Showing posts with label Lingkungan. Show all posts
Showing posts with label Lingkungan. Show all posts

Saturday, August 2, 2014

Peningkatan Mutu Sekolah

analisis penggunaan outsourcing strategy pembangunan berkelanjutan lihat aspek hidrologi bumi serpong damai tangerang analisis studi kelayakan proyek teknologi informasi lpnd abc mafia peradilan pengadilan negeri jakarta selatan penyediaan air bersih kawasan perumahan kecamatan rawalumbu kota bekasi perumahan bumi bekasi baru kemang pratama pengaruh keandalan kemudahan pemeliharaan proses akuisisi peralatan koalisi partai politik pemilihan kepala daerah secara langsung kasus pilkada provinsi banten tahun 2006 kesadaran santri kesehatan lingkungan (di pesantren ma'haduttholabah babakan tegal jawa tengah) otonomi desa sebagai upaya pendemokrasian desa (badan perwakilan desa perajin kecamatan banyuasin i kabupaten banyuasin) program pemberdayaan anak jalanan melalui rumah singgah (5 anak jalanan rumah singgah yayasan kesejahteraan anak indonesia) hubungan penanganan ispa tingkat keluarga pneumonia berat balitarawat rumah sakit kodya jakarta timur januari 1995 - mei 1996 analisis strategi pemasaran banks muamalat memasuki era persaingan perbankan sistem bagi hasil keterbukaan ekonomi dampaknya tabungan nasional bruto permintaan masyarakat atas barang final produksi negeri (kasus indonesia tahun 1968 - 1990) penyidikan tindak pidana perkosaan polda metro jaya analisis faktor-faktor berhubungan kejadianare balita kabupaten aceh tamiang tahun 2002 konflik konsensus lembaga legislatif daerah studi tentang penyelesaian kasusa kaveling dprd propinsi jawa barat kejahatan perbankan kasus bantuan likuiditas bank indonesia (blbi) tahun 1997-1998 faktor-faktor berhubungan lama hari rawat pasien operasi bagian kebidanan penyakit kandungan rumah sakit pmi bogor kekerasan anak jalanan tentang kekerasan 3 anak jalanan yayasan sekar tanjung priok jakarta utara masalah penyakit malaria upaya penanggulangannya menjelang tahun 2000 pertumbuhan linier penderita hipotiroidisme bawaan sporadikobati gerakan menuju netralitas politik birokrasi indonesia (1998-1999) fenomena kesalahan berpikir wacana sosial polltik nasional faktormensi pemilihan ritel indomart alfamart jalan salemba tengah persepsi kepadatan bagi masyarakat kalianyar (perkampungan kumuh dki jakarta) pemberdayaan penyandang cacat melalui rehabilitasi bersumberdaya masyarakat pelaksanan pemberdayaan lima orang penyandang cacat melalui rehabilitasi bersumberdaya masyarakat kelurahan dago kecamatan coblong kota bandung kapasitas pendamping pendukungnya mempengaruhi keberhasilan pendampingan pendampingan desa pantai sederhana kecamatan muara gembong bekasi analisis isi artikel aborsi surat kabar kompas suara pembaruan republika terbitan juli 1996-juni 2001 faktor-faktor berhubungan penggunaan pelayanan kesehatan bagi penderita tersangka tbparu kecamatan palu selatan kota palu tahun 2001 kepemimpinan pesantren rutinisasi kharisma pesantren as-syafi'iyah jakarta determinan kinerja dokter puskesman kasus dokter pegawai tidak tetap (ptt) karakteristik parameter akustik analisis suara pasien pasca-cedera kranioserebral sedang-berat perubahan pemanfaatan ruang lingkungan pemugaran kebayoran baru kaveling tanahjalan cikajang jalan ciranjang blok q kebayoran baru the alteration of space use restoration area of kebayoran baru case study land lot on cikajang and ciranjang street block q kebayoran baru model negara implikasi partisipasi rakyat otonomi daerah (uu no 22 tahun 1999) kajian kadar cadmium bayam (amaranthus sp) bekas lokasi pembuangan akhir sampah dki jakarta analisis faktor risiko berhubungan kejadian pneumonia balita 4 propinsi indonesia pengembangan sistem pelayanan hak kekayaan intelektual mewujudkan tingkat kepuasan pelanggan rektorat jenderal hak kekayaan intelektual perbandingan kadar laktat darah serial antara sindrom syok dengue demam berdarah dengue kebutaan sebagai akibat retinopatiabetik upaya pencegahannya tinjauan terapi nutrisiare anak modelisasi numerik ventilasi alami analisa tampilan arsitektur perumahan kota daerah beriklim tropis lembab usulan perbaikan kualitas mengatasi problem fine boring longgarvisi crank case pt yamaha indonesia motor manufakturing toxoplasma gondii - musuh selimut refleksi penerapan enabling strategy pembangunan perumahan-perumahan bertumpu kelompok (p2bpk) deteksi rna virus hepatitis c serum penderita sedang menjalani hemodialisis batu saluran kemih suatu problema gaya hidup pola makan serta analisis ekonomi pengobatannya optimasi pemotongan bahan duamensi menggunakan program linier pt port rush semarang sistem perpajakan nasional era ekonomi global fragile mental retardation and fragile x chromosomes in the indonesian population lembaga pemasyarakatan kelas i semarang pusat rehabilitasi penyalahguna narkoba provinsi jawa tengah semarang simulasi aerodinamika model simplified bus menggunakan program computational fluid dynamics dengue hemorrhagic fever in indonesia the role of cytokines in plasma leakage coagulation and fibrinolysis identifikasi berbagai aspek penentu pengembangan usaha pengolahan ikan kabupaten pasuruan jawa timur = identification on various of fixed aspect in the development of fish processing effort at pasuruan regency east java pengaruh tingkat pemahaman pengusaha kecil tentang permasalahan akuntansi pengelolaan keuangan usaha kecil pengusaha marmer tulungagung pengaruh peningkatan beban komposisi suplai energi listrik sistem konversi energi angin-hibrid faktor-faktor penyebab istri membunuh suaminya model pembinaan lembaga pemasyarakatan studi tentang kriminalitas wanita proses sosialisasinya lp khusus wanita malang tanda klinis radiologis sederhana sebagai tesagnostik alternatif selain ct-scan hematom intra kranial traumatik rumah sakit kanker semarang upaya peningkatan mutu sekolah melalui pengawasanlakukan oleh kepala sekolah meningkatkan proses belajar mengajar tentang pengawasan kepala sekolah meningkatkan proses belajar mengajar sdn pajajaran kota bandung efektivitas manajemen sistem pendidikan pelatihan sdm keperawatan (tentang manajemen sistem pelatihan tenaga perawat hemodialisis rskg nyrahabibie bandung) manajemen pelatihan karyawan bank permata cabang bandung kajian khusus kebijakan merger lima bank model perancangan interior taman kanak-kanak (taman kanak-kanak bukit dago selatan) rasionalitas konsumen membelanjakan pendapatannya (kasus pusat perbelanjaan istana plaza kota bandung) pengaruh komik jepang bentuk gambar manusiabuat oleh para siswa kelas i sman i cimahi pengembangan kinerja staf administratif pusat pendidikan profesional keahlian teknik departemen permukiman prasarana wilayah bandung peran penggunaan antibiotika topikal pasca ektraksi gram kornea analisis pengaruh modal kerja perilaku kewirausahaan pengalaman usaha lingkungan persaingan perkembangan usaha sektor informal (pada para perlilaku sektor informal jalan siliwangi kabupaten garut) profil perilaku kepemimpinan intrepreneurship kepala smk stm negeri 5 kotamadya bandung manajemen sistem pengembangan sdm lingkungan industri studi tentang pengaruh pendidikan kepuasan kerja komitmen organisasi pelatihan waktu kerja produktivitas pt indokemas industri warung plastik bandung pembauran membina nilai persatuan kesauan bangsa kodyang kel simpang enam pengembagan strategi pendidikan berbahasa santun sekolah (di sekolah menengah umum negeri 2 bandung) penilaian karyawan anggaran biaya operasi selasar sunaryo art space - bandung analisis faktor-faktor mempengaruhi permintaan jasa hotel (pada hotel melati kecamatan tarogong kabupaten garut) pengukuran indeks kenyamanan termal ruang kuliah jurusan pendidikan teknik bangunan fptk upi (ruang 69a ruang 70 jptb fptk upi) hubungan antara persepsi mahasiswa praktikan tentang micro teaching supervisi ppl kemampuan mengajar mahasiswa praktikan (suatu kasus mahasiswa praktikan ppl jurusan pendidikan ekonomi tahun akademik 2003-2004) peranan perempuan kegiatan melukis desa jelekong kabupaten bandung propinsi jawa barat (eli ibu yuyum ibu alit) kendala penggunaan data kependudukan perencanaan evaluasi program kesehatan puskesmas [kasus kabupaten dati ii blitar] penggunaan metoda geolistrik penyelidikan daerah rawan longsong (longsoran kecamatan pakenjeng kabupaten garut) proses pembelajaran pemulihan fitrah insani anak jalananlihat segi perencanaan proses hasil dampak pembelajaran kemampuan manajerial pengelola peningkatan prestasi kelembagaan pusat kegiatan belajar masyarakat pkbm (pada pkbm konengsari kecamatan ngamprah kabupaten bandung) pengaruh sikap anggota koperasi kualitas pelayanan partisispasi anggota serta implikasinya perkembangan usaha (pada koperasi unit desa kabupaten majalengka) evaluasi kinerja jaringan air bersih desa cikadut (wilayah desa cikadut kecamatan cimenyan kabupaten bandung) efektivitas pendidikan pelatihan berbasis kecerdasan emosi spiritual depdiklat daarut tauhiid bandung(pada peserta pelatihan manajemen qolbu reguler lingkungan pt pln (persero) area pelayanan jaringan bandung) identifikasi sesar metode geomagnet(sesar cimandiri sukabumi jawa barat) studi korelasi antara sikap ilmiah mahasiswa prestasi akademiknya ( mahasiswa progra s-1 jurusan pendidikan teknik mesin fptk upi angkatan tahun 2001 mata kuliah teknik merancang) analisis ungkapan ~vte kudasai ~vte hoshii ~vte moraitai sebagai sinonim analisis faktor-faktor mempengaruhi efektivitas kebijakan pemerintah daerah menanggulangi kemiskinan masyarakat pedesaan (pada pelaksanaan kebijakan program pengembangan kecamatan kabupaten cirebon) nteraksi sosial anak tunarungu teman sebaya jam istirahat sekolah reguler (tentang anak tunarungu berinteraksi sosial teman sebaya anak mendengar jam istirahat sd r kec pakis kab malang tahun 2005) nilai ekonomi hasil air hutan kawasan lindung hutan lindung lawu selatan kawasan lindung hutan rakyat sumberejo analisis faktor-faktor mempengaruhi proses produksi (pada perusahaan garment cvia persada) pengaruh bahan baku pesaing teknologi penawaran produksi tempe (di kabupaten majalengka jawa barat) pengaruh harga harga barang substitusi upah harga bahan baku jumlah penawaran batao (industri kecil batako kecamatan cimahi selatan) analisis deskripsi kegiatan belajar mengajar mata kuliah bidang studi upaya menumbuhkan sikap kewiraswastaan (kasus kegiatan belajar mengajar tiga mata kuliah bidang studi) penerapan metode kerja 5r (5s) pt tanabe indonesia pharmaceutical manufacturer bandung (pada departemen produksi pt tanabe indonesia pharmaceutical manufacturer bandung) pemanfaatan ruang terbuka sebagai ruang interaksi sosial penghuni perumnas sarijadi pengukuran indeks kenyamanan termal ruang kuliah jurusan pendidikan teknik bangunan fptk upi metode et/cet (effective temperature/ corrected effective temperature) (ruang 69a 70) tipologi menara mesjid kota bandung peran nilai tradisional melestarikan lingkungan hidup kampung kuta desa karangpaningal kecamatan tambaksari kabupaten ciamis faktor-faktor mempengaruhi produktivitas perusahaan industri kecil unggulan (pada industri kecil unggulan kabupaten garut) pengingkaran putusan perdamaian oleh salah satu pihak berperkara pengadilan negeri surakarta suatu tinjauan mengenai pengajaran berbicara program pendidikan bahasa jepang jpba fpbs upi profil keterampilan proses sains siswa melalui praktikum konsep ekosistem (study kasus man i bandung) efektivitas pengelolaan program akselerasi smu labschool jakarta (pada smu lab school jakarta) simulasi rancang bangun tracker sebagai alat pengaman kendaraan menggunakan sistem penentuan posisi melalui pemrograman visual basic (pembahasan software) analisis perbedaan hasil perhitungan pajak penghasilan menurut wajib pajak hasil pemeriksaan fiskus ( wajib pajak badan menyampaikan spt tahunan pph kurang bayar kpp tasikmalaya) pola kinerja siswa pembelajaran pemecahan masalah konsep indikator asam basa (di salah satu smkn bandung) analisis implikatur percakapan roman un chec de maigret karya georges simenon analisis faktor-faktor sosial ekonomi mempengaruhi perubahan pengeluaran konsumsi masyarakat (di kecamatan cileunyi sebagai salah satu daerah bercorak urban kabupaten bandung) pengaruh tingkat risiko kredit laba perusahaan bri unit cikoneng cabang ciamis efektivitas penerapan learning organization berbasis kecerdasan emosi spiritual pt pln (persero) stribusi jawa barat banten (pada bagian pengembangan sdm organisasi) tinjauan hukum pembatalan perkawinan akibat hukum anaklahirkan (di pengadilan agama surakarta) faktor-faktor mempengaruhi pendapatan industri skala kecil makanan kota cimahi (pada industri kecil industri rumah tangga kerupuk tahu kota cimahi) peranan pemberitaan kriminalitas surat kabar membentuk kesadaran hukum siswa (studi deskriptif analitis sma negeri i baleendah kabupaten bandung) kebijakan nizam-i-islam pakistan masa pemerintahan muhammad zia ul-haq 1977-1988 problematika pembelajaran pendidikan jasmani bagi tunanetra sekolah umum ( siswa tunanetra sman 7 kota bandung) pengaruh implementasi otonomi daerah bidang pendidikan motivasi kerja pegawainas pendidikan kabupaten ciamis ( pendapat pegawainas pendidikan) efektivitas implementasi kurikulum berbasis kompetensi program keahlian administrasi perkantoran sekolah menengah kejuruan (smk) negeri i kota bandung pelaksanaan model pembelajaran portofolio (portfolio based learning) mata mengembangkan keterampilan berfikir kritis kajian tingkat kenyamanan audio ruang auditorium jica fpmipa upi pembelajaran ekstrakurikuler pembinaan perilaku santun siswa (pada sdn i karangpawulang kota bandung) upaya pondok pesantren membina akhlak wanita tuna susila pondok pesantren dar al-taubah bandung penyelesaian kredit macet pt bank perkreditan rakyat cita dewi colomadu kabupaten karanganyar pola pengasuhan anak balita membina kepribadian tiga keluarga kelompok program bina keluarga balita kotif tasikmalaya proses pengembangan kemampuan mengajar meneliti tenaga edukatif universitas sebelas maret surakarta (kualitatif) implementasi mata kuliah budaya sunda sebagai muatan lokal pembinaan akhlak mahasiswa fkip unpas sign sebagai bentuk komunikasi arsitektur mengacu teori charles pierce robert venturi ( kawasan pertokoan cihampelas) pola kaderisasi kiai upaya penanaman aqidah syari'ah membina sikap kekiaian santri pesantren asyrafuddin conggeang sumedang pembinaan nilai kemanusiaan kepedulian sosial melalui latihan ibadah kurban pembinaan para siswa smu negeri 2 bandar lampung strategi pembinaan pengembangan tenaga akademik perguruan tinggi meningkatkan mutu pendidikan tinggi (di perguruan tinggi swasta jakarta) penerapan konsep pendidikan luar sekolah pembinaan penyuluhan industri kecil studi tentang proses pembelajaran pengusaha industri kecil kain besurek kotamadya bengkulu efektivitas pelaksanaan pelatihan tenaga perawat rumah sakit (tentang pelaksanaan pelatihan tenaga perawat rsup dr hasan sadikin bandung) kewiraswastaan kalangan pemuda tani simpang tutup kabupaten kerinci tindakan hukum komisi pemilihan umum efektivitas model pembelajaran program kejar paket b setara sekolah lanjutan tingkat pertama serta dampaknya warga belajar kejar paket b setara sltp skb kabkuningan prop jabar studi evaluatif penyelenggaraan programii kearsipan universitas padjadjaran kontribusi lulusannya kinerja tenaga/personil kearsipan pemerintah propinsi jawa barat efektivitas pemberdayaan tim pelaksana usaha kesehatan sekolah pengaruhnya kesehatan siswa sekolah dasar (kasus tim pelaksana uks kota bandung tahun 2000/2001) uji hayati kronis (life table) daphnia magna pengujian kualitas air sungai cikapundung strategi manajemen pengembangan dosen yunior institut agama islam negeri sulthan syarif qasim pekanbaru riau kepemimpinan manajerial pimpinan sekolah tinggi kedinasan pengelolaan sistem pembelajaran menunjang peningkatan produktivitas sekolah (pada sekolah tinggi kesejahteraan sosial bandung) pengaruh fungsi manajemen informasi efektivitas program imunisasi hubungannya perubahan perilaku ibu (implementasi program imunisasi anak balita kota bandung) peranan kepala cabangnas pendidikan manajemen kinerja efektif kepala sekolah dasar rangka pengembangan sumber daya manusia (tentang peranan kepala cabangnas pendidikan kota bandung) implementasi pengawasan melekat dampaknya kinerja karyawannas pendidikan pengajaran (di kota bogor 1999/2000) efektivitas pelaksanaan fungsi koordinasi proses manajemen adkademik universitas islam nusantara bandung (di universitas islam nusantara bandung) kajian tahun 2000 2001 pengaruh laba arus kas kemampuan manajerial pengelola peningkatan prestasi kelembagaan pusat kegiatan belajar masyarakat [pkbm] pkbm kongensari kecamatan ngamprah kabupaten bandung strategi kognitif mahasiswa menyelesaikan soal mekanika pengembangan model manajemen pembinaan siswa peserta program khusus sekolah menengah umum (pada smu negeri 1 cisarua bekerjasama yayasan darmaloka pemda jawa barat) manajemen pelatihan pemberdayaan usaha industri kecil kabupaten bogor (program pembinaan {melalui pelatihan} industri kecil cabangnas perindustrian} profil kompetensi profesional guru sltp ( kinerja guru sltp negeri 50 bandung) efektivitas manajemen sistem pendidikan pelatihan sdm keperawatan (tentang manajemen sistem pelatihan tenaga perawat hemodialisis rskg ny r a habibie bandung) analisis perbandingan kekuatan komponen struktur baja mengalami pembebanan kombinasi metode desain faktor beban tahanan (lrfd) metode desain tegangan ijin (asd) pengaruh penempatan kepuasan produktivitas kerja guru (pada guru pns sltpn lingkungan cabangnas pendidikan tanjungsari sukasari pamulihan kabupaten sumedang) keterampilan manajerial kepala sekolah meningkatkan mutu pendidikan (pada smun 8 kota bandung tahun 2002) manajemen hubungan sekolah masyarakat memberdayakan masyarakat industri program pendidikan sekolah peranan sistem informasi akuntansi penjualan meningkatkan efektifitas pengendalian intern hasil penjualan koperasi peternak sapi bandung utara (kpsbu) lembang peranan kepemimpinan kepala sekolah meningkatkan mutu pendidikan (pada sltpn kecamatan subang kabupaten subang) peningkatan fungsi administrasi akademik proses belajar mengajar pendidikan agama islam (di lingkungan sltp pgri ujungberung bandung) produktivitas tenaga struktural kependidikannas pendidikan kabupaten (analisis efektivitas efisiensi kinerja pejabat struktural pascamergernas pendidikan kabupaten indragiri hulu provinsi riau tahun 2003) solusi perilaku sistem satu massa peredam vibrasiberi gaya eksitasi parametrik menggunakan metode numerik pengaruh kompetensi profesional iklim organisasi kinerja dosen (pada akademi keperawatan budi luruh ahmad yani cimahi) analisis faktor-faktor mempengaruhi perilaku berkoperasi siswa (pada siswa sma /smk negeri kabupaten kuningan) pengaruh motivasi berprestasi latar belakang pendidikan kinerja guru (pada sekolah menengah kejuruan negeri kelompok teknologi industri kota bandung tahun 2004) manajemen pembiayaan pendidikan mutu pendidikan lembaga pendidikan swasta (di lembaga pendidikan bahasa asing lia mmc els cinderella bandung tahun 2002 - 2003) pandangan penguasaan guru inti sltp matematika guru inti matematika sltp bandung peranan pelaksanaan audit ekonomi efisiensi menunjang efektivitas pengendalian intern anggaran operasional (pada pt pindad (persero) ) pengaruh pesan iklan pencurian listrik pt pln (persero) stribusi jawa barat banten melalui radio pengajaran remidial sebagai upaya mengoptimalkan penguasaan siswa mata pelajaran matematika sekolah dasar negeri nanjung iii margaasih kabupaten bandung keyakinan guru konsep cbsa implementasinya pembelajaran matematika guru sd kelas iv kota bandung model cooperative learning pola pembinaan koperasi mahasiswa universitas langlangbuana bandung koperasi mahasiswa universitas langlangbuana bandung kemampuan siswa membangun model fisikakaitkan prestasi belajarnya studi deskriptif sma negeri 3 tasikmalaya e-learning sebagai sumber pembelajaran meningkatkan pemahaman mata pelajaran pendidikan kewarganegaraan sma negeri 3 bandung tahun 2006 upaya memahami konsep sifat kegunaan air menggunakan pendekatan keterampilan proses pembelajaran ipa sekolah dasar siswa kelas iv sekolah dasar kabupaten buton pengaruh modal kerja teknologi produksi harga penawaran sepatu (industri kecil sepatu cibaduyut kota bandung) pengembangan model pembelajaran keterampilan proses sains melalui praktikum topik materi perubahannya suatu kelas i man model pembelajaran kimia pendekatan sains-teknologi-masyarakat [s-t-m] pokok bahasan pencemaran air suatu salah satu man palembang dampak pengajaran guru hasil belajartinjau keterampilan intelektual siswa topik suhu kalor siswa kelas i smu negeri lembang kabupaten bandung peranan sistem informasi akuntansi menunjang efektivitas proses pemberian kredit kemampuan siswa membangun model fisika konsep suhu kalor hubungan persepsi wajib pajak badan mengenai undang-undang pajak penghasilan penghematan pajak penghasilan( wajib pajak badan kpp tasikmalaya) analisis faktor-faktor mempengaruhi daya saing industri kecil menengah(ikm) pertenunan (suatu kasus ikm pertenunan kecamatan majalaya kabbandung) pembelajaran fisika tentang fluida bergerak melalui proses penemuan siswa sma kelas xi analisis faktor-faktor mempengaruhi pengambilan keputusan menjadi pemegang polis asuransi pendidikan jiwasraya (suatu kasus pegawai pemerintah kota bandung) program pemberdayaan orang tua agar mampu membantu mengembangkan keterampilan anak tunaganda slb-g ybmu baleendah kab bandung program bimbingan perkembangan terintegrasi pembelajaran taman kanak-kanak tentang upaya pengembangan aspek fisik emosi sosial intelektual anak taman kanak-kanak laboratorium sekolah percontohan upi bandung upaya orang tua guru tk mencegah perkembangan emosi anak usiani rangka menyusun rancangan program bimbingan tk laboratorium universitas pendidikan indonesia analisis pengaruh harga jualferensiasi produk saluranstribusi pendapatan (suatu kasus usaha kerajinan anyaman bambu kecamatan palasah kabupaten majalengka) analisis faktor-faktor mempengaruhi produktivitas perusahaan (suatu kasus perusahaan jasa pelaksana konstruksi pt matrix primatama bandung) pengaruh pelaksanaan anggaran biaya produksi pencapaian laba perusahaan pengembangan kemampuan widyaiswara balai besar pendidikan pelatihan kesejahteraan sosial [bbppks] bandung [ tentang proses pengembangan kemampuan widyaiswara bbppks bandungtahun 2003-2004] strategi tindak tutur pendongeng radio membawakan cerita anak ( cara bertutur pendongeng radio kids fm) pengaruh perilaku kewirausahaan partisipasi anggota manajemen keanggotaan struktur modal keberhasilan usaha koperasi (suatu kasus koperasi pasar kota bandung) peranan dunia industri meningkatkan mutu praktik kerja industri program keahlian teknik gambar bangunan (smk negeri 5 bandung) studi motivasi kerja pegawai instansi sekolah calon perwira angkatan darat (secapaad) hubungan antara aksesibilitas daya serap siswa (di smp pasundan 5 bandung) analisis faktor-faktor mempengaruhi kredit bermasalah (suatu kasus program kreasi perum pegadaian kantor cabang cimahi) analisis pemeriksaan pajak tingkat kepatuhan wajib pajak pemenuhan kewajiban perpajakan pph pasal 21 (pada kpp bandung karees) pengaruh biaya tenaga kerja produktivitas tenaga kerja pt pupuk kujang (persero) manajemen praktek kerja industri sistem ganda industri otomotif (tentang manajemen prakerin smk merdeka bandung) romosi jabatan fungsional tenaga pengajar tetap yayasan pts propinsi bengkulu (pada universitas muhammadiyah bengkulubandingkan kasus universitas prof dr hazairin sh bengkulu) tanggung jawab pidana pelaku penipuan melalui sms berhadiah pengaruh penerapan program akselerasi (precepatan belajar) efektivitasri anak berbakat (suatu kasus siswa-siswi akselerasi sman 3 bandung smak 1 bpk penabur) pengaruh persepsi siswa tentang profesionalisme guru prestasi belajar siswa mata pelajaran komputer akuntansi (pada smk negeri 11 bandung) pengajaran kontak mata anak autis menggunakan penerapan strategi okupasi (pada anak autis sd mutiara bunda bandung) kansha hyougen (analisis deskriptif bahasa surat) pengaruh modal harga bahan baku kemampuan tenaga kerja hasil produksi (suatu kasus industri kecil pengrajin boneka kota bandung) pengaruh persepsi siswa tentang unit produksi minat siswa ikut unit produksi siswa sekolah menengah kejuruan negeri 5 bandung persepsi siswa tentang tayangan berita kriminal televisi perilaku agresif (studi deskriptif analitis siswa sma negeri 23 bandung) analisis perbandingan perhitungan laba sebelum pajak menurut standar akuntansi keuangan penghasilan kena pajak menurut ketentuan peraturan perundang-undangan perpajakan (pada pt pos indonesia (persero) tahun 2002 - 2005) pengembangan program bimbingan penyesuaian sosial siswa sekolah menengah atas implementasi pendekatan problem possing (hadap masalah) pemahaman konsep kompetensi perhitungan statika bangunan smkn 6 bandung tinjauan hukum serangan virus the trojan horse internethubungkan tindak pidana penghancuran pengrusakan barang kitab undang undang hukum pidana pengaruh non performing loan rentabilitas bank (kasus pt bank bukopin cabang bandung periode bulan januari 2005-mei 2006) implementasi iso 90012000 perusahaan jasa konstruksi (pt pembangunan perumahan (persero) ) herdi ardhiansyah-e014 993159 profil kecakapan hidup tunadaksa dewasa (pada seorang mouthpainter) hubungan persepsi siswa tentang kinerja guru prestasi belajar mataklat kelistrikan otomotif (smk negeri 8 bandung bptp) pemanfaatan hasil evaluasi program bagi peningkatan kualitas mengajar instruktur sentra pendidikan bri lembang bandung (studi deskriptif sentra pendidikan bri lembang - bandung) pengaruh ketersediaan alat bahan praktik motivasi siswa melakukan praktik mata pelajaran praktik kerja batu studi komparasi prestasi belajar pesertaklat kelas binaan astra kelas reguler programklat perbaikan chasis pemindah tenaga (di smk negeri 6 bandung) pengaruh pemanfaatan fasilitas internet sebagai salah satu sumber belajar siswa prestasi belajar (membuat animasi tingkat dasar smkn 1 cimahi) analisis wacana kritis pemberitaan lumpur lapindo (pada harian umum media indonesia pikiran rakyat) register bahasa pemandu wisata (penggunaan bahasa pemandu wisata daerah bandung) analisis hubungan perlakuan hasil penjualan sisa bahan harga pokok produk analisis kesalahan pelafalan fonem bahasa prancis mahasiswa pendidikan bahasa prancis fpbs upi semester iv tahun ajaran 2006/2007 penggunaanglosia harian umum pikiran rakyat tribun jabar bimbingan belajar bagi anak hiperaktif sekolah dasar pengaruh perilaku kepemimpinan kyai dam motif berprestasi guru efektivitas pengelolaan pesantren pondok pesantren darul hikmah sumedang reaksi pasar modal ex-dividend date termotivasi pembagianviden bursa efek jakarta (perusahaan manufaktur terdaftar bursa efek jakarta) kemampuan orangtua mengembangkan kecerdasan emosional anak pengembangan program hipotetik pelatihan meningkatkan kemampuan orangtua mengembangkan kecerdasan emosional beberapa taman kanak-kanak kecamatan ungaran kabupaten semarang pengaruh kebiasaan belajar fasilitas belajar pemberian embedded test proses pembelajaran prestasi belajar siswa mata pelajaran ekonomi (pada siswa kelas xi ma al-inayah kota bandung) pengaruh penerapan total quality control (tqc) pencapaian tingkat ekonomis biaya produksi (kasusvisi tempa cor pt pindad (persero) ) pengaruh volume pemberian kredit tingkat pendapatan bank (suatu kasus bank jabar bandung) pengembangan program bimbingan sosial siswa sekolah dasar melaksanakan pendidikan inklusi sd lab upi kampus cibiru sd sains al biruninamika politik pedesaan pemilihan kepala desa pengaruh profit margin tingkat rentabilitas ekonomi pt industri telekomunikasi indonesia (persero) pengaruh jumlah pemberian kredit efektivitas perolehan laba (suatu kasus bank jabar) pengaruh biaya pengendalian kualitas efektivitas produksi (pada pt pindad (persero) ) pengaruh penerapan good corporate governance informasi kinerja keuangan pt pos indonesia (persero) visi good corporate governancevisi akuntansi serta anggaran pengaruh biaya operasional laba operasional perusahaan pt pindad (persero) visi tempa cor analisis efektivitas retribusi pelayanan persampahan pasar kabupaten cirebon (pada pasar pasalaran pasar palimanan kab cirebon) faktor-faktor kesulitan pembinaan nilai-nilai agama usia transisi serta upaya penanggulangannya guru siswa orang tua siswa tingkat sekolah dasar sekolah menengah pertama nurul huda nyalindung kabupaten bandung analisis kompetensi profesional guru mataklat kejuruan [produktif]program keahlian administrasi perkantoran smk negeri 1 bandung bidang keahlian bisnis manajemen pengaruh motivasi belajar persepsi siswa mengenai kompetensi guru fasilitas belajar prestasi belajar siswa mata pelajaran ekonomi (suatu kasus sman kota bandung) pengaruh pendidikan pelatihan kemampuan berwirausaha implikasinya keberhasilan berwirausaha kbu (pada kbu kabupaten subang bagian selatan) implementasi kebijakan pendanaan pendidikan upaya pembangunan pendidikan kota bandung implementasi program pendidikan teknologi dasar sekolah menengah pertamakaitkan vokasionalisasi pendidikan smp taruna bakti bandung pengaruh sistem akuntansi instansi (sai) tingkat satuan kerja peningkatan efektivitas pengendalian intern (pada pppg kota bandung) analisis faktor-faktor mempengaruhi permintaan jasa hotel (pada hotel melati sekota bandung) identifikasi kompetensi guru ekonomi pengaruhnya prestasi belajar siswa mata pelajaran ekonomi (suatu kasus sma pasundan kota bandung) pengaruh motivasi belajar persepsi siswa tentang kemampuan mengajar guru prestasi belajar siswa (suatu kasus bimbingan belajar nurul fikri) analisis kontribusi pendapatan bagi hasil pendapatan jual beli pendapatan operasi bank syariah (pada pt bank muamalat indonesia tbk) pengaruh penggunaan teknologi serta pendidikan pelatihan produktivitas budidaya tanaman teh (pada afdeling perkebunan ptpn viii wilayah kecamatan ciwidey) analisis keunggulan bersaing pengaruhnya ekspor furniture suatu kasus industri kerajinan rotan kabupaten cirebon analisis faktor-faktor mempengaruhi rasionalitas perilaku konsumsi anak kost (pada anak kost kelurahan isola kecamatan sukasari kota bandung) peranan biaya standar pengendalian biaya produksi guna mencapai efisiensi biaya (pada pt mega cipta busana) analisis penerapan metode pengakuan pendapatan jasa telekomunikasi keakuratan penyajian laba operasional pengaruh pelaksanaan anggaran biaya operasional pencapaian laba operasional (pada kantor wilayah usaha pos-v bandung) pengaruh biaya pemasaran pendapatan pt tunas wargi jaya cilegon (kasus pt tunas wargi jaya periode 2004 2005 2006) moina macrocopa sebagai bioindikator alternatif pengujian kualitas air sungai cikapundung penyidikan tindak pidana kehutanan oleh satuan resere kriminal polres fakfak rangka operasi hutan lestari ii tahun 2005 (study kasus ipkma madewana) studi tentang manajemen sistem pelaksanaan penapisan gizi buruknas kesehatan kabupaten boyolali penatalaksanaan micro waveathermy terapi latihan william flexion exercise kondisi nyeri punggung bawah miogenik rsud dr moewardi surakarta analisis pengaruh human relation kondisi fisik lingkungan kerja leadership etos kerja karyawan kantor pendapatan daerah pati penatalaksanaan terapi latihan post operative fracture intercondiler humeri sinistra pemasangan plate and screw rso prof dr soeharso surakarta penatalaksanaan terapi latihan post sectio caesaria akibat pre eklampsi berat rsud dr moewardi surakarta proses penyidikan tindak pidana kekerasanlakukan oleh pelajar wilayah hukum polres magetan perbandingan penjadwalan n job m mesin meminimasi total weighted earliness menggunakan algoritma heuristik mmjd metode last due date kemungkinan penerapan metode activity based costing sebagai sistem penentuan tarif rawat inap rsud giriwono wonogiri faktor-faktor mempengaruhi partisipasi kader jumantik pemberantasan dbd desa ketitang kecamatan nogosari kabupaten boyolali tahun 2009 penatalaksanaan fisioterapi ischialgia short waveathermy terapi latihan rsud sragen karakteristik pemakaian bahasa guru tk pertiwi 02 jetis proses belajar mengajar hubungan insiden ikterus neonatorum persalinan secara vakum ekstraksi asuhan keperawatan ny p gangguan sistem persyarafan stroke non hemoragik (snh) ruang sindoro rsud boyolali asuhan keperawatan ny h combustio bangsal anggrek brsud sukoharjo penatalaksanaan terapi latihan kondisi post orif fraktur tibia 1/3 medial fibula 1/3 proksimal dekstra pemasangan plate and screw bangsal bougenville rumah sakit orthopedi prof dr soeharso surakarta hubungan antara jumlah anggota jumlah penjualan perolehan sisa hasil usaha pusat koperasi waris strategi coping istri mengalami kekerasan rumah tangga usulan penerapan sistem kanban menggunakan kartu kanban produksi sebagai salah satu upaya mengurangi pemborosan terjadi produk ksa 32 simulasi assembling kekuatan lift barang portable kapasitas maximum 500 kg tinggi 2 meter program catia v5 r15 sistem informasi profil jurusan matematika berbasis web (pada jurusan pendidikan matematika fakultas keguruan ilmu pendidikan universitas muhammadiyah surakarta tahun ajaran 2007/2008) penatalaksanaan terapi latihan kondisi post sectio caesaria akibat kala ii lama rsud dr moewardi surakarta penatalaksanaan terapi latihan pasien stroke non hemoregik stadium akut rsud sragen penatalaksanaan terapi latihan kondisi post oref fraktur tibia 1/3stal proksimal dextra pemasangan plate and screw tinjauan aspek klinis resep tiga apotek kota surakarta periode januari-juni 2008 faktor-faktor berhubungan kejadian preeklampsia rsud dr moewardi surakarta hubungan antara tingkat pengetahuan kepala keluarga tentang pencegahan demam berdarah dengue (dbd) container index desa gondang tani kebupaten sragen tahun 2008 hubungan antara kecerdasan emosi penyesuaian perkawinan pasangan remaja penatalaksanaan terapi latihan paraplegi frankle d post laminectomy akibat fraktur kompresi vertebra lumbal iii rsup dr kariadi semarang kampanye waspada hama wereng kepada petani jawa barat asuhan keperawatan tnes post orif fraktur klavikula sinistra ruang mawar rumah sakit umum daerah sragen penatalaksanaan terapi latihan pasien paska stroke non hemoragik dekstra stadium akut hubungan tingkat pengetahuan perawat tentang keselamatan pasien kepatuhan pelaksanaan prinsip pemberian obat injeksi rumah sakit islam surakarta perilaku koping anggota samapta polri ketika menghadapi kerusuhan massa penatalaksanaan fisioterapi kondisi low back pain miogenik rsud boyolali penerapan activity-based costing system sebagai alternatif penentuan harga pokok produksi (studi pt jamu air mancur surakarta) peran pusat studi dakwah islam mahasiswa (pusdam al shahwah) sleman meningkatkan mutu bacaan al qur' n tahun 2006/ 2007 penatalaksanaan terapi latihan hemiparese sinistra post stroke non haemoragic stadium recovery penerapan azas sederhana cepat biaya ringan pemeriksaan perkara perdata melalui mediasi berdasarkan perma no o1 tahun 2008 pengadilan negeri surakarta penerapan metode activity-based costing system menentukan besarnya tarif jasa rawat inap (survey rsud kabupaten sukoharjo) kesiapan pemerintah daerah melaksanakan pelayanan publik berbasis e-government evaluasi sistem akuntansi pengelolaan aktiva tetap pt jamsostek (persero) kantor cabang surakarta hubungan kondisi fisik rumah lingkungan sekitar rumah kejadian malaria desa ketosari kecamatan bener kabupaten purworejo penatalaksanaan fisioterapi kondisi hemiparese dextra post stroke non haemoragik rsup dr kariadi semarang penatalaksanaan terapi latihan pasien paska stroke hemorage dextr stadium recovery analisis biaya penggunaan antibiotik pasien infeksi saluran kemih rawat inap rsu pandan arang boyolali tahun 2008 hubungan pengetahuan tentang flu burung sikap masyarakat memelihara unggas wilayah mojogedang penatalaksanaan terapi latihan post operasi fraktur femur 1/3stal dextra pemasangan plate and screw rsal dr ramelan surabaya analisis kinerja keuangan ksps-baitul maal wat tamwil (bmt) nar barokah jumapolo karanganyar tahun 2007-2008 peranan baitul mal wat tamwil (bmt) buana peningkatan pendapatan pedagang kecil desa mulur kecamatan bendosari kabupaten sukoharjo penatalaksanaan terapi latihan post operasi fraktur femur 1/3stal dextra pemasangan plate and screw rsal dr ramelan surabaya engaruh pelatihan kinerja pamong belajar kinerja pamong belajar sanggar kegiatan belajar magetan propinsi jawa timur pengaruh berita pilkada hu pikiran rakyat pembentukan pilihan para pemilih kabbandung tinjauan aspek farmasetik resep racikan tiga apotek kota surakarta periode januari-juni 2008 asuhan keperawatan an a kejang demam (febris convulsive) bangsal edelweiss rsud pandan arang boyolali praperadilan sebagai upaya kontrol bagi penyidik perkara pidana tinjauan potensi interaksi obat pengobatan hipertensi pasien geriatri rs pku muhammadiyah surakarta tahun 2007 asuhan keperawatan keluarga keluarga tns masalah utama stroke hemoragik nysgambiran makam haji kartasura sukoharjo hubungan antenatal care angka kejadian bblr rsud sragen tahun 2006-2007 pengaruh partisipasi proses penyusunan apbd berbasis anggaran kinerja kinerja manajerial pemerintah daerah motivasi sebagai variabel moderating (survei pemerintah daerah kabupaten karanganyar) asuhan keperawatan ant demam typhoid ruang melati rsud dr moewardi surakarta faktor risiko kejadian penyakit menular seksual (pms) komunitas gay mitra strategis perkumpulan keluarga berencana indonesia (pkbi) yogyakarta penatalaksanan terapi latihan post operasi open fractur cruris 1/3stal dextra pemasangan internal fixasi bangsal cempaka rs orthopedi surakarta perencanaan pengembangan sumber daya manusia aparatur pemerintah kota bandung perubahan kemampuan kognitif klien skizofrenia setelahberikan terapi aktifitas kelompok stimulasi persepsi rumah sakit jiwa daerah surakarta gambaran asupan zat gizi makro status gizi penderita tuberkulosis paru rsud dr moewardi surakarta tinjauan aspek farmasetik resep racikan tiga apotek kabupaten pemalang periode januari-juni 2008 pola penggunaan antibiotika penderita gastroenteritis akut pediatri instalasi rawat inap rumah sakit umum daerah tingkat ii wonogiri januari sampai juni tahun 2008 penatalaksanaan terapi latihan motor relearning programme kondisi hemiparese sinistra post stroke non haemoragic rsud sukoharjo hubungan interval persalinan kejadian pre-eklampsia rumah sakit islam yayasan kesehatan kesejahteraan islam (yakssi) sragen pengaruh partisipasi proses penyusunan apbd berbasis anggaran kinerja kinerja manajerial motivasi sebagai variabel moderating (survei pemerintah daerah kabupaten klaten) analisis pengaruh human relation kondisi fisik lingkungan kerja leadership etos kerja karyawan kantor pendapatan daerah pati analisis rasio keuangan mengukur efisiensi penggunaana pt pln (persero) area pelayanan pelanggan semara studi eksperimen proses wire drawing kawat tembaga variasi sudut masuke pengaruh efektivitas keandalan pengendalian intern kas kewajaran penyajian laporan arus kas analisis faktor-faktor berpengaruh perilaku masyarakat santri menjadi nasabah non nasabah bank syariah (studi kabupaten klaten sukoharjo) time out alternatif modivikasi perilaku penanganan anak adhd (attention deficit/hyperactivitysorder) hubungan antara faktor lingkungan sosial perilaku reproduksi remaja sma n i jatisrono kabupaten wonogiri tahun 2009 penatalaksanaan fisioterapi congestive heart failure nyha ii ec pericardiac efusion rsdrkariadi semarang hubungan antara jenis anestesi kejadian asfiksia neonatorum bayilahirkan secara sectio caesarea preeklamsia rsud dr moewardi surakarta hubungan frekuensi pemeriksaan antenatal care kematian maternal tahun 1998-2008 rumah sakit pku muhammadiyah surakarta asuhan keperawatan sdr g gangguan sistem pencernaan typus abdominalis ruang cempaka rsud sukoharjo hubungan antara masa kerja anggota polisi lalu lintas bertugas lapangan derajat berat vena varikosa perbedaan cardiothoracic ratio foto thorax standar usia bawah 60 tahun atas 60 tahun penyakit hipertensi rs pku muhammadiyah surakarta hubungan antara sense of humor somatisasi analisis perbandingan anggaran realisasi penjualan meningkatkan kinerja penatalaksanaan terapi latihan kondisi pasca operasi fraktur cruris 1/3 proximal sinistra pemasangan plate and screw bangsal cempaka rso prof dr r soeharso surakarta penatalaksanan terapi latihan post operasi fracture cruris 1/3stal dexstra pemasangan internal fiksasi plate and screw bangsal cempaka rs orthopedi surakarta gambaran asupan zat gizi makro status gizi penderita tuberkulosis paru rawat inap rsud dr moewardi surakarta analisis sistem akuntansi penjualan cv gion rahayu kartasura penatalaksanaan terapi latihan kondisi post operasi fraktur femur 1/3stal dextra pemasangan plate and screw rsal dr ramelan surabaya asuhan keperawatan ny s pneumonia ruang cempaka rsud pandan arang boyolali proses penyidikan tindak pidana kekerasanlakukan oleh pelajar wilayah hukum polres magetan penatalaksanaan transcutaneus electrical nerve stimulation (tens) william flexi exercise kondisi low back pain karena spondylosis lumbales rsud moewardi surakarta pengukuran kinerja menggunakan balanced scorecard pdam boyolali hubungan antara pengetahuan keluarga perilaku pencegahan flu burung desa kiping kecamatan sambungmacan kabupaten sragen perencanaan penjadwalan pembangunan perumahan permata kopo pengendalian menggunakan metode konsep nilai hasil (rumah type-70) pt marga tirta kencana laporan komprehensif asuhan keperawatan ny n post partus normal ruang mawar i rsud dr moewardi surakarta asuhan keperawatan keluarga tn s tb paru nn m sumber rt 01 rw 12 surakarta penatalaksanaan terapi latihan kondisi hemiparese dextra pasca stroke non hemoragik analisis efektivitas biaya penggunaan antidiabetik tunggal pasienabetes melitus tipe 2 rawat jalan rsu pandan arang boyolali tahun 2008 upaya peningkatan minat belajar matematika melalui pembelajaran remedial kerja kelompok (ptk pembelajaran matematika kelas v sd negeri 1 bangsalan) identifikasi drug related problems pasien anak demam berdarah instalasi rawat inap rumah sakit umum daerah wonogiri tahun 2007 pembelajaran apresiasi drama siswa kelas viii a smp negeri 16 surakarta tahun ajaran 2007 2008 penatalaksanaan terapi latihan kondisi pasca operasi sectio caesarea rsud dr moewardi surakarta penatalaksanaan fisioterapi bell s palsy sinistra rsud dr moewardi surakarta asuhan keperawatan tn k gangguan sistem pernafasan tuberkulosis paru ruang edelweis rsud sukoharjo analisis sistem informasi internal berbasis web penatalaksanaan fisioterapi kondisi hemiparese dextra post stroke non haemoragik rsud dr moewardi surakarta asuhan keperawatan keluarga tn m masalah gangguan sistem cardiovaskuler hipertensi khususnya ny s desa dukuh rt 1 rw 03 wilayah kerja puskesmas sukoharjo i implementasi peran badan permusyawaratan desa (bpd) pemberdayaan pemerintahan pemberdayaan masyarakat desa desa mojoreno kecamatan sidoharjo kabupaten wonogiri penatalaksanaan fisioterapi ischialgia sinistra modalitas infra red william flexion exercise rsal ramelan surabaya analisis kinerja keuangan baitul maal wat tamwil (bmt) kabupaten klaten tahun 2005 pengaruh motivasi perilaku pemimpin kesempatan pengembangan karier kinerja karyawannas pendapatan daerah kota surakarta asuhan keperawatan ny s post-op sectio caesarea indikasi ketuban pecahni ruang mawar i rsud dr moewardi surakarta penggunaan activity based management menyusun anggaran biaya produksi pt perkebunan nusantara ix (persero) kebun jolotigo pekalongan hubungan persepsi tentang pola asuh orang tua pengetahuan kesehatan reproduksi remaja siswi sma negeri 1 bangsri kabupaten jepara asuhan keperawatan ny s gangguan sistem persyarafan stroke hemoragik bangsal anggrek bougenvile rsud pandan arang boyolali tinjauan hukum mengenai transaksi antar bank melalui fasilitas internet bankinghubungkan kontribusi pajak penghasilan orang pribadi (pph op) penerimaan pajak kantor pelayananpajak pati implementasi pembelajaran kontekstual strategi inquiri questioning meningkatkan hasil belajar siswa mataklat melakukan administrasi (siswa kelas i jurusan administrasi perkantoran smkn i pamekasan madura) yeyen amalia winda peran pendidik paud mengenfdalikan perilaku emosional anak usiani (kasus pendidikan anak usiani singhasari malang) yunan ali fikri ananda masyarakat betawi pesisir jakarta utara perubahan fungsi ruang rumah tradisional betawi saat lahirnya perikatan jual beli melalui media elektronik (e-commerce) menurut hukum perdata barat hukum islam situs wwwyesasiacom international cooperation on combating human trafficking especially women and children a view from indonesia pemetaan it governance pt bank xyz (persero) tbk manajemen aset liabilitas kebijakan pembiayaan hubungannya performing loan bagi hasil perbankan syariah fersifikasi pembiayaan pt bank xyz analisis pengaruh faktor-faktor perekonomian regulasi perbankan penawaran saham pasar modal indonesia indonesia imbal hasil investasi saham bursa efek jakarta studi faktor-faktor mempengaruhi turnover perawat honorer rumah sakit kabupaten tangeran pembangunan sistem informasi aset pola hubungan faktor-faktor mempengaruhi dampak tayangan iklan antrokok kognisi intensi remaja iklan layanan masyarakat antirokok philip morris japan tobacco international mtv analisis pengaruh konsumen tentang konsumsi produk ramah lingkungan konsumen jakarta korelasi stadium usia penderita kanker serviks departemen patologi anatomi rscm tahun 2006 peran pengasuhan orang tua keberagamaan perilaku altruistik remaja pendekatan relawan remaja dampak implementasi standardized approach risiko kredit rasio kecukupan modal portfolio kredit bank x optimasi kinerja jaringan jalan perkotaan (kota tangerang) perlindungan investor aksi pembelian kembali saham melalui pasar modal perilaku seksual remaja pekerja seks risiko kesehatan reproduksi mereka klinik ims milik lsm daerah khusus ibu kota jakarta penilaian terpadu dampak tumpahan minyak perairan balikpapan tumpahan sludge oil kapal mt panos g sistem pengaturan lalu lintas terdistribusi menggunakan nonliear cupled oscillator pengaruh penjualan tatap muka aplikasi qpd model analisis proses pengembangan suatu produk manufaktur (tinjauan kasus forklift) faktor - faktor mempengaruhi keberhasilan pengajuan klaim kontraktor ke owner proyek grand indonesia = factors influencing the successfull granting of claim from contractor to owner case analisys grand indonesia project rekayasa ulang (bpr) aktivitas pelayanan pembuatan sim oleh kepolisian republik indonesia polda sumatera barat penggambaran tandingan kaum waria media studi analisis wacana film televisi panggil aku puspa pengaruh atribut-atribut program pembinaan loyalitas pelanggan kepuasan kesetiaan pelanggan toko new matahari club card analisis dampak lingkungan biaya pembangkitan listrik pembangkit listrik tenaga hibrida pulau sebesi lampung selatan surveillance ruang publik stasiun krl halte trans jakarta = surveillance in public place case study railway station and trans jakarta shelter pelaksanaan pemilihan umum indonesia (1971-1997) analisis hukum kekuatan mengikat sita jaminan kasus jual beli hak atas tanah statusbebani sita jaminan alternatif formula pengendalian harga lng masa datang meningkatkan pendapatan negara peranan informasi akuntansiferensial pembangunan pemukiman transmigrasi wilayah pedesaan rangka menunjang ketahanan nasional (di kabupaten aceh besar) identifikasi variabel kinerja perancangan strategi pengembangan perguruan tinggi swasta institut teknologi indonesia perlindungan hak milik alas merek praktik persaingan curang indonesia penyidikan kecelakaan lalu lintas penyimpangannya polres metro jakarta timur peningkatan kinerja industri kapal melalui peningkatan produktivitas kasus pt bikinkapal ptbangunkapal analisis pengaruh pengukuran kinerja internal (return on asset return on equity earning per share economic value added) market value added industri telekomunikasi transportasi prosedur pemindahan hak atas tanah aset perseroan terbatas (pt) likuidasi pt cikarang jasa aston likuidasi perencanaan strategis sistem informasi departemen luar negeri ri pelaksanaan prinsip kehati-hatian bank pemberian kredit agunan berupa tanah (bank x) tinjauan faktor-faktor penentu kemiskinan rumah tangga provinsi banten anajemen sistemstribusi buku pelajaran sekolah dasar jawa barat (sekolah dasar kotamadya bandung) pengaruh biayastribusi perbandingan resikombal hasil sukuk obligasi konvensionalpasar sekunder bursa efek surabaya 2004-2006 analisis kebutuhan barang atk cetakan puskesmas wilayah kota bekasi profit margin (mark-up) pembiayaan murabahab bank syariahtinjau perspektif hukum islam pt bank muamalat indonesia penaksiran kandungan cadangan bauksit daerah mempawah menggunakan ordinary kriging semivariogram anisotropik faktor-faktor mempengaruhi pemberian bagi hasil nasabah bank muamalat indonesia pengaruh sertifikasi iso 9002 kinerja mutu proyek konstruksi indonesia (pt waskita karya) pemberdayaan perempuan melalui pengelolaan kredit mikro sistem grameen bank oleh koperasi mitra usaha mandiri cabang jatiragas (di 3 desa barugbug situdam jatiwangi kabupaten karawang jawa barat) telaah kritis masalah absentiisme karyawan pabrik analisis hukum tentang akuisisi restrukturisasi perusahaan pt x analisisstribusi arus intensitas medan magnet tegangan induksi sistem penangkal petir gedung bertingkat pengaruh perubahan modal kerja multiple cysticercus nodules in skin and brain in a balinese woman a case report pengaruh risiko likuiditas profibilitas pt bank muamalat indonesia tbk pengukuran konsentrasi fitoplankton metoda fluoresensi chlorella sp pembuatan peta struktur-kedalama shelf-edge formasi kujung laut jawa timur perilaku pencarian informasi mahasiswa memanfaatkan layanan search engines menyusun skripsi mahasiswa s1 program studi ilmu perpustakaan universitas indonesia kajian estetika feminis seni tradisi lengger grup sekar budaya lengger keliling jakarta basisdata tekstual pengembangan basisdata kamus besar bahasa indonesia pengaruh kepuasan pekerja kepuasan pelanggan restoran sederhana masakanng perantara budaya masyarakat indian amerika serikat vine deloria jr n scott momaday pablita velarde pemeringkatan kualitas desain software berdasarkan properti kualitas metric object oriented software menggunakan analytic hierarchy process kampanye iklan bajigur hanjuang prevalensi pterygium faktor-faktor berhubungan kalangan pekerja pabrik kertas pt makna tradisi perayaan tahun baru imlek dewasa ini beberapa warga etnis cina kota bogor pengendalian temperatur ruangan gedung pameran bertingkat plc loyalitas nasabah bank muamalat indonesia faktor-faktor mempengaruhinya (nasabah bank muamalat indonesia cabang sudirman) namika acceptance istri bertahan pernikahan konfliktual faktor-faktor mempengaruhi kematian ibu indonesia analisis perencanaan kegiatan kerja bagi narapidana menjalankan asimilasi lembaga pemasyarakatan lapas sukamiskin bandung variabel makro ekonomi mempengaruhi penghimpunana pihak ketiga (bank muamalat indonesia periode 2000-2003) analisis proses penyaluran pembiayaan usaha kecil menengah perbankan syariah bank bri unit usaha syariah dampak reksaa syariah deposito syariah (bank syariah mandir) pengaruh biaya kualitas analisis faktor-faktor mempengaruhi dampak iklan banner internet industri telepon seluler indonesia analisis risiko menggunakan metode simulasi monte carlo menilai harga wajar saham pt holcim indonesia tbk konflik budaya jepang (tentang pengendalian konflik rangka mencapai keharmonisandalam ie) hubungan faktor-faktor manajemen keuangan akses pembiayaan kinerja ukm peserta pameran produk unggulan ekspor (di jcc) peserta forum temu bisnis (di hotel borobudur) mei 2005 tinjauan yuridis mengenai pembatasan tanggung jawab pelaku usaha perjanjian berlangganan layanan sirkit sewa (perjanjian leased line acces service) i peraturan pemerintah nomor 10 tahun 1959 studi perilaku pondasi rigid mooring dolphin kapal cpo 30000 dwt = study of the behaviour of rigid foundation for mooring dolphin for cpo ship 30000 dwt optimasi pembiayaan program penanganan jalan pendekatan keseimbangan sistem jaringan jalan kota bogor evaluasi pembiayaan murabahah melalui perbandingan antara return resiko bank bukopin syariah pengendalian pertumbuhan penduduk rangka meningkatkan ketahanan nasional peranan program keluarga berencana aspek kependudukan kabupaten sukabumi pengaruh sistem pemberian upah motivasi kerja karyawan pt ebs global engineering production supply bandung hubungan kepuasan kerja pemberian imbalan jasa karyawan non medis rs x jakarta politik luar negeri republik indonesia bebas aktif mutu security act (msa) masa kabinet sukiman (1952) faktor-faktor mempengaruhi penetapan return bagi hasil deposito mudharabah muthlaqah unit syariah bank x pragmatisme politik luar negeri amerika serikat masa clinton interaksi amerika serikat pbb nato 1993-1999 dampak penerapan sistem informasi bisnis sektor usaha kecil menengah (ukm) cv or ketidakkonsistenan penafsiran pengadilan perlindungan merek terkenal davinci collection kajian antara keberagaman (diversity) keberhasilan taman (taman menteng taman tebet) studi keandalan sistem penyaluran daya hantaran udara 150 kv kosambi baru -grogol menggunakan value engineering analisis hubungan antara audience characteristics product category/brand recall product placement film product placement film ayat-ayat cinta faktor-faktor perilaku konsumen mempengaruhi nasabah memilih produk shar-e pt bank maumalat indonesia tbk dki jakarta analisis pengelolaan proyek pembangunan rumah type 160 adaptive workflow management system menangani perubahan struktur organisasi prevalensi maloklusi remaja usia 12-14 tahun sekolah menengah pertama jakarta pengukuran tingkat kematangan perusahaan keselarasan strategis bisnis ti pt nusantara card semesta (ncs) perspektif perempuan program acara televisi studi acara perempuan peristiwa antv pemanfaatan sarana bibliografi elektronik pusat perpustakaan penyebaran teknologi pertanian (pustaka) bogor model pengembangan jaringan jalan kota ( kota palu) analisa pemodelan logikal sistem informasi laboratorium komputer universitas pelita harapan perancangan sistem informasi akademik online lembaga pendidikan informal cyber campus jakarta analisis kepuasan pemustaka kualitas layanan perpustakaan perpustakaan stain surakarta pengaruh kualitas layanan syariah pemberdayaan usaha kecil menengah bri unit usaha syariah bprsyariah amanah ummah pengaruh pelaksanaan periklanan keputusan pembelian produk minyak pelumas top one (pada bengkel sentosa mobil bandung) perlindungan konsumen pengguna jasa ketenagalistrikan penerapan tarif dasar listrik (tdl) oleh pt pln (persero) kebebasan hakim refleksi manusia sebagai homo religiosus komponen-komponen mempengaruhi produktivitas karyawan lembaga pendidikan islam yayasan abacu unit pendidikan strategi bisnis bank bukopin syariah pengelolaan kpr syariah peranan siaran berita rri ketahanan sosial budaya masyarakat pedesaan jawa barat kabupaten bogor kotamadya bekasi kabupaten bekasi) kerajinan sulaman wanita minang menunjang perekonomian keluarga (bukittinggi sekitarnya) faktor-faktor mempengaruhi keinginan masyarakat menjadi nasabah bank syariah beberapa daerah jawa tengah analisa yuridis perlindungan konsumen jasa layanan short message service (sms) tinjau undang-undang nomor 8 tahun 1999 tentang perlindungan konsumen (perjanjian penetapan harga sms oleh enam operator telekomunikasi) pengaruh penerbitan obligasi subordinasi pembiayaan kinerja bank syariah pt bank muamalat indonesia strategi komunikasi pemasaran produk inovatif inovasi aliansi strategis komunikasi pemasaran kartu shar-e sebagai produk unggulan bank muamalat indonesia budaya kerja perusahaan jepang upaya pencegahan kejahatan pencurian penyedia jasa internet (pada warnet itw depok) pengaruh penilaian kinerja penentuan kompensasi departemen penjualan pemasaran pt xyz pengaruh sertifikasi iso 9002 khususnya sistem dokumentasi kinerja konstruksi perusahaan kontraktor indonesia (pada 770 proyek lingkungan pt waskita karya) analisis pengaruh persepsi kualitas jasa kepuasan/ketidakpuasan pelanggan perusahaan jasa operator pergudangan kedudukan peran pemimpin informal menggalang ketahanan nasional kecamatan koto tengah kotamadyang provinsi sumatera barat perancangan kerangka service level agreement penyelenggaraan ti aplikasi korporat global purchase order perusahaan xyz penerapan teknik aspect oriented programming sistem card fraud monitoring hubungan gaya kepemimpinan budaya organisasi kinerja petugas lapas cipinang (study kasus lapas kelas i cipinang jakarta timur) left ventricularastolic dysfunction in type 2abetes mellitus patient without cardiovascularsease the association with microalbuminuria wanprestasi pelaksanaan lelang melalui internet penyempurnaan hukum lelang indonesia (pada ebay) pengaruh pengendalian pembelian bahan baku tingkat inventory turn over analisis faktor-faktor mempengaruhi keputusan nasabah non muslim menggunakan tabungan bank internasional indonesia syariah bii syariah cabang mh thamrin jakarta hubungan sosial status sosial masyarakat jepang jawaungkapkan penggunaan honorifiks merendahkanri novel yukiguni anteping tekad analisis risiko musculoskeletalsorders (msds) pekerja laundry tahun 2009 (pada 12 laundry sektor usaha informal kecamatan beji kota depok) kajian penggunaan teknologi informasi perilaku pencarian informasi dosen mahasiswa universitas indonesia pemanfaatan jurnal electronik usulan penerapan proteksi keamanan sistem informasi rangka penerapan e-goverment pemerintah kota depok analisis faktor sistem pelayaran nasional perspektif ketahanan nasional ; pelayaran laut persaingan industri tepung terigu indonesia 1990-2005 proses sosialisasi rangka implementasi hak kekayaan intelektual indonesia (vcd bajakan) kartu skor berimbang pengukuran kinerja sistem perencanaan strategis industri pembuatan silinder pt xyz modifikasi koefisien model thermal proses canai panas baja karbon rendah mesin ono-roll tipe tfog formk pengaruh kinerja keuangan perusahaan kebijakanviden left ventricularastolic dysfunction in chronic renal failure patients on chronic hemodialysis in dr cipto-mangunkusumo hospital the association with left ventricular mass identifikasi core competency upaya meningkatkan keunggulan kompetitif organisasi biro konsultasi manajemen sumber daya manusia pt bina potensia indonesia analisis potensi kompetitif swot layanan telkom metro area jakarta perancangan manufaktur rapid tooling soft injection mould memanfaatkan rapid prototyping fused deposition modeling (fdm) part formulasi service level agreement menyelenggarakan ti sebuah instansi pemerintah perencanaan strategi bersaing bisnis internet tv pt global trend intermedia penerapan metodologi information economics mengukur nilai ekonomis implementasi sistem informasi geografisvisi komplek pertamina gambaran laju filtrasi glomerulus anak refluks vesiko-ureter analisis putusan arbitrase sengketa nama domain orang terkenal kepemimpinan kyai perubahan organisasi pesantren (kepemimpinan khmuhammad achmad sahal mahfudh enerapan pendekatan andragogi pengelolaan pembelajaranklat adumla lembagaklat pemda propinsi jambi pengaruh perputaran modal kerja perolehan laba perusahaan perencanaan tata kelola keamanan informasi berdasarkan information security management system (isms) iso 27001 pusat komunikasi departemen luar negeri ri orientasi politik amerika perimbangan kekuatan cina kasus open door policy wilayah banjir hilir kali anke tahun 2002 2007 2008 (rawa buaya) hubungan anemia ibu hamil persalinan preterm rumah sakit umum pusat mohammad hoesin palembang pertimbangan-pertimbangan politik anggota dpr/mpr pemberhentian presiden republik indonesia tentang pemberhentian presiden kh abdurrahman wahid sidang istimewa mpr tahun 2001 sistem identifikasi hybrid metode arx fast fourier transform aplikasi suspensi semi aktif sperempat kendaraan kedaulatan rakyat pembentukan kebijakan publik (partisipasi masyarakat pembentukan undang-undang indonesia) analisis preferensi agen asuransi syariah pt asuransi takaful keluarga faktor-faktor mempengaruhi pembelian asuransi mobil (syariah) pt asuransi abc syariah perbandingan alokasi investasi perusahaan asuransi jiwa syari'ah kanvensional suatu usulan strategi pemasaran berdasarkan tanggapan konsumen scissorsstro scissorsstro sukabumi efek penguapan selektip plasma gelombang kejut iradiasi laser studi banding implementasi java rmi java corba sistem terdistribusi kasus komputasi numerik kreativitas guru proses belajar mengajar namika pengetahuan guru sma negari i tanggerangstribusi frekuensi celah bibir langitan rsab harapan kita tahun 1998 2000 evaluasi pengendalian internal siklus pendapatan klat khusus perkapalan pertamina tinjauan hukum perlindungan konsumen produk kosmetik importinjau undang-undang nomor 8 tahun 1999 tentang perlindungan konsumen (produk meei yung whitening day cream) sumbangan pembangunan perumahan rakyat meningkatkan ketahanan kotamadya dati ii jambi perumahan griya aur duri kecamatan telanaipura analisis efek moderasi; involvement switching cost alternative attractiveness hubungan antara niat perpindahan oleh konsumen performa buruk perusahaan industri salon pengalihan fungsi lahan perspektif ketahanan nasional tentang pengambilan keputusan pelepasan lahan oleh penduduk sekitar proyek kawasan industri lippo cikarang kabupaten bekasi penerapan metodologi information economis mengevaluasi investasi teknologi informasi proyek manajemen data migas (pada pt parta nusa data) upaya partai meningkatkan pelaksanaan perceraian kalangan masyarakat muslim kotamadya yogyakarta penyertaan modal sementara oleh lembaga penjamin simpanan sebagai upaya penyelamatan bank gagal (ptbank century tbk) analisis faktor internal eksternal mempengaruhi jumlah pembiayaan bagi hasil bank syariah mandiri analisis praktek remunerasi pengaruhnya kinerja perusahaan pt keramika indonesia assosiasi tbk bagian produksi kendala-kendala pengembangan pariwisata manokwari kecamatan manokwari kabupaten manokwari propinsi irian jaya peran oklusi traumatik bentuk kerusakan tulang alveolar kasus periodontitis sunset policy pasal 37a ayat (2) uu no 28 tahun 2007 sebagai salah satu upya eksistensifikasi pajak emningkatkan penerimaan negara (kpp pratama pasar minggu) faktor-faktor mempengaruhi investasi perusahaan sektor pertanian pertambangan barang konsumsi indonesia tahun 2004-2007 usulan perbaikan sistem informasi manajemen pemeliharaan kilang pt ept analisis pengaruh perencanaan strategis formal kinerja keuangan perusahaan tudi kasus (pt pertamina geothermal energy) tinjauan hukum transaksi pembayaran melalui internet banking menggunakan letter of credit kajian kolaborasi interdisipliner peneliti indonesia program riset unggulan terpadu i-vii fenomena alasan sakit seorang tersangka atau terdakwa berdasarkan surat keterangan dokter menghindar proses peradilan pidana analisis transfer pricingspute atas transaksi ekspor (pada pt x jakarta) asuransi islam strateginya menembus pasar pt asuransi syari'ah mubarakah efektivitas program layanan jarum alat suntik steril (ljss) sudut pandang para stakeholder (di puskesmas kecamatan tebet) pengembangan campus portal sebuah program studi teknik informatika universitas atma jaya yogyakarta komponen perbandingan kepuasan kerja antara karyawan muslim non muslim (pt jas enginering) analisis risiko pasar atas investasi model value at risk (pada reksaa pnm syariah tahun 2003 - 2004) peranan program bantuan pembangunan desa meningkatkan ketahanan nasional desa pantai desa pedalaman kalimantan barat perancangan arsitektur e-business layanan wap kompas cyber media pengaruh sengketa pulau dokdo/takeshima semenanjung korea hubungan bilateral korea selatan jepang gambaran stres copingsebabkan oleh aborsi akibat stres pranikah remaja wanita pelaksanaan pendaftaran tanah ulayat ganggam bauntuak sumatera barat kota payakumbuh penyelenggaraan pendidikan formal lembaga pemasyarakatan anak (di lapas anak pria tangerang) implementasi metode ppr mengestimasi error meh pelat lentur elemen mitc analisis perhitungan risiko kredit pendekatan creditrisk+portofolio pembiayaan murabahah bai bithaman ajil bmt at taqwa) pengaruh international monetary fund (imf) pembentukan hukum ekonomi indonesia uu kepailitan analisa yuridis penyalahgunaan ruang terbuka hijau (penggunaan ruang terbuka hijau usaha pengisian bahan bakar umum dki jakarta) jual beli saham pasar modal tingkat efisensi lemah setengah kuat pandangan fiqh islam bursa efek jakarta minum obat suatu kajian mengenai penggunaan pengetahuan obat-obatan barat masyarakat kota (di kelurahan pejaten timur pasar minggu jakarta selatan) aspek hukum sektor informal dki jakarta (pedagang kaki lima jakarta timur) identifikasi aplikasi program linier menyusun perencanaan pembangunan berwawasan lingkungan (polusi dki jakarta) analisa harga produksi listrik pltu batubara 2 x 15 mw kupang perhitungan debit limpasan menggunakan metode rasional program smadatinjau aspek tata guna lahan (sub - das pesanggrahan) = calculation of overflow by using rational method and smada software based on land use aspect (case study subdas pesanggrahan) sistem kesenian nasional indonesia sebuah renungan analisa kriteria pencapaian kepentingan ekonomi economic partnership agrements (epa) sebagai bentukplomasi bilateral jepang tiga kawasan dunia tahun 2002 - 2009 pemenuhan hak perawatan rohani jasmani bagi anakdik mewujudkan lapas anak ramah anak lapas anak wanita tangerang hubungan antara nilai tukar riil pertumbuhan ekonomi investasi langsung ekspor non migas indonesia ke jepang suatu analisa regresi adaptasi model goldberg klein pengawasan perencanaan pembangunan upaya meningkatkan ketahanan nasional pengawasan perencanaan pembangunan daerah pengaruh proses perencanaan proyek berdasarkan pmbok 2004 pekerjaan jasa konsultasi konstruksi kinerja waktu (ptx) analisis desain sistem informasi penerapan know your customer principles bank tabungan negara perancangan aplikasi sistem pengolahan data kepegawaian kantor pengolahan data elektronik pemerintah kota bandung analisis faktor - faktor penentu efisiensi operasional kantor cabang syariah (di deposito perbankan syariah peran fungsi manajemen pemasaran rs pluit memasarkan ikatan kerjasama berbagai perusahaan analisis proteksi sambaran petir eksternal menggunakan metode colection volume gedung fakultas teknik universitas indonesia = external lightning protection analysis using collection volume method case study buildings in faculty of engineering university of indonesia faktor-faktor mempengaruhi kebetahan penghuni rumah susun sewa harian pondok kelapa cengkareng tambora dampak kebijakan pembiayaan usaha kecil menengah indonesia struktur ekonomi optimasi biaya konstruksi proyek bangunan gedung menggunakan constraint simulasi monte carlo (proyek bangunan gedung pt (persero) bank negara indonesia tbk) calo tiket kereta api stasiun gambir perancangan data warehouse perusaha jasa telekomunikasi selular pt isat pantai publik kajian tentang kebijakan pantai publik rekreasi pengembangan infrastruktur it-tv broadcast sebuah jak-tv sistem pelaksanaan kliring prototipe perhitungan risiko operasional pendekatan teori logika fuzzy bank x pengaruh material-material alternatif proyek konstruksi perumahan (di perumahan taman semanan indah) = the influence of alternative materials to the housing construction project (case study in taman semanan indah) kajian investasi teknologi informasi implementasi push e-mail perusahaan epcc metode real option valuation pt rekayasa industri faktor - faktor mempengaruhi lamanya waktubutuhkan mustahik merubah pendapatan (peserta program masyarakat mandiri dompet dhuafa republika peserta program baitul ikhtiar lsm peramu) child abuse a case report analisis inefisiensi biaya administratif pemerintah daerah pengumpulan pendapatan daerah kasus kabupaten kota sumatera tahun 2005 analisa network traffic monitoring sebagai acuan capacity planning infrastruktur 3g value added service sebuah operator selluler pengembangan knowledge based system rekomendasi tindakan penanganan resiko pengelolaan pasar dki pd pasar maya dki pengembangan usaha masyarakat memantapkan perekonomian berdasarkan kepada ekonomi kerakyatan (di kelurahan kukusan) internet banking sebuah studi implementasi infrastruktur sistem informasi rawat jalan pengembangan sumberdaya manusia perusahaan jepang indonesia visi produksi perusahaan farmasi kajian kurikulum pelaksanaan program pendidikan pelatihan membentuk karyawan handal tanggap mutu produk analisis faktor-faktor mempengaruhi pemakaiannar-dirham sebagai mata uang suatu wakala adina pengembangan model knowledge management system lembaga riset badan pengkajian penerapan teknologi (bppt) community action sebagai praktek pengorganisasian masyarakat (pada walhi jakarta) implementasi pengaruh otonomi daerah manajemen perpustakaan badanustakaan daerah yogyakarta pemodelan pelaksanaan pengerukan perilaku saluran pemasaran produk pipa baja indonesia (pt bakrie pipe industries) kepemimpinan tradisional pedesaan irian jaya desa ajau sentani-jayapura penerapan audit sistem informasi metode audit berbasis resiko pt ib perancangan arsitektur teknis agent performance management call center pt telkomsel perencanaan anggaran biaya proyek pembangunan bak penampung mata air metode analisis bow (bagian perencanaan air bersih pdam kota) evaluasi penerapan kebijakan office channeling peningkatana pihak ketiga bni syariah analisis yuridis dugaan persaingan usaha tidak sehat membangun penggunaan menara telekomunikasi kabupaten badung propinsi bali perencanaan kebijakan keamanan informasi berdasarkan information security management system (isms) iso 27001 bank xyz pengembangan e-business menggunakan sap r/3 versi 40b sebagai dasar aplikasi pt united tractors tbk penggunaan pasal inkonstitusional putusan perkara pidana pengadilan negeri (putusan no 1114/pdb/2006/jktpst) kajian manajemen lingkungan perusahaan pertambangan emas upaya mempertahankan daya dukung lingkungan pt aneka tambang tbk unit bisnis pertambangan emas pongkor kabupaten bogor provinsi jawa barat wacana penyelesaian kebijakan perbankan indonesia masa krisislihat perspektif komunikasi politik kasus bantuan likuiditas bank indonesia decision support system (dss) knowledge base pengembangan infrastruktur jalan (propinsi banten) respons imunitas rendah tubuh manusia usia lanjut analisis atas manajemen aset tetap penerapan sistem akuntansi barang milik negara rumah sakit berstatus blu rsupn dr cipto mangunkusumo enerapan model perencanaan partisipatif bagi efektivitas pencapaian tujuan pelatihan pamong belajar sanggar kegiatan belajar (skb) balai pengembangan kegiatan belajar jawa barat analisis kemampuan kinerja karyawan pt bakrie corrugated metal industry (bcmi) menggunakan work ability index (wai) tinjauan hukum perdata internasional atas putusan perkara kepailitan badan hukum asing oleh pengadilan niaga indonesia (putusan mari no033/k/n/2006jo putusan pengadilan niaga no 16/pailit/2006/pn niaga/jktpst putusan pengadilan niaga no 03/pailit/pnniagajktpst) hubungan kesepian agresi remaja sedang berpacaran eksklusi sosial pekerja sistem outsourcing industri perbankan (divisi penagihan kembali bank x) proses penentuan iklan televisi deskripsi peran komponen terkait periklanan obat tradisional pengukuran kinerja instalasi pengolahan air bersih perusahaan xyz analisis pemanfaatan sistem informasi manajemen rsm ridwan meuraksa desember 2002 - pebruari 2003 penataan fisik jalan keamanan aktivitas pedestrian kajian kasus jalan malioboro jalan margonda orchard road penerapan metodologi information economics mengukur nilai ekonomis pengimplementasian internet perbankan btn mesocyclops sp sebagai pengendalian hayati jentik nyamuk vektor laboratorium pengukuran kinerja perusahaan berbasiskan ekuitas merek metode shareholder value added operator gsm indonesia identifikasi pengaruh motivasi akademik rata-rata indeks prestasi (ip) mahasiswa (mahasiswa teknik industri universitas komputer indonesia bandung) analisis proses rekam medis rawat jalan rumah sakit pmi bogor tahun 2002 kinerja penyidik pegawai negeri sipil pemda penegakan peraturan daerah (kantor pemda kabupaten bekasi) pengaruh temperatur waktu pemanasan ketahanan penggetasan oleh hidrogen baja aisi 4340lapisi cadmium penggunaan perkerasan berfungsi ekologis taman kota taman menteng taman honda - galunggung etnografi komunikasi bahasa pergaulan speech community mahasiswa stikom interstudi wijaya perancangan tata kelola infrastruktur teknolodi informasi inna grand bali beach hotel perancangan data warehouse upaya membantu meningkatkan kinerja produk sebuah pt telkomvmedia analisis emisi spektrokimia menggunakan laser nitrogen stabilitas frekuensi repetisi tinggi pemanfaatan gas suar bakar melalui mini lng industri software testing berdasarkan metodologi rational unified process menggunakan alat bantu rational testmanager rational robot analisis penyebab cacat produk menggunakan teknik the seven qc tools pengembangan koleksi perpustakaan sekolah sekolah lanjutan pertama negeri 142 206 215 jakarta barat upaya pemenuhan kebutuhan perumahan bagi golongan masyarakat berpenghasilan rendah perkotaan perspektif ketahanan nasional dua lokasi rumah susun sewa dki jakarta strategi komunikasi pemasaran media online astagacom analisis hubungan board governance penciptaan nilai perusahaan perusahaan-perusahaan tercatat bej perancangan jaringan (fast ethernet) (routing protocol) ospf eigrp = design and simulation of fast ethernet network using ospf and eigrp routing protocol kekuatan pembuktian hasil scan aktamana minuta salinan akta telah musnah konsep kami matsuri suatu kawagoe hikawa jinja matsuri pengaruh sikap iklan cetak keputusan pembelian (pada iklan cetak twinings tea varian four red fruits majalah cosmopolitan edisi januari 2009 avian influenza peranan hakim mejatuhkan putusan sanksi pidana pencemaran lingkungan hidup pengaruh pengendalian intern anggaran kas realisasi kasnas pendapatan daerah kota bandung survival rate and prognostic factors in advanced cervical cancer patients accompanied by renal impairment pembuktian pendanaan terorisme berdasarkan uu no25 tahun 2003 tentang perubahan atas uu no15 tahun 2002 tentang pemberantasan tindak pidana pencucian uang (financing of terorism reverse money laundering) (pendanaan terorisme terdakwa ainul bahri alias abu dujana pengadilan negeri jakarta selatan) ekologi budaya kota jakarta (kasus adaptasi sumberdaya pondok pinang) perancangan sistem informasi manajemen notanas pt (persero) angkasa pura i bandara juanda surabaya geopolitik perdamaian timur tengah studi peranan geopolitik arab saudi penyelesaian konflik arab-israel memahami spektrum autistik secara holistik analisis rasio keuangan berpengaruh pengadopsian program stock option ( perusahaan publik melaksanakan esop 1 tahun 200-2007 perencanaan perancangan web portal iklan informasi nyodokcom pt lingga fidam indonesia (lfi) interferensi kata-kata bahasa jerman mengandung huruf sebuah mahasiswa semester satu tahun ajaran 2008/2009 rancangan lokasi assembly point fakultas kesehatan masyarakat universitas indonesia sistem informasi pengelolaana bantuan penerapan tatakelola ti prencanaan proyek-2 kegiatan ti universitas paramadina eksperimen formalisasi sistem hol teori graph efektivitas kebijakan moneter menangani dampak variabel shock eksternal rezim nilai tukar mengambang bebas indonesia (model struktural var periode 19978-200612) de-escalation of tensions in constructivist perspective the case study of north korea and south korea conflict (2000-2002) penerapan sistem perencanaan program pengendalian anggaran perpustakaan perpustakaan bppt jakarta tahun anggaran 1998/1999 1999/2000 2000 penerapan algoritma tabu search penjadwalan job shop analisis produk layanan rawat inap ibu upaya pemasaran rs ibu anak hermina bekasi tahun 2002 perempuan budaya siri' tentang pola pengasuhan anak dampaknya perempuan etnis bugis wajo provinsi sulawesi selatan faktor-faktor risiko lingkungan berhubungan kejadian penyakit tb paru bta(+) kontrol kota jambi tahun 2000-2001 indikator meprediksi kegagalan penanganan pembiayaan bermasalah (non performing financing) pendekatan model logot (pada bank syariah xyz) sistem informasi perencanaan pengendalian persediaan material berbasis client-server (cvgrafika kreasindo) pengaruh kepribadian merek kecenderungan berkontribusi organisasi nirlaba gerakan pramuka lembaga upaya administratif prosedurnya bidang kepegawaian 13 departemen 8 lembaga pemerintah nondepartemen pemda dki jakarta 6 bumn eksepsi gugatan bersifat prematur hukum acara perdata (gugatan citizen lawsuitt gerakan rakyat penyelamat blok cepu) strategi pemasaran telekomunikasi masa krisis ekonomi pt telekomunikasi indonesia tbk aliran modal portfolio implikasinya pergerakan nilai tukar indonesia 1997 - 2007 fluktuasi arus kendaraan penumpang tingkat kejahatan wilayah hukum polsek pulomerak tahun 2001 opini masyarakat lokasi pelacuran kajian risiko kesehatan lingkungan akibat pencemaran udara hidrogen sulfida semburan lumpur panas sidoarjo analisis pendaftaran desain industri pembatalan desain industri terdaftar sepeda motor garuda analisa penerapan corporate governance bumn pt kawasan berikat nusantara aplikasi mobile data collecting berbasis image recognition system scanning barcode 2mensi menggunakan kamera mobile phone analisis perbandingan kinerja bank syariah bank konvensional berdasarkan rasio keuangan bmi 7 (tujuh) bank umum konvensional analisis yuridis pelaksanaan privatisasi badan usaha milik negara (bumn) indonesia stusi kasus pt krakatau steel (persero) konsep puskesmas terapung (pt) sebagai wujud paradigma baru kawasan pesisir pantai indonesia kecamatan kepulauan seribu sebagai daerah sampel strategi pemasaran produk alas kaki (pada pt xyz) mutu pelayanan bank umum syariah wilayah jakarta timur tiga bank umum syariah project financing driven feasibility study bangunan gedung komersial rangka optimalisasi pemanfataan lahan melalui kerjasama investasi institutional engineering implementasi metode cafe indexing retrieval database genomik uji kasus penerapan panjang gram berbeda-besa analisis hak konsumen perolehan penyediaan karya cipta lagu melalui internet pola peer to peer communication berdasarkan undang-undang nomor 19 tahun 2002 tentang hak cipta pertimbangan hakim bias rasial putusan perkara pidana (narkotika terpidana warga negara asing - putusan pengadilan negeri jakarta pusat nomor 2152/pidb/2003/pnjktpst) sistem informasi geografis penentuan lokasi cabang baru memperhatikan faktor risiko (bank xyz) sistem informasi pendaftaran lamaran kerja secara online (pt semen gesik (persero) tbk) hubungan faktor iklim angka insiden demam berdarah dengue kabupaten serang tahun 2007-2008 perspektif amerika hubungan amerika -indonesia kasus prri empat media cetak new york times washington post wall street journal time penggunaan laporan keuangan sebagai alat analisis produktivitas pt asuransi raksa pratikara tahun 1996-2000 portable architecture keberadaannya terkait ruang waktu syarat-syarat pemberian kuasatinjau segi hukum acara perdata indonesia (no 316/pdtg/1999/pnjktpst antara pt manggala dwi lestari pt asuransi prima perkasa internasional) pengukuran cost of quality penerapan activity-based costing informasi biaya kualitas pt x analisis faktor-faktor mempengaruhi loyalitas konsumen seluler gsm mahasiswa universitas indonesia depok analisa hubungan antara market timing struktur modal 30 perusahaan indonesia perlindungan konsumen pemberian hak informasi kepemilikan kartu kredit bank niaga pengukuran biaya kualitas (cost of quality) sistem perhitungan biaya berdasarkan aktivitas (activity-based costing system) cvx aplikasi pengolahan data sewa perangkat komputer pt pertamina ep region jawa berbasis web (pt pertamina cirebon) faktor mempengaruhi penentuan indicative rate penghimpunana pihak ketiga penentuan margin pembiayaan non bagi hasil bank mu amalat indonesia pengaruh product quality service quality tingkat brand awareness nasabah permata bank syariah analisis ketentuan pilihan hukum pilihan forum hukum kepailitan lintas batas (cross border bankruptcy) tinjauan hukum atas uu no37 tahun 2004 strategi perempuan batak toba mendapatkan akses kepada harta waris melalui proses penyelesaian sengketa (di kalangan perempuan migran batak toba jakarta) analisa kebijakan tarif potensi retribusi tempat penginapan graha wisata kuningan ujiagnosis igm-igd rapid captured immunochromatography penentuan tipe virus dengue reaksi berantai polimerase kesiapan sukunas pendapatan daerah mendukung pelaksanaan undang-undang no 22 tahun 1999 (kasus sukunas pendapatan daerah kotamadya jakarta selatan) perubahan penggunaan tanah terkait penyusunan luas perairan laguna (da ci tanduy da segara anakan tahun 1994 - 2006) aspek hukum tentang monopoli penyalahgunaan posisi dominan pasar bongkar muat petikemas putusan kppu perkara nomor l/kppu-1/2004 penghitungan beban overbooking (pembukaan penuh penyusunan contingence plan pt garuda indonesia kantor cabang cengkareng penjadualan n job m mesin proses penjadualan ulang menghadapi masalah penambahan pekerjaan baru sistem produksi job shop pengaruh desentralisasi fiskal akses pendidikan kabupaten/kota pulau jawa periode 1995-1997 2003-2006 analisa kebijakan perpajakan sektor minyak gas bumi menyangkut uplift perjanjian kontrak bagi hasiltinjau uu nomor 36 tahun 2008 tentang pajak penghasilan usulan perbaikan metode pemeliharaan pencegahan kegagalan mesin printing berbasis hasil analisa metode advanced fmeaplomasi politik wilayah konflik tentang peran organisasi internasional konflik israel-lebanon tahun 2006 analisis tingkat maturity manajemen proyek perusahaan jasa konstruksi (pada pt x) sisem manajemen dokumen alur kerja (workstation) perancangan e-government berbasis web pemerintahan daerah indonesia perancangan e-government pemerintahan daerah propinsi riau analisis kesesuaian tipe iklan tipe produk iklan seksi iklan non seksi iklan produk saja produk handphone produk kecantikan analisis kemampuan pemerintah daerah melakukan pinjaman daerah pemerintah kota bekasi pola pemanfaatan lahan pertanian (di kabupaten cianjur bagian utara propinsi jawa barat) atandang sebagai wahana pembelajaran pembelajaran wanita nelayan wanita pendatang kelpasir kandang keckoto tangah kotamadyang pengaruh penerapan self assement system kepatuhan wajib pajak pembayaran pertambahan nilai kantor pelayanan pajak bandung bojonagara perancangan sistem editorial mendukung multi-channel publishing pt republika media mandiri klausula arbitrasekaitkan putusan pengadilan niaga nomor 32/pailit/1999/pnniaga/jktpst pembangkangan masyarakat peraturan sekitar pusat kegiatan umum pangkalan becak pasar klewer analisa perhitungan biaya mutu pt x analisa kinerja keuangan bank syariahtinjau pengaruh eksternal bank syariah mandiri periode januari 2001 juni 2003 karakteristik penderma pemilihan perangkat program kemanusiaan lembaga kemanusiaan pkpu - jakarta upaya penyelesaian sengketa pulau sipadan ligitan (tinjauan aspek ketahanan nasional) permodelan imbalan manajer proyek berbasis keuntungan perusahaan metode risk monte carlo simulation optimization modeling proyek konstruksi indonesia implikasi enterpreneur proclivity kinerja wirausahawan sebuah pendekatan kapabilitasnamis pedagang pasar bsd pedagang pasar palmeriam perjanjian waralaba internasional antara pihak asing pihak indonesia berdasarkan peraturan tentang waralara pt fastfood indonesia tbk rancangan bangun sistem pengarsipan surat masuk surat keluar berbasis client server (di bidang kearsipan badan informasi komunikasi pemda kota bekasi) analisis faktor jumlah uang beredar jumlah deposito masyarakat bank syariah bank syariah mandiri 2000-2003 analisis sistem kemitraan kegiatan kerja pihak swasta lembaga pemasyarakatan kasus kemitraan lembaga pemasyarakatan klas i tangerang pt ikezaki tekindo tama tahun 2004-2006 analisis pengaruh customer complaints positive affectivity negatif affectivity komitmen karyawan customer service perusahaan jasa pt bank negara indonesia (persero) tbk aspek-aspek perlindungan hukum pengadaan tanah kepentingan swasta sengketa tanah desa cimacan perancangan aplikasi sistem pengecekan status kendaraan berbasis teknologi short message service(sms) bengkel body repair and paint pt kawan-kawan kita sejahtera (k3s) upaya indonesia menyelesaikan sengketa pulau sipadan pulau ligitan malaysia hubungan antara motivasisiplin pegawai produktivitas kerja pusat penelitian pengembangan teknologi minyak gas bumi lemigas (ppptmgb lemigas) pengaruh kualitas pelayanan pemasaran relasional keinginan nasabah menambah tabungan bank syariah bank muamalat indonesia - jakarta sumber stres karyawan lini depan perbankan pt bank rakyat indonesia (persero) tbk kantor cabang jakarta pasar-minggu depok pengaruh lama jarak peregangan besar gaya elastik karet ortodonti sistem informasi penjualan pembelian obat apotek cimindi berbasis client server produk politik pengaruhnya perilaku pemilih kasus pemilihan kepala daerah kab bandung kab blitar persepsi pengguna mengenai software jaws screen reader yayasan mitra netra perbandingan perilaku moral lazard tertanggung asuransi syariah tertanggung asuransi konvensional (pada ptasuransi xyz) faktor - faktor mempengaruhi preferensi nasabah fif syariah principal component analysis pt fif cabang rawamangun jakarta penggambaran tandingan kaum waria media studi analisis wacana film televisi panggil aku puspa konsep desain produk manufaktur biomedikal komponen lutut buatan strategi pemasaran produk rotan menghadapi era pasar bebas (pada pt tanamas industry) suksesi kekuasaan aljazair (military putcsh aljazair tahun 1992) pengaruh media massa pendapat mahasiswa fisip ui tentang hak asasi manusia indonesia identifikasi etnik integrasi nasionaltinjau perspektif ketahanan nasional pelajar smu vi jakarta sistem informasi pengolahan data pasien puskesmas cikalapa kabupaten subang public relations citibank membangun citra positif suatu analisis kualitatif atas pembentukkan citra oleh pr citibank penerapan e-business pola e-channelsvisi pemasaran pt emt relevansi hukum pidana adat pembaharuan hukum pidana nasional (hukum pidana adat bali) sistem informasi gawat darurat bencana (sigab) aplikasi kasus bencana banjirnas kesehatan dki jakarta wilayah jakarta pengetahuan farmakopea tradisional kesehatan reproduksi kasus wanita malaya krui lampung evaluasi penyebab korosi pelat baja jis g 3010 perjuangan mencari bentuk negara pembangunan politik palestina antara memilih islamis atau nasionalis agribisnis perkebunan peranannya perspektif ketahanan nasional jawa barat korosi baling-baling kapal laut skin test in drug eruption five years experience at dr cipto mangunkusumo general hospital jakarta sistem informasi akademik smk an-nahl cibeber kabupaten cianjur eastern indonesian women on the move domestic work in global cities implementasi kebijaksanaan penataan kelembagaan koperasi tingkat primer kotamadya surabaya (inovasi struktural penjenisan koperasi) strategi bersaing hotel sofyan sebagai hotel syariah menghadapi persaingan hotel bintang tiga jakarta hotel sofyan betawi hotel sofyan cikini etos kerja sistem manajemen amerika sebuah kasus perusahaan minyak amerika-caltex gambaran gejala episodik psikosis pasien epilepsi poliklinik syaraf rscm 2006 membongkar wacana kebenaran rezim kuasa kasus homoseksual indonesia perencanaan pengendalian produksi metode aggregate planning proses stamping produksi kendaraan bermotor daihatsu tahun 2000 dominasi pengaruh kualitas aktiva produktif (kap) melalui unsur aktiva produktif bermasalah (apyd) penilaian tingkat kesehatan (tks) bank perkreditan rakyat syariah (bprs) bprs x analisa aspek finansial kelayakan investasi skenario pembiayaan pembangkit listrik tenaga nuklir pltn ap600 pengaruh kepuasan kinerja karyawan outsourcing karyawan tetap pt bank muamalat indonesia tbk - jakarta usulan sistem perawatan komponen kritis metode fmeca (di perum damri unit bus kota bandung) formulasi strategi pemasaran isp menggunakan metode quality function deployment indosatnet rn bogor analisis kesadaran penonton akan penempatan produk film jakarta selatan (pada film twilight) pelaksanaan adopsi program manajemen berbasis sekolah (mbs) kasus sdn kecamatan cicurug kabupaten sukabumi penerapan teknik intelligent search penjadwalan kuliah perguruan tinggi peran wanita menunjang ekonomi rumah tangga miskin kecamatan selogiri kabupaten wonogiri propinsi jawa tengah optimasi penjadwalan job shop metode algoritmafferential evolution meminimumkan total biaya lembur kegiatan pemuatan barang kontainer ekspor transformasi kompleks keamanan semenanjung korea (1991-2003) aplikasi teori kompleks keamanan regional perlindungan desain industri mengenai pendesain sepatu pusat industri kecil (pik) pulogadungtinjau undang-undang no 31 tahun 2000 tentang desain industri hubungan antara kecerdasan emosional konsumen intensi membeli produk telepon selular kajian awal pengalaman perempuan menjalani nikah sirri dampaknya bagi perempuan (di kecamatan sumbersari kabupaten jember provinsi jawa timur) penerapan kriptografi algoritma rsa keamanan database (pada sistem informasi toko buku) sistem otomatisasi pengolahan teh hitam pt xyz berbasis programmable logic controller proses pelayuan penggilingan birokrasi perspektif perempuan mengenai keberadaan perempuan birokrasi beberapa departemen jakarta analisis wewenang tanggung jawab penjamin emisi efek proses penawaran umum (initial public offering/ipo) (proses penawaran umum perdana pt wahana artha harsaka tbk) analisa hukum tanggung jawab perjanjian pengangkutan barang lewat laut (perjanjian bongkar muat) rancangan tata kelola ti institusi pemerintah badan perencanaan pembangunan nasional (bappenas analisa yuridis penerapan asas peradilan sederhana cepat biaya ringan tindak pidana tercakup beberapa kompetensi relatif pengadilan (tindak pidana penipuan atas nama ybb) kajian ketersediaan koleksi bahan ajar perpustakaan universitas islam negeri sultan syarif kasim riau pengaruh kualitas pelayanan sosial marketing lembaga amil (laz) keputusan berzakat muzakki (pada rumah zakat indonesia) karier otonomi perempuan (pengalaman enam perempuan pengusaha jakarta) aplikasi sistem informasi geografis penentuan wilayah prioritas penanganan bahaya erosi (daerah aliran citarum) rancang bangun aplikasi koperasi berbasis client server koperasi sdn margahayu vi bekasi timur masyarakat sipil penyelesaian konflik potensi peranan masyarakat sipil penyelesaian konflik aceh pengembangan prototip sistem pakar penjadwalan pemeliharaan pembangkit sistem kelistrikan jawa-bali percampuran budaya melayu cina (pemukiman bagan siapi-api pulau halang) = acculturation of malay and chinese culture (case study bagan siapi-api and halang island housing area) penempatan guru sekolah dasar perspektif ketahanan nasional (padakbudnas p&k kab bogor) kajian penelitian sistem informasi/ teknologi informasi indonesia kepuasan pelanggan kualitas layanan auto 2000 bengkel auto 2000 cilandak jakarta selatan the evaluation of the offcial development assisstance programme from jica on the material and child health handbook at the telogo asri village central java pengembangan rencana implemnetasi manajemen layanan ti berbasis standar iso 2000 si suatu institusi pendidikan negeri pengaruh kontrol kepercayaan keadilan intensi turnover detailer perusahaan farmasi citra sebuah brand arsitektur = image of brand in architecture rancang bangun sistem informasi pembelian penjualan barang victoria factory outlet berbasis client-server mekanisme terjadinya haze keberadaan haze wilayah indonesia tahun 1991 keterbukaan informasi pembagianviden saham penentuan kondisi pemotongan optimum proses bubut berbantuan komputer mesin bubut konvensional hubungan antara informasi asimetri perataan laba kasus indonesia identifikasi hambatan komunikasi teamwork partner asing pekerjaan engineering design studi tentang perilaku konsumsi rumah tangga kebutuhan lingkungan bersih sehat kelas menengah kompleks perumahan pondok timur indah i desa mustika jaya kecamatan bantar gebang kabupaten bekasi jawa barat) pengaruh pengalaman pelanggan evaluasi kualitas pelayanan kepuasan pelanggan auto 2000 dki jakarta analisis faktor-faktor mempengaruhi harga saham perusahaan-perusahaan jakarta islamic index periode januari 2001-desember 2003 pengaruh sengketa hukum emiten proses penawaran umum perlindungan hukum investor pt adaro energy tbk analisis tentang peranan hukum proses pengembangan koperasi melalui sahamperoleh perusahaan swasta (analisis kasus pt metrodata epsindo koperasi mahasiswa universitas brawijaya) penggunaan algoritma kriptografi menggunakan metode hashing aplikasi e-learning telkom (di telkom learning center) analisis strategi kebijakan pelayanan prima ijin trayek nas perhubungan kabupaten tangerang algoritma memetika grasp menyelesaikan permutation flow shop scheduling problem hubungan peranan humas publisitas iklan citra perusahaan bank dki syariah cabang wahid hasyim pemahaman mubaligah tentang kepemimpinan perempuan islam majelis taklim as-syah'iyah pondok gede penentuan tingkat efektivitas situ sebagai stabilization pond situ baru kelurahan sukmajaya kecamatan sukmajaya kota depok analisa percepatan waktu menggunakan metode crashing kegiatan pemancangan proyek dermaga 115 tanjung priok aplikasi program pertmaster = analyse time accleration using crasing method at stake activity on dock 115 project tanjung priok with program application pertmaster pengaruh suku bunga sbi ihsg kurs roa legi harga obligasi harga obligasi konvensional syariah obligasi pt bank bukopin tbk tahun 2003 forecasting kebutuhan jasa telekomunikasi segmen industri sebagai acuan pengembangan layanan kawasan industri pulogadung pelaksanaan pelayanan kesehatan pasien penderita tbc lembaga pemasyarakatan klas iia bogor analisis risiko ergonomik craftsman welder floorman pekerja lapangan produksi minyak gas bumi vico indonesia kalimantan timur tahun 2000 study of provincial revenue sources y ogyakarta special region before and after the implementation of regional autonomy law tax information system for land and building on comparative analysis between local original budget revenues premises original local bandung on receipt the calculation procedure filling and income tax reporting revenue service hotels in medan analysis of the impact of restructuring of debt to income tax and financial performance at pt x the accounting treatment of income tax on banking products in the bank x surabaya branch comparative income taxation for real estate business based on government regulation no 27 years and government regulation no 1996 79 1999 treatment of value added tax on imports of pivot and the influence on the financial statements of fiscal pt x in surabaya influence of demographic factors on the skills and personality in end user computing (survey in klaten pratama tax office) analysis of tax payment service quality of hotels and restaurants in the area of east jakarta taxation aspects of the online auction service transactions by private auction in indonesia policy of tariff increase the base price of water (hda) in support of tax regulerend function retrieval and utilization of underground water (case studies policy formulation effectiveness of collecting duties on the acquisition of land and buildings (bphtb) in dki jakarta evaluation of determination of motor vehicle taxes in the province of dki jakarta 2005 analysis of thefference between budget and actual taxes in northern sumatra factors that affect the legal position of women in tax law after the enactment of law number 6 years ri in 1983 and law no 7-year ri 1 analysis of letters of objection and appeal against the decision of pooling cash transactionsmension of justice for the results of motor vehicle fuel tax the evaluation of policy implementation in the regions a case study in bogor regency regency leb from the factory design formic acid methyl format and water capacity 12 150 tonnes year design factory aniline from nitrobenzen and gas hydrogen capacity 9000 tons year factory design of sodium chloride sodium nitrate nitric acid and capacity 60 000 tonnes year design factory mononitrotoluen from toluene and acid mixture with continuous process capacity 47 150 tons year task report design factory design factory glucose syrup from tapioca starch and water capacity 55 000 tonnes year acetaldehyde from acetylene plant design process with capacity germany 71 500 tons per year factory design of sodium chloride sodium nitrate nitric acid and capacity 70 000 tonnes year kami hanya menyajikan judul-judulhasil pencarian http//jurnaldiktigoiddengan kata kunci daerahisi lengkap dapatakses melalui http//jurnaldiktigoiderumusan konsep kebijakan ekonomi tata ruang internalisasi pencemaran air kali tengah kecamatan driyorejo kabupaten gresikperbandingan antara penerimaan pajak penghasilan wajib pajak orang pribadi (pph pasal 25) penanganan surat masuk surat keluar kantor pelayanan pajak (kpp) medan prarancangan pabrik metil metakrilat asetone sianohidrin metanol kapasitas 90000 ton/tahunperan fiskus meneliti pembayaran pajak penghasilan hal peralihan hak atas tanah/atauaspek hukum pajak penghasilan restrukturisasi perusahaan sebagai upaya meningkatkan sistem manajemen perusahaanfaktor-faktor mempengaruhi pelanggan melakukan pembelian pajak usu (pajus) tinjauan yuridis pengenaan pajak penghasilan atas perseroan komanditer (pada cv makmur medan) analisis beberapa variabel mempengaruhi realisasi pajak hotel restoran kabupaten tapanuli utaratinjauan atas prosedur perhitunganprosedur pemungutan pajak reklameprosedur pemungutan pajak reklameanalisa dampak meminimalisasi pajak pertambahan nilai atas pengenaan pajak pertambahan nilai barang pemberian cuma-cuma perusahaan xxxpengaruh penerimaan pajak reklame pendapatan asli daerahevaluasi pemungutan pajak rumah kost kota depokupaya peningkatan pendapatan pajak daerah tentang upaya peningkatan pendapatan pajak daerah unit organisasinas pendapatan daerah kabupaten musianalisis administrasi pendapatan asli daerah pengelolaan pajak daerah (studi tentang penyetenggaraan administrasi pajak daerah kabupaten bekasi) analisis dampak reformasi perpajakan efisiensi sistem pemungutan pajak indonesiaanalisis implementasi sunset policy 2008 (d kpp pratama jakarta tebet) analisa kebijakan perpajakan sektor minyak gas bumi menyangkut uplift perjanjian kontrak bagi hasiltinjau uu nomor 36 tahun 2008 tenkebijakan pajak atas penentuan besaran penghasilan tidak kena pajak indonesiaanalisis implementasi sunset policy 2008 (di kpp pratama jakarta tebet) kedudukan negara sebagai pemegang hak mendahulu atas utang pajak kepailitankebijakan pemusatan tempat terutang ppn media elektronik (e-filling) rangka penyenderhanaan administrasi perpajakanpengembangan sistem informasi penerimaan perhitungan pajak hotelpenda kota bandungpenagihan pajak surat paksa kaitan dampaknya bagi usaha perbankan suatu kajian mengenaik uu no 19 tahun 1997 tentang penagihan pajak surat paksanalisis administrasi pencairan tunggakan pajak kendaraan bermotor (pkb) suatu tinjauan meningkatkan law enforcementanalisis sistem official assessment pajak pemanfaatan air bawah tanah air permukaan propinsi dki jakartaanalisis pelaksanaan pemeriksaan pajak kriteria seleksibagian penghasilan tidakkenakan pajak pajak penghasilan orang pribadiprosedur pencatatan pajak penghasilan pasal 21tinjauan penerimaan hasil pajak reklamepenilaian kinerja pemeriksa pajak kantor pelayanan pajak wajib pajak besar satupengaruh standar prestasi jurusita pajak pencairan tunggakan pajak (pada kantor pelayanan pajak penanaman modal asing satu) pengaruh rekayasa akrual meminimalkan pajak industri sektor perbankan bursa efek jakarta periode 2001-2005prosedur penerimaan pajakanalisis pengawasan faktur pajak sebagai implementasi kebijakan undang-undang pajak pertambahan nilai (suatu study tentang pendapat aparat pajak wajib pajak terpengaruh pertambahan jumlah kepatuhan wajib pajak penerimaan pajakjenis tarif atas jenis penerimaan negara bukan pajak berlaku badan meteorologi geofisikano 04/1995 tgl 8 pebruari 1995 tentang pajak penghasilan atas penghasilan perusahaan modal ventura transaksi penjualan saham atau pengalihan penyertaan modalno 36/1993 tgl 10 juni 1993 tentang perubahan atas pp no 22/1985 tentang pelaksanaan uu pajak pertambahan nilai 1984 sebagaiman telah beberapa kaliubah terakhno 03/1994 tgl 2 maret 1994 tentang pembayaran pajak penghasilan tahun berjalan atas penghasilan pengalihan hak atas tanah atau tanah bangunanno 42/2000 tgl 23 juni 2000 tentang pembayaran pajak penghasilan orang pribadi akan bertolak ke luar negerino 74/1991 tgl 31 desember 1991 tentang pajak penghasilan atas bunga deposito berjangka sertifikat bank indonesia sertifikat deposito tabunganno 142/2000 tgl 21 desember 2000 tentang tarif atas jenis penerimaan negara bukan pajak berlaku departemen kelautan perikananperubahan atas peraturan pemerintah nomor 51 tahun 2008 tentang pajak penghasilan atas penghasilan usaha jasa konstruksiprosedur pemungutan pajak bumi bangunanno 134/2000 tgl 18 desember 2000 tentang tarif atas jenis penerimaan negara bukan pajak berlaku badan pengawas tenaga nuklirno 140/2000 tgl 21 desember 2000 tentang pajak penghasilan atas penghasilan usaha jasa konstruksino 17/2000 tgl 2 agustus 2000 tentang perubahan ketiga atas no 7 tahun 1983 tentang pajak penghasilanpajak penghasilan atas bunga simpananbayarkan oleh koperasi kepada anggota koperasi orang pribadino 76/1991 tgl 31 desember 1991 tentang perubahan atas pp no 22/1985 tentang pelaksanaan uu pajak pertambahan nilai 1984 sebagaimana telah beberapa kaliubahpenundaan keempat berlakunya pp no 39/1998 tentang perlakuan ppn pajak penjualan atas barang mewah kawasan berikat (bonded zone) daerah industri pulau batamno 27/1996 tgl 16 april 1996 tentang perubahan atas pp no 48/1994 tentang pembayaran pajak penghasilan atas penghasilan pengalihan hak atas tanah/atau btarif atas jenis penerimaan negara bukan pajak berlaku departemen energi sumber daya mineraltarif atas jenis penerimaan negara bukan pajak berlaku lembaga ilmu pengetahuan indonesiajenis tarif atas jenis penerimaan negara bukan pajak berlaku departemen perindustrianpengembangan sistem informasi pengolahan pajak bidang pajak hotel restaurantnas pendapatan daerah kota bandungno 148/2000 tgl 23 desember 2000 tentang fasilitas pajak penghasilan penanaman modal bidang-bidang usaha tertentu atau daerah-daerah tertentuno 16/2000 tgl 10 maret 2000 tentang pembagian hasil penerimaan pajak bumi bangunan antara pemerintah pusat daerahno 139/2000 tgl 21 desember 2000 tentang pajak penghasilan atas penghasilan obligasiperdagangkan bursa efektarif atas jenis penerimaan negara bukan pajak berlaku departemen komunikasi informatikaperubahan atas pp no 143/2000 tentang pelaksanaan uu no 8/1983 tentang ppn barang jasa pajak penjualan atas barang mewah sebagaimana telah beberapa kali djenis tarif atas jenis penerimaan negara bukan pajak berlaku badan tenaga nuklir nasionalperlakuan pajak pertambahan nilai atas penyerahan avtur keperluan penerbangan internasionaljenis tarif atas jenis penerimaan negara bukan pajak berlaku badan standardisasi nasionalno 34/2000 tgl 20 desember 2000 tentang perubahan atas undang-undang ri no18 tahun 1997 tentang pajak daerah retribusi daerahno 92/1999 tgl 13 oktober 1999 tentang perubahan kedua atas pp no 59/1998 tentang tarif atas jenis penerimaan negara bukan pajak berlaku departemen kehtinjauan atas pemotongan pembayaran pelaporan pajak penghasilan pasal 21 atas pegawai tetapfasilitas pajak penghasilan penanaman modal bidang-bidang usaha tertentu/atau daerah-daerah tertentujenis tarif atas jenis penerimaan negara bukan pajak berlaku badan tenaga nuklir nasionalno 144/2000 tgl 22 desember 2000 tentang jenis barang jasa tidakkenakan pajak pertambahan nilaijenis tarif atas jenis penerimaan negara bukan pajak berlaku departemen hukum hak asasi manusiajenis tarif atas jenis penerimaan negara bukan pajak berlaku badan koordinasi survei pemetaan nasionalno 92/2000 tgl 16 oktober 2000 tentang tarif atas jenis penerimaan negara bukan pajak berlaku departemen tenaga kerja transmigrasijenis tarif atas jenis penerimaan negara bukan pajak berlaku mahkamah agung badan peradilan berada bawahnyajenis tarif atas jenis penerimaan negara bukan pajak berlaku departemen perdaganganpenetapan perkiraan alokasia bagi hasil pajak bumi bangunan bagian daerah tahun anggaran 2008jenis tarif atas jenis penerimaan negara bukan pajak berlaku sekretariat konsil kedokteran indonesia departemen kesehatanprosedur pelaksanaan restitusi kantor pelayanan pajak bumi bangunan bandung duano 78/1999 tgl 22 september 1999 tentang perubahan ketiga atas peratuaran pemerintah nomor 46 tahun 1994 tentang pembayaran pajak penghasilan bagi orang pribadi yno 130/2000 tgl 15 desember 2000 tentang pengecualian sebagai objek pajak atas keuntungan karena pembebasan utang debitur kecilno 67/2000 tgl21 agustus 2000 tentang tarif atas jenis penerimaan negara bukan pajak berlaku lembaga penerbangan antariksa nasional (lapan) pengaruh undang-undang perpajakan minyak bumi gas alam pemrasaran tukirman seminar nasional hukum pajak bandung 15-16 juli 1985 (fino 72/1999 tgl 30 juli 1999 tentang penangguhan mulai berlakunya no 26 tahun 1999 tentang tarif atas jenis penerimaan negara bukan pajak berlaku departpencabutan keputusan presiden nomor 90 tahun 1995 tentang perlakuan pajak penghasilan atas bantuanberikan pembinaan keluarga prasejahtera keluargano 136/2000 tgl 20 desember 2000 tentang tata cara penjualan barang sitaankecualikan penjualan secara lelang rangka penagihan pajak surajenis tarif atas jenis penerimaan negara bukan pajak berlaku kementerian negara lingkungan hiduppajak penghasilan atas penghasilanterima oleh pekerja samapai sebesar upah minimum propinsi atau upah minimum kabupaten/kotaperubahan ketiga atas peraturan pemerintah no26 tahun 1999 tentang tarif atas jenis penerimaan negara bukan pajak berlaku departemen kehakimanperanan pemeriksaan rutin menguji kepatuhan wajib pajak badan kantor pelayanan pajak pratama bandung cibeunyingno 62/1992 tgl 19 september 1992 tentang sektor-sektor usaha perusahaan pasangan usaha perusahaan modal ventura pelaksanaan uu no 7/1983 tentang pajakno 79/1999 tgl 30 september 1999 tentang perubahan kedua atas no 48 tahun 1994 tentang pembayaran pajak penghasilan atas penghasilan pengalihan hak atas tanjenis tarif atas jenis penerimaan negara bukan pajak berlaku departemen sosialpajak penghasilan atas penghasilan transaksi derivatif berupa kontrak berjangkaperdagangkan bursano135/2000 tgl20 desember 2000 tentang tata cara penyitaan rangka penagihan pajak surat paksaperubahan atas pp no 62 tahun 2002 tentang tarif atas jenis penerimaan negara bukan pajak berlaku departemen kelautan perikananjenis tarif atas jenis penerimaan negara bukan pajak berlaku arsip nasional ripenempatan tenaga menteri keuangan tim prakarsa pengarahan reformasi peningkatan kinerja bidang pajak bea cukaijenis tarif atas jenis penerimaan negara bukan pajak berlaku lembaga ilmu pengetahuan indonesiapencabutan atas peraturan pemerintah no18 tahun 2001 tentang tarif atas jenis penerimaan negara bukan pajak berlaku badan urusan logistikpengaruh penerimaan pajak prkir pendapatan asli daerahnas pendapatan daerah kota bandungjenis tarif atas jenis penerimaan negara bukan pajak berlaku badan pengawas tenaga nuklirpengesahan agreement between the government of the republic of indonesia and the government of teh republic of mauritius for the avoidance of double taxation and teno 54/1990 tgl 13 oktober 1990 tentang perubahan atas pp 21/1989 tentang pajak penghasilan atas bunga deposito berjangka sertifikat deposito tabunganpenetapan bagian penghasilan sehubungan pekerjaan pegawai harian mingguan serta pegawai tidak tetap lainnya tidakkenakan pemotongan pajak peno 14/2000 tgl 23 pebruari 2000 tentang tarif atas jenis penerimaan negara bukan pajak berlaku departemen perhubunganjenis tarif atas jenis penerimaan negara bukan pajak berlaku departemen hukum hak asasi manusiano 131/2000 tgl15 desember 2000 tentang pajak penghasilan atas bunga deposito tabungan sertaskonto sertifikat bank indonesiano 03/1996 tgl 25 januari 1996 tentang perlakuan perpajakan bagi pengusaha kena pajak berstatus entrepot produksi tujuan ekspor (epte) perusahaan pengolperubahan atas peraturan pemerintah no14 tahun 2000 tentang tarif atas jenis penerimaan negara bukan pajak berlaku departemen perhubunganjenis tarif atas jenis penerimaan negara bukan pajak berlaku departemen komunikasi informatikaemodelan pendapatan asli daerah (pad) propinsi jatim menggunakan metode varimapengaruh penerapan sanksi administrasi tingkat kepatuhan wajib pajak orang pribadi kantor pelayanan pajak pratama bandung cicadasjenis tarif atas jenis penerimaan negara bukan pajak berlaku badan pusat statistikno 74/1999 tgl 10 agustus 1999 tentang perubahan atas pp no 59/1998 tentang tarif atas jenis penerimaan negara bukan pajak berlaku departemen kehutananperubahan atas peraturan pemerintah no 1 tahun 2007 tentang fasilitas pajak penghasilan penanaman modal bidang-bidang usaha tertentu/atau daerah-dajenis tarif atas jenis penerimaan negara bukan pajak berlaku kementrian negara pemuda olahragapenerapan psak no 46 tentang akuntansi pajak penghasilan rangka menyajikan laporan keuangan lebih relevan infomatif pt xperhitungan nilai jual obyek pajak bidang usaha perikanan darat perusahaan hatchery x daerah gondol kecamatan gerokgak-balipenerapan tax planning mengefisiesikan nilai pajak penghasilan pt jatim lubritama gemilang surabayapenerapan standar akuntansi keuangan nomor 46 penyajian laporan keuangan ptxpenerapan akuntansi pajak penghasilan (psak 46) pt xfaktor-faktor mempengaruhi nilai jual objek pajak tambak udangpengenaan pajak bumi bangunan rumah susun pekunden kota semarangpenerapan evaluasi perhitungan pajak penghasilan pajak pertambahan nilai kaitannya metode transfer pricingpajak penghasilan final atas penghasilan transaksi penjualan saham bursa efek jakartatinjau asas keadilan asas kesederhanaanpengelolaan pajak reklame dki jakarta (di sukunas pendapatan daerah wilayah kotamadya jakarta pusat) perlakuan pajak atas piutang usaha bankperencanaan pajak penghasilan sehubungan fasilitas pajak penghasilan berdasarkan uu sebagaimana telahubah terakhir uu no 17 tahun 2000analisa potensi kapasitas pajak hiburan bioskop kotamadya jakarta selatanpengaruh pemeriksaan pajak kepatuhan wajib pajak penyampaian surat pemberitahuan tahunan (pada kantor pelayanan pajak cikarang) pendapat masyarakat tentang penagihan pbb tingkat kepatuhan wajib pajak pbb dki jakarta (suatu) tinjauan yuridis perbandingan utang pajak utang niaga perkara kepailitan perkararektorat jendral pajak melawan pt inti mutiara kimindokuasa hukum pengadilan pajakmembangun model perlindungan hukum bagi wajib pajak sistem penyelesaian sengketa pajak indonesiatax planning baik sebagai upaya legal meminimalkan besarnyapajak harusbayar sesudah adanya pemeriksaanperanan undang undang nomor 19 tahun 1997 tentang penagihan pajak surat paksa sebagaimana telahubah undang-undang nomor 19 tahun 2000 pencpengurangan atau penghapusan sanksi administrasi pajak atas pajak pertambahan nilai pajak penghasilanpengaruh pemeriksaan rutin pajak pajak terutang wajib pajak badantinjauan yuridis bea perolehan hak atas tanah bangunan transaksi jual beli tanah bangunan (tinjauan kasus kantor pelayanan pajak pratama karangananalisis pertumbuhan pajak parkir peningkatan pendapatan asli daerah kabupaten wonogirianalisis sistem akuntansi menunjang pengendalian intern penerimaan pajak hotel restorannas pendapatan daerah kabupaten tulungagung strategi pelayanan seksi penagihan aktif kantor pelayanan pajak malang penerapan pp no3p tahun 2004 tentang tarif atas jenis penerimaan negara bukan pajak berlaku kepolisian negara ri pungutan biaya pelayanan sidampak kebijakan tarif imfor pajak ekspor kinerja perekonomian sektor pertanianstribusi pendapatan indonesia suatu pendekatan model keseimbaimplementasi kebijakan pajak bumi bangunan kelurahan gisikdrono kecamatan semarang barat kota semarangmasalah pertahanan sebagai penghambat pembangunan pertanian berkelanjutansistem informasi pajak kendaraan bermotor kantor uppdtinjauan mekanisme pemblokiran rekening banka wajib pajak badan kantor pelayanan pajak bandung kareessistem informasi pengolahan data pendapatan pajak penerangan jalannas pendapatanintensitas pajak reklame ssebagai sumber pendapatan asli daerahnas pendapatan daerah pemerintah kota bandungtinjauan atas pelaksanaan pajak bumi bangunannas pendapatan daerah kota bandungtinjauan pendapatan daerah atas pajak hotelnas pendapatan daerah kota bandungtinjauan atas prosedur penerimaan pajak bumi bangunan kantornas pendapatan daerah pemerintah kota bandungtinjauan atas pencairan tunggakan pajak sebelum sesudahterbitkan surat paksa kpp bandung kareestinjauan atas pelaksanaan perosedur pemungutan pajak reklamependa kota bandunghubungan kemampuan pegawai motivasi pegawai efektivitas kerja pegawai rangka peningkatan pajak bumidan bangunan (pbb) kecamatan cimanggu kabupatinjauan atas mekanisme pelaporan pajak pertambahan nilai kpp bandung kareestinjauan atas mekanisme pemblokiran rekening wajib pajak pajak badan kpp bandung kareestinjauan atas pelaksanaan pajak pertambahan nilai masukannas koperasi usaha kecil menengah bandungtinjauan atas penerimaan pajak parkir subdinas retribusinas pendapatan daerah kota bandungtinjauan atas pelaksanaan pemungutan pajak restorannas pendapatan pendapatan daerah kota bandungtinjauan atas penerapan sanksi administrasi penerimaan pajak reklametinjauan atas pelaksanaan pemungutan pajak bumi bangunannas pendapatan daerah (dipenda) kota bandungprosedur atas penagihan sanksi pajak hiburan subnas pendapatan daerah kota bandungperanan setoran pajak bumi bangunan sebagai salah satu sumbera memenuhi kebutuhan likuiditas ptbank jabar cabang soreang bandungperanan penerimaan pajak reklame meningkatkan pendapatan asli daerah (pad) kota bandungpengaruh tarif tunggal pasal 17 pph badan jumlah pajak penfhasilan terhutang kpp pangkal pinangprosedur penerimaan pajak bumi bangunan kantornas pendapatan daerah pemerintah kota bandungperanan perencanaan pajak penghasilan badan menunjang penghematan pajak penghasilan badan (pada pt industri telekomunikasi indonesia (persero) peranan pajak daerah pendapatan asli daerah kabupaten bandung tahun 2006analisisfaktor-faktor mempengaruhi jumlah wajib pajak orang pribadi mendaftarkanri serta hubungannya penerimaan pajak (untuk wilayah jakarta timhubungan anatara kecerdasan spritual persepsi wajib pajak kinerja pelayanan perpajakan motivasi wajib pajak memenuhi kewajiban perpajakannanalisis peran sistem informasi perpajakan pemeriksaan pajakanalisis pengaruh pemeriksaan pajak tingkat kepatuhan wajib pajak memenuhi kewajiban perpajakan kantor pelayanan pajak jakarta kebayoran baru duaadvance pricing agreement (apa) penanganan kasus transfer pricing menurut hukum positif perpajakan indonesiatinjauan kebijakan pajak lingkungan sebagai strategi penganggulangan pemanasan global berbagai negaraanalisis faktor-faktor sistem administrasi pajak mempengaruhi tingkat kepatuhan wajib pajakprinsip keadilan pengenaan pajak penghasilan bagi wajib pajak orang pribadi pengusaha tertentu kantor pelayanan pajak jakarta kelapa gading tinjauan tentkinerja kantor pelayanan pajak pratama (small taxpayers office) studi kantor pelayanan pajak pratama gambir tiga/ taufika naviri hidayantopengaruh penerapan sistem administrasi pajak modern kinerja kantor pelayanan pajak penanaman modal asing duacdewa putu gede chrisna sanjaya --keberadaan pajak bumi bangunan sebagai pajak pusat era otonomi daerah wilayah kab temanggung kab sleman kab sukoharjopenentuan besaran pengurang pajak terhutang obyek pajak mengalami transisi perubahan prosentase njkp sektor pedesaan perkotaan memanfaatkan sipembuatan model potensi penghasilan subjek pajak menggunakan metode jaringan syaraf tiruan intensifikasi ekstensifikasi pajak penghasilan kelutinjauan atas tindakan pengadilan negeri pontianak memeriksa mengadili memutus sengketa pajak kantor pelayanan pajak pontianakpengaruh penetapan nilai jual objek pajak ketetapan pajak bumi bangunan tahun 2007 kota prabumulih/ taufik nur hidayatanalisis persepsi pengguna wajib pajak sistem e-registration kantor pelayanan pajak yogyakarta satu/ ida ernawatitanggung jawab pribadi pengurus perseroan terbatas hutang pajak perseroantinjau undang-undang pajak undang-undang ptpenerapan standar akuntansi (psak no 46) atas pajak penghasilan pt xpelaksanaan perjanjian kerjasama jasa konsultan pajak antara setiabudi business consultant ptxperhitungan nilai jual obyek pajak jalan tol ruas surabaya-gempol menurut undang-undang berlaku tahun 2001evaluasi sistem prosedur pemungutan pajak daerah retribusi daerah pemerintah kabupaten klatenprosedur perijinan pemasangan reklame analisis uji beda penetapan target pajak parkirprosedur penagihan pajak bumi bangunan menggunakan surat paksatinjauan hukum atas tanggung jawab yayasan pengelola tanah pemakaman pembayaran pajak kabupaten deli serdang berdasarkan perda nomor 26 tahun 2000tinjauan atas pemeriksaan pajak penghasilan (pph) kaitannya surat pemberitahuan tahunan pph badan pt deltamas surya indah muliabagi hasil pajak optimal mendukung peiaksanaan otonomi daerah propinsi dki jakartaanalisis transfer pricingspute atas transaksi ekspor (pada pt x jakarta) analisis pemenuhan kebutuhan administrasi perpajakan atas penghasilan musisi internasional sebagai wajib pajak luar negerikontribusi pajak daerah pendapatan asli daerah (pad) dki jakarta tahun 1991 hingga tahun 2000analisis pelaksanaan efektivitas pemungutan pajak kendaraan bermotor (pkb) samsat kota bandungpengaruh kualitas pelayanan perubahan organisasi kepatuhan wajib pajak kantor pelayanan pajak pratama jakarta sawah besar duaperanan staf pendukung pelayanan (spp) rangka meningkatkan tax compliance penerimaan pajak kantor pelayanan pajak pratama jakarta sawahefektifitas kewajiban memiliki nomor pokok wajib pajak mendirikan perusahaan penerimaan pajak kpp pademanganinsentif pajak penghasilan pengaruhnya investasi modal asing kawasan pengembangan ekonomi terpadu kawasan timur indonesiasistem informasi pajak reklamenas pendapatan daerah kota bandungteknik kepemimpinan kepala desa meningkatkan kinerja pamong desa memungut pajak bumi bangunan (pbb) desa buntet kecamatan astanajapura kabupatentinjauan atas pengawasan pembayaran masa pajak penghasilan (pph) pasal 25 orang pribadi kantor pelayanan pajak bandung kareestinjauan atas pelaksanaan pencatatan komputerisasi pph pasal 21tinjauan atas biaya fiskal menghitung pajak penghasilan pthuge trading industry laporan kuliah praktek kerjaperlakuan akuntansi pajak pertambahan nilai pt impresindo karyapritamatata cara penerimaan surat pemberitahuan (spt) tahunan pph pasal 21 kantor pelayanan pajak bandung karees laporan kerja praktekperencanaan pajak penghasilan melalui pemilihan lokasi usaha pt bmk tahun pajak 1995 1996efisiensi efektifitas administrasi pajak reklame penda dki jakartapengenaan pajak pertambahan nilai atas kegiatan membangun sendiri kawasan realestat pt abc - jakartaanalisis hubungan ukuran perusahaan tarif aefektif pajak penghasilanpolitik hukum penerapan pajak pertambahan nilai indonesiapelayanan prima perpajakan kantor pelayanan pajak jakarta) kebijakan pajak atas penghasilan usaha jasa konsultanfaktor-faktor mempengaruhi tingkat keberhasilan pemungutan pajak bumi bangunanimplementasi kebijakan pemerintah bidang pemeriksaan pajak kantor pemeriksaan penyidikan pajak (kasus karikpa surabaya tiga) nalisis efektifitas pemungutan pajak kendaraan bermotornas pendapatan daerah dki jakartakontribusi pajak retribusi daerah pendapatan asli daerah (pad) kotamadya jakarta utara tahun 1992/1993-2002tindak penyanderaan penunggak pajak olehrektorat jendral pajaktinjau sudut penegakan hukum peningkatan penerimaan pajak evaluasi perlakuan pajak penghasilan atas outbound transaction electronic commercetinjauan atas pemberian fasilitas perpajakan berupa pengampunan pajak perspektif hukum pajak indonesiatinjauan atas pelaksanaan pemungutan pajak penghasilan pasal 21 atas pegawai tetap cv armico bandungtinjauan atas perhitunganpelaksanaan pengawasan pembayaran pelaporan angsuran bulanan pph pasal 25 wajib pajak badan kantor pelayanan pajak bandung tegallegapengaruh pemahaman prosedur perpajakan kepatuhan wajib pajak badan memenuhi kewajiban pajak penghasilan kpp pratama klatenhubungan pelaksanaan pajak bumi bangunan perkotaan penghasilan kena pajak (di kec banjarsari kota surakarta) analisis ketidakadilan vertikal beda koefisien keadilan penetapan nilai jual objek pajak atas perumahan kantor pelayanan pajak bumianalisis pengaruh pemeriksaan pajak peningkatan penerimaan pph badan karikpa karawangaspek pemungutan pajak transaksi perdaganganlakukan melalui media internet (e-commerce) identifikasi wajib pajak bentuk usaha tetap (but) kantor pelayanan pajak modern kantor pelayanan pajak pma tigaanalisis efektivitas pemungutan pajak hiburan wilayah kotamadya jakarta timuranalisis pilihan penerapan sanksi perpajakan atas abuse of transfer pricingpenerapan prinsip pay as you earn atas gaji upaya mencegah penghindaran pajak upaya keadilan memungut pajak potensi pajak penghasilan koperasi kabupaten bangkalan madura jawa timuranalisa model restrukturisasi hutang pengaruh laba bersih beban pajak pt gt kabel indonesia tbkperlakuan akuntansi pajak pertambahan nilai atas transaksi impor inden serta pengaruhnya laporan keuangan fiskal perusahaan indentor cv xpenerapan perencanaan pajak penghitungan pph 21 pt xpenerapan sak no 46 tentang akuntansi pajak penghasilan laporan keuangan pt x surabayaevaluasi perhitungan pajak penghasilan terutang (pada pt x) tinjauan atas penagihan pajak bumi bangunan sebagai upaya meningkatkan penerimaan daerah (pada kantor pelayanan pajak bumi bangunan jakarta timuranalisa penerimaan pajak kendaraan bermotor (pkb) propinsi jawa timuranalisis assessment ratio studies pajak bumi bangunan kota tangeranganalisis atas pajak tangguhan pt wika realtykinerja subsektor perkebunan evaluasi masa lalu (1994-1998) prospek era perdagangan bebas dunia (2003-2008) keterkaitan faktor internal eksternal pelaksanaan pemeriksaan mendukung upaya pengoptimalan penerimaan pajak hiburan (phi) propinsi dki jakarta setelahevaluasi metode pengakuan pendapatan perhitungan penghasilan kena pajak atas kontrak jangka panjangterapkan pt x berkaitan pp nomor 138implementasi peraturan pemerintah nomor 12 tahun 2001 tentang fasilitas pajak pertambahan nilaibebaskan cv asiaevaluasi alternatif penerapan perhitungan pajak pertambahan nilai pt x sebagai pengusaha kena pajak pedagang eceranaspek perlakuan perhitungan pembayaran pajak pertambahan nilai industri tembakau rokokevaluasi perhitungan pajak penghasilan karyawan perusahaan home industri surabayaanalisa penerapan pajak pertambahan nilai pt xevaluasi atas perhitungan pajak penghasilan laporan keuangan fiskal pt sumber purnama sakti metode tax planningtinjauan atas pelaksanaan penghitungan pemotongan penyetoran pelaporanprosedur pelaksanaantata cara pelaksanaan perpajakanefektifitas organisasi faktor-faktor mempengaruhi serta keterkaitannya penerimaan pajak kantor pelayanan pajak wajib pajak besar satuefektifitas pemungutan pajak hiburanpengaruh kualitas pemeriksaan kantor pemeriksaan penyidikan pajak (karikpa) jakarta khusus satu putusan badan penyelesaian sengketa pajak (bpsp) penerapan ketentuan pasal 37a undang-undang nomor 28 tahun 2007 tentang sunset policy rangka peningkatan wajib pajak orang pribadi (studi kantor pelayanaekstensifikasi wajib pajak penghasilan meningkatkan penerimaan negara kantor pelayanan pajak jakarta tamansarihubungan pemeriksaan pajak kepatuhan wajib pajak hotel restoran penerapan sistem self assessment (pada sukunas pendapatan daerah jakperlakuan akuntansi ppn pt sentra tatacahaya persadapenerimaan pajak indonesia tahun 1969/70 1996/97 analisis kinerja struktur pajakkemudahan pelayanan sistem pengendalian penerimaan pajak pertambahan nilaifaktor-faktor mempengaruhi pelaksanaan pemeriksaan bukti permulaanrektorat pemeriksaan penyidikan penagihan pajakketentuan pajak penghasilan berkenaan penyusutan barang modal secara membeli pembayaran lease finance lease pengaruhnya pajak pengahapengertian penghasilan sesuai azas keadilan pelaksanaan undang-undang pajak penghasilankontribusi bagi hasil penerimaan pajak bumi bangunan program bantuan pembangunan desa (di kabupaten malang jawa timur) tinjauan analisa pajak bumi bangunan (se-35/pj6/1991 daerah tingkat ii kotamadya bandar lampung) pengaruh jumlah modal pajak penghasilan pt ismbfmreksaa aspek perpajakannyaaspek pengembangan kelembagaan pemungutan pajak daerah tingkat kecamatan wilayah kota madya jakarta selatansistem komputerisasi perhitungan pajak bumi bangunananalisis kinerja penerimaan pajak bumi bangunan tahun 1993/1994 - 1998/1999pelaksanaan ketentuan undang-undang pajak penghasilan atas transaksi penjualan saham bursa efektinjau asas-asas perpajakan kesederhanaan administrasiperlakuan pajak atas penghasilan artis sinetron production house xpersepsi wajib pajaka pensiun tentang pembebanan biaya secara proporsional pengaruhnya perhitungan penghasilan kena pajakidentifikasi faktor-faktorperkirakan menjadi penentu defisit apbn melalui suatu pendekatan ekonometri' tentang potensi kapasitas penerimaan pajak hotel pemda kabupaten berau kalimantan timurpengaruh modernisasi adminstrasi perpajakan kualitas pelayanan kepada wajib pajak kantor pelayanan pajak pratama majalayaanalisis sistem aplikasi bphtbnettinjauanpengaruh kebijakan penghapusan sanksi adminstrasi (sunset policy) tingkat kepatuhan wajib pajak orang pribadi (pada kantor pelayanan pajak pratevaluasi sistem pengendalian intern atas struktur penggajian kantor pelayanan pajak wajib pajak besarpengolahan data surat permintaan pertanggung jawaban faktur pajak pajak pertambahan nilai (ppn) kpp bandung - kareestinjauan atas pajak pertambahan nilaimembentuk model upaya hukum pajak sesuai prinsip equality (kesamaan) equity (keadilan) pph pasal 23metode akuisisi perusahaan analisa pajak penghasilan atas capital gain; akuisisi internal indocement grouphubungan pendapatan asli daerah (pajak restribusi) anggaran pendapatan belanja daerahrangka mewujudkan otonomi daerah kotamadya samarindadampak pengenaan ppn bm atas barang konsumsi (pada produk sabun mandi minyak wangi) analisis trend linier pajak daerah retribusi daerah bagian laba bumd pendapatan lain-lain sah kabupaten sukabumianalisis penerapan pajak penghasilana pensiun pt xyztinjauan hukum mengenai electronic filling system tata cara penyampaian surat pemberitahuan (spt) pajak penghasilan menurutanalisis restitusi ptnamika elektra mandiritinjauan atas pelaksanaan pajakanalisa pengaruh perubahan tarif pajak penghasilan penerimaan pajak perspektif kurva lafferanalisis pelaksanaan ekstensifikasi pemberian nomor pokok wajib pajak (npwp) orang pribadi (op) kantor pelayanan pajak (kpp) tebetanalisa kajian beban pajak (tax burden) hiburan reklame pajak tontonan pajak papan nama kota palembangpengaruh penerapan kode etik pemeriksa pajak kepatuhan wajib pajak kpp pma limaanalisis pengaruh pembentukan kantor pajak modern peningkatan efektivitas pemeriksaan upaya pencapaian penerimaan pajakanalisis penghapusan pemungutan pajak pertambahan nilai oleh badan pemungut kontraktor bagi hasil penerimaan pajak pertambahan nilai kantor pelayanan pajakkajian penerapan zakat sebagai kredit pajak pajak penghasilan orang pribadi indonesiapenentuan penghasilan tidak kena pajak sebagai upaya mencapai keadilan pengenaan pajak penghasilan orang pribadipenentuan pajak pertambahan nilai terutang atas penyerahan paket program acara ke stasiun televisi oleh rumah produksimekanisme perhitungan ppn rangka pemenuhan kewajiban perpajakan pt xyzdeterrent effect penyidikan pajak asian agri group peningkatan kepatuhan wajib pajak sektor industri perkebunan kelapa sawitanalisis penggunaan faktor pajak sederhana mekanisme pajak pertambahan nilai pt abcanalisis kualitas pelayanan tingkat kepuasan wajib pajak kpp wajib pajak besar duaanalisis pelaksanaan ektensifikasi pemberian nomor pokok wajib pajak (npwp) orang pribadi (op) kantor pelayanan pajak (kpp) tebettinjauan penetapan dasar pengenaan pajak nilai lain atas produk rekamananalisis kualitas pelayanan restitusi pajak pertambahan nilai kantor pelayanan pajak penanaman modal asing satutinjauan yuridis tentang keberatan banding atas pengenaan pajak penghasilan (pph) pasal 26 undang-undang nomor 17 tahun 2000 (penerapan perjanjiananalisis perhitungan pph final atas pengenaan sewa tanah atau bangunan pd pasar jayaanalisis perancangan jaringan menggunakan routing protokol ospf sekretariat pengadilan pajakanalisis perancangan sistem informasi akuntansi penggajian pt eka jaya perkasapengaruh transfer pricing laporan keuangan pt aneka sumber kencana dampak perpajakannyaupaya optimalisasi pelaksanaan pemungutan pajak kendaraan bermotor pendapatan asli daerah periode 2003-2007 (di kantor samsat jakarta barat) potensi retribusi daerah bagi peningkatan pendapatan asli daerah sebuah studi kabupaten rembangperlakuan pajak penghasilan selisih kurs valuta asing tahun 1997perbandingan standar akuntansi fiskal serta pengaruhnya laporan keuanganhubungan pejabat penyidik pegawai negeri sipil (ppns) penyidik polri penyelesaian tindak pidana pajaktingkat kesadaran hukum wajib pajak pbb faktor mempengaruhinyainsentif pajak kaitannya pengembangan kualitas sumberdaya manusiapengaruh pelaksanaan koordinasi pemerintah daerah khusus ibukota jakarta kepatuhan wajib pajak kantor pelayanan pajak jakarta grogol petamburananalisis implementasi kebijakan penyelesaian tunggakan restitusi ppn (kajian atas per-122/pj/2006 tanggal 15 agustus 2006 tentang jangka waktu penyelesaianalisis pengaruh pemeriksaan tingkat kepatuhan wajib pajak hiburan sukunas pendapatan daerah kotamadya jakarta barateran sistem administrasi perpajakan modern upaya meningkatkan kepatuhan wajib pajak kantor pelayanan pajak wajib pajak besar satu (large taxpayer office operlakuan akuntansi perhitungan pajak revaluasi aktiva tetap pt bank metania (persero) tbkanalisis zakat sebagai faktor pengurang penghasilan kena pajak tinjauan aspek sinergi antara zakat pajakanalisis mekanisme pemungutan pajak reklame serta pengaruhnya efektifitas nas pendapatan daerah propinsi dki jakartapemanfaatan analisis risiko pengusaha kena pajak proses penyelesaian restitusi pajak pertambahan nilai studi kantor pelayanan pajak penanaman modal asinekstensifikasi obyak pajak hiburan game online (dki jakarta) dampak pemungutan pajak penghasilan final kepatuhan wajib pajak perusahaan pelayaran negeriimplikasi penerapan sistem administrasi perpajakan modern kantor pelayanan wajib pajak besar dua perencanaan perpajakan (tax planning) wajib pajaktinjauan kebijakan pengenaan pajak pertambahan nilai (ppn) penyerahan barang kena pajak kantor pusat ke kantor cabang atau sebaliknyakualitas layanan kantor pelayanan pajak tingkat kepuasan wajib pajak kantor pelayanan pajak penanaman modal asing satupelayanan bbn kendaraan bermotor samsat kodya semarangdesain pembuatan purwarupa sistem informasi pendapatan daerahnas pendapatan daerah kabupaten kediririset atas pendapatanterima berupa seivice charge tip sebagai objek pajak (penelitian rumah makan jakarta barat jakarta selatan) masalah hak kewajiban hukum bentuk usaha tetap indonesiapengaruh penerapan sistem monitoring pelaporan pembayaran pajak (mp3) tingkat kepatuhan wajib pajak (studi empiris kantor wilayahrektorat jenderalkebijakan pengampunan pajak indonesia (suatu tinjauan atas kebijakan pengampunan pajak tahun 1984 pengampunan pajak tahun 2008) analisis efisiensi pemeriksaan pajak kantor pemeriksaan penyidikan pajak jayapurapembukuan pembayaran pajak mata uang dollar amerika serikatpenerimaan pajak hiburan propinsi dki jakarta tahun 1995/1996 sd 1999/2000 studi korelasi tingkat inflasi nilai kurs kinerja pemungutan pajak hioptimalisasi penerimaan pajak bumi bangunan wilayah daerah khusus ibukota jakarta melalui nilai jual obyek pajakpemberian insentif pajak rangka penanaman modal indonesia kajian instruksi presiden no3 tahun 2006 tentang paket kebijakan perbaikan iklim inveskewenangan pajak daerah pelaksanaan otonomi daerah kota bekasikebijakan pengurangan tarif pajak penghasilan wajib pajak badan usaha mikro kecil menengah (umkm) tinjau asas keadilanevaluasi pengenaan ppn atas penjualan jasa baranglakukan oleh perusahaan penjual barang jasakebijakan pajak penghasilan atas komisibayarkan kepada petugasnas luar asuransifaktor-faktor mempengaruhi efektifitas efisiensi administrasi perpajakan tunggakan pajak studi kantor pelayanan pajak wilayah djp jakartatinjauan azas keadilan kebijakan pengenaan pajak penghasilan atas penghasilan transaksi penjualan saham bursa efekanalisis pengaruh pengawasan intern penerapan good governancerektorat jenderal pajak citra organisasi kepatuhan wajib pajak kperlakuan pajak penghasilan atas merger akuisisi badan usaha indonesia penggabungan badan usaha pt abc pt xyzanalisis pelaksanaan pemungutan pajak hotel restoran (phr) sukunas pendapatan daerah kodya jakarta pusatperbedaan pengaruh laporankeuanganaudit tidakaudit pemeriksaa pajak kantor pemeriksaan penyidikan pajak karawangpengaruh persepsi wajib pajak orang pribadi atas tax payer's service quality pelaksanaan self assessment system (pada wajib pajak orang pribadiperanan pengendalian intern menunjang efektivitas penerimaan pajakprosedur penyetoran perhitunganpenerapan undang-undang no18 tahun 2000 penyerahan perolehan barang/jas kena pajak pt sido muncul surabayamekanisme perhitungan penarikan pajak hotelnas pendapatan daerah kota bandungimplementasi peraturan daerah (perda) peranannas pendapatan daerah kabupaten subangpemungutan pajak pagelaran musik kabupaten sukoharjo (proses kendala pemanfaatan) kontribusi realisasi pajak daerah peningkatan pendapatan asli daerah mendukung pelaksanaan otonomi daerah (pada pemerintah kota salatiga) analisis kinerja pemungutan pajak bumi bangunan (pbb) propinsi dki jakartakinerja pajak pertambahan nilai (ppn) pajak penjualan atas barang mewah (ppn bm) periode tahun 1984-2003evaluasi key performance indicator pendekatan balanced scorecard sebagai alat pengukuran kinerja sebuah kpp wajib pajak besar satupersepsi wajib pajak yayasan pendidikan implementasi perencanaan perpajakan sebagai upaya legal rangka meminimalkan jumlah pajak terutang suranalisis persepsi aparat pajak mengenai peranan administrasi perpajakan meningkatkan kepatuhan wajib pajak hotel restoran dki jakartaanalisa penerimaan pajak reklame kota surabayaaspek hukum perpajakan atas transfer pricing perusahaan multinasional indonesia rektur jenderal pajak vs pt tyrolit vincentpengenaan pajak penghasilan atas capital gains indonesia suatu kajian teoritis studi banding beberapa negara lainnyateori praktek pemajakan atas penghasilan wajib pajak warga negara indonesia karyawan kontraktor production sharing bekerja menetap sementara luar nepengaruh retribusi daerah penerimaan pendapatan asli daerah kota cimahiperanan pejabat pembuat akta tanah pembayaran pajak atas transaksi jual beli tanah bangunan kotangpotensi penerimaan pajak bumi bangunan sektor perdesaan perkotaan kabupaten boalemo 2005analisis faktor-faktor mempengaruhi minat adopsi e-filling oleh wajib pajak indonesiaperanan dprd kabupaten sleman meningkatkan pendapatan asli daerah sektor penerimaan pajak daerah/ sumyarakibat hukum putusan pengadilan pajak atas gugatan pph badan pemberian imbalan bungapengaruh kepemimpinan transaksional transformasional kepuasan kerja karyawan kantor pelayanan pajak pratama magelangevaluasi potensi pajak daerah sebagai sumber pendapatan asli daerah (pad) kabupaten sukoharjopengaruh transaksi pihak-pihak memiliki hubungan istimewa perencanaan pajakkinerja pengelolaan pajak daerah melalui proses intensifikasi kabupaten sleman tahun 2004analisis efektivitas implementasi kebijakan penerimaan negara bukan pajak (pnbp) departemen kelautan perikanan/ tomo hsestimasi potensi pajak hotel kota gorontaloevaluasi kemampuan mosaik video kegiatan pendapatan obyek pajak bangunanpengaruh program kemitraan kepatuhan wajib pajak kinerja organisasi sebagai variabel interveningpenerapan lembaga paksa badan (gijzeling) pelunasan pajak terutanganalisis faktor-faktor mempengaruhui kepuasan penguna internet portalrektorat jendral pajakpengaruh keadilan kompensasi persepsian kepuasan kerja karyawan kantor pelayanan pajak pratama magelangimplementasi perda no 5 tahun 2002 tentang pajak reklame kabupaten slemanimplementasi ketentuan pembayaran zakat sebagai pengurang penghasilan kena pajak (studi kpp pratama sukoharjo) pungutan pajak bumi bangunan serta implikasinya ketahanan wilayah (studi kota medan) upaya peningkatan penerimaan pajak reklame kabupaten magelangefektivitas penerimaan pajak kabupaten lahat/ herman panggabeananalisis strategi pemasaran perpajakan kantor pelayanan pajak pratama yogyakarta/ koharuddin abdillahefektivitas efisiensi pajak pengambilan bahan galian golongan c kabupaten muara enim propinsi sumatera selatan tahun 2000/2001-2002/ rinaldopengaruh penurunan tarif pajak saham pendiri keputusan pelepasan saham pendiri saat ipodampak penyidikan tindak pidana bidang perpajakan bagi wajib pajak surakarta motivasi berprestasi lingkungan keluarga hubungannya prestasi belajar siswa kelas ii smu negeri lawang kabupaten malang pudji widajati pemilihan alternatif perbaikan meminimasi biaya lingkungan pendekatan environmental management accounting (pt kertas leces persero) peran serta masyarakat program gerakan nasional rehabilitasi hutan lahan (gn-rhl) kasus gn-rhl kecamatan napabalano kabupaten muna/ dewi sartika studi pengembangan teknologi surjan penampung air hujan sistem usahatani basis hortikultura aman lingkungan das brantas hulu laporan penelitian hubungan antara faktor lingkungan faktor sosiodemografi kejadianare balita desa blimbing kecamatan sambirejo kabupaten sragen tahun 2009 hubungan antara faktor lingkungan kekambuhan asma bronkhiale klien rawat jalan poliklinik paru instalasi rawat jalan rsud dr moewardi surakarta analisis reduksi emisi gas metan melalui proyek mekanisme pembangunan bersih (cdm) pabrik pengolahan kelapa sawit rangka pengelolaan lingkungan hidup evaluasi kesesuaian lahan permukiman hubungannya potensi bahaya banjir erosi kecamatan ungaran kabupaten semarang/ heince christonovel hubungan perilaku sehat sanitasi lingkungan infeksi cacingtularkan melalui tanah nagari kumanis kabupaten sawahlunto/sijunjung/ pembuatan demplot reklamasi lahan bekas tambang batu gunung sebagai upaya pelestarian lingkungan kawasan lindung taman hutan raya sultan adam laporan kegiatan sistem zonasi pengelolaan taman nasional laut berdasarkan indeks kepekaan lingkungan kepulauan karimunjawa kabupaten jepara propinsi jawa tengah upaya penanggulangan pencuri pemberatan lingkungan pemukiman melalui tindak perfentif peningkatan siskamling polsek metro tambora jakarta barat pelaksanaan mediasi sebagai alternatif penyelesaian sengketa lingkungan hidupkaitkan fungsi badan pengendalian lingkungan hidup daerah sebagai mediator tingkat kebisingan pesawat terbang respon penduduk kota yogyakarta bawah jalur pendekatan-lepas landas bandara adisutjipto/ veronica setioningtyas prativi akses perempuan pengelolaan lingkungan ibu rumah tangga pengguna kayu bakar kawasab banawa selatan kabupaten donggala laporan penelitian analisis hubungan antara kinerja lingkungan kinerja keuangan perusahaan pertambangan peserta proper terdaftar bursa efek indonesia periode 2003-2007 analisis pengaruh orientasi stakeholder strategi manajemen lingkungan dampaknya kinerja perusahaan (studi industri tekstil jawa tengah) beberapa faktor kondisi fisik lingkungan kerja berhubungan motivasi kerja tenaga kerja bagain produksivisi ii industri sepatu bakti surakarta bentuk penerapan tanggung jawab lingkungan dunia usaha sebuah industri perbekalan kesehatan rumah tangga kawasan industri jababeka - cikarang daya tahan hidup colletotrichum dematium f truncata (schw) v arx (comb nov) penyebab penyakit antraknosa tanaman kedelai berbagai keadaan lingkungan pengaruh minat baca lingkungan belajar prestasi belajar ekonomi siswa kelas viii smp negeri 3 kaliwiro kabupaten wonosobo tahun ajaran 2007/2008 persepsi masyarakat mengenai dampak pencemaran udara oleh emisi gas buang kendaraan bermotor kota yogyakarta sekitarnya tinjauan politik hukum pidana etika lingkungan kebijakan perlindungan lingkungan hidup amerika masa pemerintahan presiden bill clinton (1993-1997) pt freeport indonesia pengaruh budaya organisasi motivasi kerja pegawai bidang kebersihan lingkungan hidupnas pekerjaan umum lingkungan hidup kabupaten jembrana pengaruh budaya organisasi motivasi kerja pegawai bidang kebersihan lingkungan hidupnas pekerjaan umum lingkungan hidup kabupaten jembrana pengaruh lingkungan perilaku struktur organisasi implementasi sistem informasi berbasis komputer kinerja karyawan pemerintah kabupaten sorong papua dampak lingkungan usaha pertumbuhan investasi ekonomi indonesia aplikasi model makroekonomiperluas variabel corruption perception indexstribusi logam berat timbal tanaman mahoni akibat emisi kendaraan bermotor kawasan permukiman lingkar timur lingkar utara yogyakarta/ rifa hendrianty evaluasi keterkaitan pengembangan industri masalah kependudukan pencemaran lingkungan kawasan berikat nusantara cakung marunda jakarta hubungan faktor-faktor lingkungan perilaku kader kesehatan pengelolaan lingkungan kejadian malaria daerah hci ici kecamatan mayong jepara pelatihan cara pengendalian penyakit parasit sapi meningkatkan sanitasi lingkungan ktt rejeki lumintu desa sumurrejo kecamatan gunungpati kota semarang pencemaran plumbum (pb) air lindi ikan tambak kandungan plumbum rambut konsumen tempat pembuangan akhir terjun kota medan tahun 2006/ zainul ikhwan pengaruh kepemimpinan motivasi pelatihan lingkungan kerja kinerja karyawan (surveynas kesejahteraan sosial panti tuna grahita raharjo sragen) janda muda (studi deskriptif tentang makna janda muda surabaya tindakannya menghadapi stigma status janda muda berkembang lingkungan sosialnya) janda muda (studi deskriptif tentang makna janda muda surabaya tindakannya menghadapi stigma status janda muda berkembang lingkungan sosialnya) janda muda (studi deskriptif tentang makna janda muda surabaya tindakannya menghadapi stigma status janda muda berkembang lingkungan sosialnya) janda muda (studi deskriptif tentang makna janda muda surabaya tindakannya menghadapi stigma status janda muda berkembang lingkungan sosialnya) kajian hubungan pengetahuansikap pelaksanaan peran serta masyarakat pemeliharaan jalan dl perumahan (perumahan sederhana kota bandar lampung) penentuan laju korosi baja aisi 4340 sebagai bahan konstruksi bangunan karena pengaruh lingkungan kerja media pendingin proses laku panas laporan penelitian pengaruh implementasi peran guru bimbingan konseling lingkungan keluarga prestasi belajar pkn siswa kelas viii smpn 1 karanganom tahun pelajaran 2009/2010 studi kemungkinan pemanfaatan perifiton sebagai bioindikator pencemaran logam berat cu pb sungai kaligarang lingkungan industri semarang laporan hasil penelitian analisis kestabilan lereng pengelolaan lingkungan sekitar segmen cadas pangeran jalan raya bandung-sumedang kabupaten sumedang jawa barat laporan penelitian analisis variasi nilai redoks potensial lapisan sedimen sebagai indikator stabilitas lingkungan perairan pesisir muara badak kabupaten kutai laporan penelitian pengaruh komitmen organisasi locus of control lingkungan kerja kompensasi kinerja pegawai sekretariat dewan perwakilan rakyat daerah kota surakarta pengaruh mentoring kepuasan kerja konflik peran prestasi kerja serta niatan pindah studi empiris lingkungan kantor akuntan publik se jawa timur pengkajian sosial budaya lingkungan masyarakat terasing pameu desa meurandeh paya desa tanjung kecamatan silih nara kabupaten aceh tengah laporan penelitian alternativespute resolution/adr pelaksanaan penegakan hukum lingkungan konsep adr kasus pencemaran laut oleh kapal mt king fisher laporan penelitian dampak kelengkapan sistemik sistem informasi pengaruh lingkungan belajar proses transformasi potensi intelektual individu menjadi modal intelektual kelompok pengaruh locus of control lingkungan kerja pemanfaatan teknologi informasi kinerja pelayanan pegawai unit pelayanan terpadu pemerintah kota surakarta tinjauan hukum pengolahan limbah sebagai sarana pengelolaan lingkungan hidup meningkatkan produksi tekstil (pt polysindo eka perkasa kendal) kawasan zona bahaya merapi studi tentang stigma lingkungan pengaruhnya penurunan nilai persepsi tanah pertanian kecamatan pakem kabupaten sleman tahun 2008 korelasi situasi lingkungan jalan raya tingkah laku pengemudi (suatu studi deskriptif ketidak patuhan pemakai jalan raya kecamatan kebayoran lama jakarta selatan pelaksanaan ketentuan hukum lingkungan peternakan sapi perah (peternakan sapi perah rakyat bantuan pemerintah kabupaten banyumas propinsi jawa tengah) pemodelan spasial epidemiologi demam berdarah dengue menggunakan sistem informasi geografis kelurahan terban kecamatan gondokusuman kotamadya yogyakarta/ prima widayani pengaruh persepsi lingkungan individu pengunjung keputusan berbelanja mal (suatu survey perubahan perilaku belanja rumah tangga kota pontianak) perlindungan environmental rights korban dampak kerusakan lingkungan kebakaran hutan indonesia (1998) luapan lumpur sidoardjo-lapindo brantas (2006) studi operasional perencanaan lingkungan jangka panjang pendekatan modelnamika ekosistem pulau analisis situasi pulau lombok bidang kebutuhan dasar (pertanian) hubungan partisipasi anggaran informasi job relevan serta pengaruhnya kepuasan kerja kinerja manajerial lingkungan pemerintah daerah/ siegers vebyana pengaruh sistem akuntansi manajemen desentralisasi ketidakpastian lingkungan kinerja manajerial (survey perusahaan penerbit percetakan surakarta) persepsi masyarakat penggunaan bahan peledak menangkap ikan lingkungan polassi desa tambolongan kabupaten selayar propinsi sulawesi selatan studi operasional perencanaan lingkungan jangka panjang pendekatan modelnamika ekosistem pulau analisis situasi pulau lombok bidang keseimbangan ekosistem pulau pengaruh budaya organisasional lingkungan kerja kinerja perawat rumah sakit mata dr yap yogyakarta motivasi kepuasan kerja sebaai variabel pemediasi meningkatkannilai tambah kertas bekas kantong semen pengembangan desain bentuk fungsi grafis serta asessori bahan lingkungan kotamadya medan laporan penelitian efektifitas penerapan model cooperative learning tipe stad pembelajaran sains peningkatan aktivitas belajar siswa penguasaan konsep pencemaran lingkungan smp faktor-faktor lingkungan stratejik pengembangan perguruan tinggi swasta (studi tentang faktor-faktor lingkungan perguruan tinggi swasta berakreditasi jawa barat) pelaksanaan sistem kebijaksanaan pengelolaan lingkungan hidup pengelolaan pembangunan berkelanjutan berwawasan lingkungan (studi kota semarang prov jawa tengah) pembangunan fasilitas sosial oleh developer lingkungan permukiman berdasarkan undang-undang nomor 4 tahun 1992 kotamadya daerah tingkat ii pontianak laporan penelitian respon masyarakat botawa rencana pembangunan ibukota kabupaten kasus masyarakat desa botawastrik waropen bawah kabupaten waropen propinsi papua/ roberth waromi aspek pidana perusakan lingkungan pelestarian alam kawasan konservasi cagar alam tangkoko duasudara kecamatan bitung utara bitung tengah laporan penelitian pengaruh lingkungan tempat tinggal mahasiswa motivasi belajar penyelesaian tugas akhir program studi arsitektur jurusan pendidikan teknik bangunan fptk upi kearifan lingkungan masyarakat kampung kuta bagi kelestarian sumber daya alam lingkungan desa karangpaningal kecamatan tambaksari kabupaten ciamis jawa barat mengefektifkan pembelajaran menulis deskripsi memanfaatkan benda-benda lingkungan kelas sebagai sumber belajar siswa kelas 4 sekolah dasar nomor 3 kampung anyar singaraja pengaruh persepsi mahasiswa lingkungan tempat tinggal lingkungan teman sebaya minat mahasiswa atas jasa upi net (suatu kasus mahasiswa fpips upi angkatan 2003) penyusunan rencana pengembangan jabatan tingkat junior manager biro-biro pengelola kemahasiswaan alumni infrastruktur kerjasama universitas katolik indonesia atma jaya pengaruh adaptabilitas lingkungan orientasi kewirausahaan kualitas aliansi meningkatkan keunggulan bersaing (pt pos indonesia wilayah jawa barat) pengaruh komunikasi kepemimpinan kesadaran hukum anggota kelompencapir bidang pengelolaan lingkungan hidup kabupaten dati ii banyumas laporan hasil penelitian pengaruh persepsi tentang profesionalitas komunikasi lingkungan kerja motivasi kerja kinerja perawat rumah sakit orthopedi prof dr r soeharso surakarta variabel-variabel lingkungan berperan perkembangan kemampuan spasial suatu studi anak usia sekolahpemukimant tidakt wilayah dki jakartanamisasi pemolisian masyarakat komunitas kecil wilayah hukum polres bojonegoro (sistem keamanan lingkungan (siskamling) desa tanjung harjo kedung adem) kajian lingkungan pemanfaatan material limbah sebagai bahan bakar alternatif pengganti bahan bakar fosil proses produksi klinker semen ptholcim indonesia tbk pabrik cilacap kegiatan pengembangan eksplorasi teknologi pengolahan bgn pengendalian dampak lingkungan serta pengelolaan kawasan instalasi nuklir tahun 2006-2004 laporan hasil penelitian pengaruh kecerdasan emosional lingkungan belajar tingkat pemahaman akuntansi (survei mahasiswa akuntansi perguruan tinggi se-wilayah eks karesidenan surakarta) pengaruh lingkungan keluarga kondisi sekolah prestasi belajar mata pelajaran ekonomi siswa kelas xi tahun ajaran 2007/2008 sma negeri 5 malang bintari marga utami pengaruh sistem akuntansi manajemen desentralisasi ketidakpastian lingkungan kinerja manajerial survey perusahaan tekstil wilayah eks karesidenan surakarta) pengaruh tata bangunan lingkungan re-radiasi lingkungan kaitannya kenyamanan thermal perkotaan tropis lembab potongan jl h agus salim semarang implementasi undang-undang lingkungan hidup bagi kehidupan masyarakat pusat listrik tenaga panas bumi (pltp) sebagai sumber energi alternatif (di pltpeng wonosobo) hubungan antara kinerja lingkungan pengungkapan lingkungan kinerja ekonomi (studi empiris perusahaan pertambangan terdaftar bursa efek indonesia periode 2004 2006 pengaruh lingkungan aktivitas belajar prestasi mata pelajaran ekonomi siswa kelas xi program ilmu pengetahuan sosial sma muhammadiyah 3 sukoharjo tahun pelajaran 2006/2007 pengembangan usaha pemanfaatan rangka konservasi terumbu karang secara tradisional kawasan pantai teluk hatawano pulau saparua kabupaten maluku tengah/ edir lokollo analisis manajemen aset atau barang milik negara mendukung penyusunan laporan keuangan pemerintah pusat studi sekolah lingkungan departemen agama propinsiy tahun 2008 dampak pencemaran udara oleh emisi gas so2 no2 kendaraan bermotor resistensi pohon tanjung (mimusop elengi l) sebagai vegetasi pelindung kota yogyakarta/ surya marizal pengaruh faktor lingkungan faktor individu faktor komunikasi pemasaran keputusan membeli obat farmasi antara apotek kabupaten sukoharjo apotek kota surakarta pengaruh gaya kepemimpinan upah lingkungan kerja produktivitas tenaga kerja industri kerajinan ukir ukiran tembaga muda tama tumang kec cepogo kab boyolali pengaruh lingkungan sekolah prestasi belajar siswa bidang studi pendidikan kewarganegaraan (studi deskriptif analitis sma negeri 2 bandung tahun pelajaran 2005/2006) pengaruh lingkungan sosial ekonomi pendidikan pelatihan kualitas jasa tenaga kerja indonesia berorientasi luar negeri (puslatker ijm kota bandung) peran serta masyarakat pemeliharaan prasarana lingkungan permukiman perkotaan kel kramat kel beurawe kel kuta alam kota banda aceh laporan penelitian arah kebijaksanaan pemerintah kota semarang da lam pemberian ijin proyek pembangunanperumahan (real estat) sebagai upaya pengembangan kota berwawasan lingkungan berkelanjutan pengaruh informasi akuntansi kinerja manajer ketidakpastian lingkungan kepuasan kerja sebagai variabel moderating (survey bank-bank konvensional surakarta) analisis corporate social responsiblity pengaturannya indonesia corporate social responsibility pt freeport indonesia suku amungme desa banti papua indikator kesehatan anak sarana air serta fasiitas kesehatan lingkungan santri pondok pesantren sukamiskin kecamatan sukamiskin kota bandung laporan penelitian pengaruh lingkungan keluarga partisipasi siswa kegiatan ekstrakurikuler prestasi belajar akuntansi siswa kelas x smk negeri i juwiring klaten tahun ajaran 2007 2008 hubungan persepsi kewajaran mahasiswa penampilan fisik mahasiswi mengundang pelecehan seksual perilaku pelecehan seksual lingkungan kampus unika atma jaya jakarta pelaksanaan sanksi administratif pencemaran lingkunganakibatkan oleh limbah industri rangka penegakan hukum lingkungan (di kotamadia dati ii semarang) pelaksanaan sanksi administratif pencemaran lingkunganakibatkan oleh limbah industri rangka penegakan hukum lingkungan (study kasus kotamadia dati ii semarang) pengaruh persepsi siswa kegiatan bimbingan konseling lingkungan keluarga prestasi belajar ekonomi siswa kelas ix smp negeri 2 mojosongo boyolali tahun ajaran 2009/2010 penyidikan penambangan pasir illegal oleh satuan reskrim polres cimahi (kerusakan lingkungan hidup blok ciamis desa gunung masigit kec ciputat oleh mulia prianto studi operasional perencanaan lingkungan jangka panjang pendekatan modelnamika ekosistem pulau analisis situasi pulau lombok bidang kebutuhan dasar (air industri rumah bbm) stribusi temporal ion klorida limbah cair industri tekstil batik proses pertumbuhan limnocharis flava (genjer) kecamatan laweyan desa kingkang/ nuryaningsih implementasi kebijakan pembangunan perkebunan kelapa sawit pola pir ramah lingkungan upaya pemberdayaan ekonomi rakyat kabupaten manokwari papua/ nataniel dominggus mandacan pengaruh perhatian siswa pembelajaran lingkungan sekolah hasil belajar mata pelajaran akuntansi siswa kelas xi smk muhammadiyah 2 wuryantoro tahun ajaran 2007/2008 perkembangan perkebunan kelapa sawit dampaknya lingkungan sosial ekonomi penduduk kasus penduduk kecamatan parindu kabupaten sanggau kalimantan barat laporan penelitian persepsi masyarakat pengelolaan lingkungan tradisional (sasi) sebagai konservasi sumber daya alam kecamatan saparua kabupaten maluku tengah laporan penelitian kajian pola pengembangan perumahantinjau unsur-unsur pembentuk karakter lingkungan bangunan perumahan bale agung residence jogja regency casa grande yogyakarta pengaruh indobas 500 ec tingkat penetasan telur ikan mas (cyprinus carpio l) penerapannya sebagai kegiatan laboratorium topik pencemaran lingkungan wiwit widyani rencana pokok pengembangan jurusan ilmu perpustakaan fakultas sastra universitas indonesia 1982-1991 suatu langkah persiapan menuju pembentukan fakultas kajian informasi lingkungan ui) tindakan badan pengendalian dampak lingkungan propinsi jawa timur mengurangi industri pencemar air sungai era otonomi daerah pt akn mojokerto laporan penelitian galian batuhias pertambangan rakyat g kuda majalengka kaitannya masalah kelestarian alam tata lingkungan satu contoh lokasi penggalian batuhias jabar kearifan tradisional masyarakat konservasi sumberdaya hutan das kasus masyarakat desa mantembustrik yapen selatan kabupaten yapen propinsi papua/ cyfrianus yustus mambay pengaruh kandungan ca mg na limbah cair industri kulit nisbah penjerapan sodium air tanah daerah sorowajan kabupaten bantuly/ ig sonnyndra artha novembha pengaruh teknik rehabilitasi hutan mangrove pola kepiting keramba konservasi lingkungan pendapatan nelayan perambah hutan kabupaten cilacap jawa tengah laporan penelitian pengungkapan kasus pencemaran limbah tailing industri pt new mont nusa tenggara oleh penyidikan pegawai negeri sipil badan pengendalian dampak lingkungan daerah provinsi nusa tenggara barat analisis lingkungan eksternal internal rangka pengembangan instalasi pelayanan kesehatan handil bakti rsud h abdul aziz marabahan kabupaten barito kuala propinsi kalimantan selatan fungsi pendidikan ilmu lingkungan pengembangan sumberdaya manusia analisis persepsi lulusan angkatan viii (1989/1990) sampai xi (1992/1993) program pascasarjana universitas indonesia penelitian palaekologi paleoenvironment rekonstruksi sejarah kehidupan manusia purba homo eretus jawa berdasarkan penelitian paleontologi vertebrata daerah paitayam jawa tengah studi ekologi limpet daerah tropis pengaruh faktor-faktor lingkungan pola pertumbuhan rekruitmen struktur populasistribusi perubahan bentuk cangkang laporan penelitian dampak kehadiran perkebunan kelapa sawit perubahan sosial ekonomi lingkungan alam desa mega timur kecamatan sungai ambawang kabupaten dati ii pontianak laporan penelitian pengaruh faktor lingkungan biologi sosial-ekonomi kasus infeksi saluran pernapasan akut (ispa) anak desa guali kecamatan kusambi kabupaten muna tahun 2001 tenggarudin pengaruh kebisingan getaran perubahan tekanan darah masyarakat tinggal pinggiran rel kereta api lingkungan xiv kelurahan tegal sari kecamatan medan denai tahun 2008 2009 pengaruh limbah cair ptpertamina upiii (persero) kualitas air ekosistem perairan sungai musi sungai komering sekitar pt pertamina upiii (persero) plaju sumatera selatan pengaruh tingkat kemampuan keaksaraan status sosial ekonomi lingkungan kelaurga gairah melestarikan kemampuan keaksaraan kehidupan sehari-hari vike margaretna sunarko putri efektifitas penerapan model precede meningkatkan kompetensi bidang kesehatan lingkungan suatu penelitian mahasiswa akl depkes bandung proses pembelajaran lahan praktek pengaruh lingkungan sarana prasarana belajar prestasi belajar studi mata pelajaran ekonomi siswa kelas x sma negeri 1 lawang tahun ajaran 2005-2006 hijrah saputro perubahan penggunaan lahan pertanian wilayah resapan air pengaruhnya kondisi fisik sosial desa umbulmartani desa sukoharjo kabupaten sleman/ irma sandiyani analisa pengaruha ketidakpastian lingkungan customization interdependensi desain karakteristik informasi broad scope aggregation sistem akutansi manajemen/ indriana widyastutistribusi vertikal kadar abu sulfur lapisan batubara tanjung enim kaitannya genesa berasal hochmoor lingkungan pengendapan berubah payau ke air tawar penggunaan model penelitian sosial pembelajaran ips pokok bahasan mengenal lingkungan keluarga meningkatkan sikap sosial siswa kelas iii sdn bunulrejo ix kota malang siswanita evaluasi tingkat pemberian serat kasar ransum em-4 efisiensi penggunaan pakan kadar profil lemak darah ayam broiler berat karkas sanitasi lingkungan laporan penelitian pengaruh pemakaian scrubber kadar emisi gas so2 no2 co debu pembakaran batu kapur uji laboratoris laboratorium balai teknik kesehatan lingkungan yogyakarta/ sigit hernowo evaluasi tingkat pemberian serat kasar ransum em-4 efisiensi penggunaan pakan kadar profil lemak darah ayam broiler berat karkas sanitasi lingkungan laporan penelitian hubungan hasil pelatihan motivasi berprestasi lingkungan sosial perilaku wirausaha pemuda desa usaha budidaya ikan binaan uptd-skbnas perikanan kelautan kab sukabumi pemanfaatan urine ternak sapi perah pembuatan pupuk organik cair dusun ngandong desa girikerto kecamatan turi kabupaten sleman daerah istimewa yogyakarta/ akhmad trisasongko adi putranto pengaruh faktor manajerial lingkungan organisasional intensitas perencanaan strategis peningkatan kinerja finansial studi empiris bank perkreditan rakyat jawa tengah perbedaan keterampilan sosial antara remaja madya usia 15-18 tahun mengikuti program reguler mengikuti program akselerasi smu (penelitian siswa smu lab school rawamangun) stribusi inventarisasi keragaman jenis kepiting canggah (uca spp) hubungannya kualitas lingkungan perairan kawasan hutan bakau selatan kota denpasar bali laporan penelitian sistem pengelolaan lingkungan hidup berbasiskan adat pembangunan berkelanjutan studi tentang kampong temawank masyarakat dayak simpang kabupaten ketapang kalimantan barat/ a alibata penggunaanksi gaya bahasa sajak siswa kelas vii smp negeri 1 sumbermanjing kabupaten malang tahun ajaran 2004/2005 berdasarkan pemanfaatan lingkungan sekolah hlis okta priangga sari studi mengenai profil limbah rumah potong ayam (rpa) daerah jakarta bogor tangerang bekasi (jabotabek) dampaknya kesehatan masyarakat kesehatan lingkungan laporan penelitian bioremediasi tanah terkontaminasi minyak bumi menggunakan kultur bakteri petrofilik lokal sporotrichum pulverulentum vico indonesia kalimantan timur/ tangkas manuturi siahaan pemberdayaan masyarakat meningkatkan kesejahteraan berspektif lingkungan studi ekologi budaya kawasan hutan mangrove/lahan basah jawa tengah kalimantan timur laporan penelitian pencemaran udara oleh debu abu terbang kawasan pltu paiton sekitarnya provinsi jawa timur pemanfaatan limbah abu terbang sebagai filler pengganti campuran beton aspal/ yulianti nurzaida pengembangan perangkat lunak simulasi marine hazard database keandalan kapal sebagai salah satu upaya memperbaiki tingkat keselamatan pengoperasian kapal proteksi lingkungan laut indonesia strategi penataan pedagang kaki lima (pkl) lingkungan kampus sebagai fasilitas penunjang pelayanan kegiatan kampus pkl belakang kampus uns kentingan surakarta laporan penelitian upaya peningkatan hasil belajar ipa tentang proses pembentukan tanah melalui pemanfaatan tanah melalui pemanfaatan lingkungan sebagai sumber belajar bagi siswa kelas v sd negeri pasarkliwon surakarta sikap ramah lingkungan perempuan hubungannya keberhasilan program pengelolaan hutan bersama masyarakat (phbm) proyeknas kehutanan kecamatan cimalaka kabupaten sumedang tinjauan aspek sosial ekonomi masyarakat lingkungan perencanaan daerah aliran sungai sub sub das plemahan kec sempor kabupaten kebumen jawa tengah/ang kuncara sakti uji efektifitas bakteri kitinolitik sebagai pengendali pertumbuhan kapang patogen penyebab penyakit utama tanaman sayuran potensinya sebagai bahan biofungisida ramah lingkungan laporan penelitian analisis hubungan antara kondisi sanitasi lingkungan perilaku penduduk kepadatan vektor demam berdarah dengue (dbd) kecamatan sangatta utara kabupaten kutai timur provinsi kalimantan timur pemberdayaan masyarakat meningkatkan kesejahteraan bersprespektif lingkungan studi ekologi budaya kawasan hutan mangrove/lahan basah jawa tengah kalimantan timur laporan penelitian pengembangan rancangan pembelajaran mata pelajaran sains model inkuiri bagi guru kelas v sekolah dasar lingkungan yayasan tarakanita yogyakarta surabaya veronica dwi atmi widyastuti penurunan toksisitas leachate (air lindi) tpas putri cempo mojosongo surakarta pac (poly aluminum chloride) efek patologis insang ikan nila merah (oreochromis niloticus) dwi astuti studi adaptasi masyarakat tradisional lingkungan hidupnya (faktor-faktor mempengaruhi pola perencanaan pelestarian lingkungan permukiman tradisional kampung naga tasikmalaya jawa barat) pengelolaan lahan pertanian ramah lingkungan sistem intensifikasi tanaman padi melalui pemanfaatan mikroorganisme lokal pembuatan kompos (di desa sidodadi kabupaten deli serdang) peningkatan hasil belajar mata pelajaran geografi materi pokok lingkungan hidup pelestariannya model contoh non contoh siswa kelas viii semester ii smp negeri 1 malang deristaanawati analisis dampak sosial ekonomi hutan mangrovekelola kelompok informal peningkatan kesejahteraan masyarakat desa pulau sembilan kecamatan pangkalan susu kabupaten langkat sumatera utara arah kebijaksanaan pemerintah kota semarang pemberian ijin proyek pembangunan perumahan (real estat) sebagai upaya pengembangan kota berwawasan lingkungan berkelanjutan laporan penelitian evaluasi daya dukung lahan tanaman pangan desa binting hilir desa sungai bangkal desa tajau landung kecamatan sungai tabuk kabupaten banjar provinsi kalimantan selatan/ lathifah pemahaman konsep-konsep dasar ekologi sikap masyarakat petani sekitarau tondano kerusakan lingkungan serta implikasinya pendidikan ipa kec eris dati ii kab minahasa pengaruh kesehatan lingkungan timbulnya penyakit masyarakat desa pantai pajukukang kabupaten maros; bajoe kabupaten bone; pajukukang kabupaten bantaeng serta usaha-usaha penanggulangannya pengelolaan lingkungan belajar sumbangannya prestasi belajar warga belajar mengikuti proses pembelajaran kelompok belajar paket b setara sltp kabupaten agam laporan penelitian pola pemanfaatan limbah pabrik pengolahan kelapa sawit upaya menghindari pencemaran lingkungan (di perkebunan kelapa sawit pttapian nadenggan smart group langga payung sumatera utra) hubungan lingkungan kerja pengetahuan sikap praktek pemakaian alat pelindungri kesehatan tenaga kerja home industri perbengkelan kecamatan secang kabupaten magelang laporan akhir pengaruh penggunaan lingkungan sebagai sumber belajar pembelajaran konvensional prestasi belajar kewirausahaantinjau minat berwirausaha mahasiswa pgsd fkip uns surakarta tahun 2007 pengaruh komputerisasi sistem administrasi keuangan peningkatan kinerja manajerial ketidakpastian lingkungan sebagai variabel moderating (survey kantor kepolisian kabupaten grobogan) peran polmas cibatu cikarang bekasi warga perumahan taman cibiru cikarang bekasi mendesain lingkungan melalui pengamanan fisik kegiatan sosial sebagai suatu bentuk strategi pencegahan kejahatan upaya meningkatkan partisipasi tenaga kerja wanita mengatasi pemenuhan kebutuhan air bersih penyehatan lingkungan bagi masyarakat penghasilan rendah kabupaten minahasa laporan hasil penelitian analisis pengaruh pengontrolan oleh atasan prestasi kerja bawahan sebagai wujud gaya kepemimpinan sumber daya manusia lingkungan iain antasari banjarmasin tahun 1988 laporan hasil penelitian hubungan antara prestasi belajar biologi siswa kelas 3 a2 sekolah menengah atas kodya bengkulu pengetahuan sikap partisipasinya konservasi sumber alam lingkungan hidup laporan penelitian pengembangan perangkat pembelajaran berstrategi guidedscovery (penemuan terbimbing) tema gambut meningkatkan sikap positif siswa sd lingkungan palangka raya sri endang mugi rahayu pandangan sikap perempuan bekerja konsep pemberdayaanri karir sebuah analisis gender-based dosen perempuan lingkungan universitas sebelas maret surakarta laporan penelitian penyelesaian sengketa lingkungan pencemaran air oleh industri jasa pengangkutan pemukiman penduduk pencemaran minyak solar oleh pt kai (persero) daerah operasi vi yogyakarta/ cunduk wasiati pengaruh pembangunan pelabuhan perikanan kualitas air persepsi kondisi sosial ekonomi masyarakat pelabuhan perikanan badar lampung lampung timur lampung selatan propinsi lampung pengaruh strategi pemasaran kinerja pemasaran kinerja perusahaan lingkungan persaingan sebagai variabel moderating (perusahaan jasa konstruksi kelas kecilmenengah kota semarang) kepentinganri lingkungan sosial program pembelajaran sebagai faktor determinan keikutsertaan warga belajar pendidikan berkelanjutan studi deskriptif analisis kursus-kursus kotamadya bandung model pengelolaan lingkungan sosial solusi resistensi konsekuensi modernisasi komunitas adat padoe akibat ekspansi pt inco soroako laporan penelitian hibah bersaing xiii/1 tahun anggaran 2007 analisis pengaruh perubahan lingkungan eksternal struktur organisasi perusahaan perusahaan-perusahaan penanaman modal negeri (pmdn) badan usaha milik negara (bumn) jawa timur penerapan hands on activity berbasis lingkungan pendekatan problem posing pembelajaran biologi meningkatkan minat hasil belajar siswa kelas viii d smp negeri 1 gresik noviana puspita tinjauan pelaksanaan penegakan hukum lingkungan daerah (suatu kajian mengenai pelaksanaan penegakan hukum lingkungan kaitannya pembangunan ekonomi sumatera barat era otonomi daerah) motivasi tinggal masyarakat sekitar tempat pembuangan akhir sampah hubungannya sikap masyarakat kesehatan lingkungan stusi kasus sekitar tempat pembuangan akhir sampah putri cempo kota surakarta penerapan pendekatan sains lingkungan teknologi masyarakat (salingtemas) metode proyek uapaya peningkatan prestasi belajar biologi siswa sma negeri 4 malang kelas x semester ii ifa nurohmah pengaruh kondisi lingkungan efektivitas bioremidiasi merkuri oleh isolat bakteri sosialisasi aplikasinya bioreaktor sederhana kepada penambang emas das kahayan kalimantan tengah liswara neneng identifikasi bentuk-bentuk investasi pengelolaan lingkungan oleh sektor industri(pt coca cola bottling indonesiavisi jawa tengah pt leo agung raya pt djarum kudus sentra industri tahu jomblang) kajian tentang kognisi sikap faktor sosial faktor ekonomi pola hubungannya kebiasaan pengelolaan sampah limbah rumah tangga masyarakat lingkungan perairan kota banjarmasin h muhammad zaini perbandingan antara ruang terbuka hijau (open space) lahan terbangun (build up area) kualitas lingkungan hunian kawasan permukimanbangun swasta/developer banda aceh laporan penelitian hambatan unjuk penampilan mahasiswa pplkaitkan penguasaan materi profesi sikap jabatan guru kesadaran profesi sebagai guru ipa lingkungan lptk negeri kodya surakarta laporan penelitian implementasi pasal 20 undang-undang nomor 4 tahun 1982 hal tanggung jawab pembayaran ganti rugi kepada penderita pencemaran perusakan lingkungan hidup propinsi jawa tengah laporan penelitian pengrusakan bangunan fasilitas umum oleh masyarakat kaitannya perencanaan fisik arsitektural lingkungan binaan kawasan fungsi komersial pinggiran kota jakarta laporan kegiatan penelitian hubungan antara variasi penggunaan metode mengajar pemanfaatan lingkungan sebagai sumber belajar pengalaman mengajar guru tingkat motivasi belajar geografi siswa sma negeri kotamadya malang karjawati pemanfaatan benda-benda lingkungan menunjang kegiatan praktikum ipa serta pengaruhnya pemahaman konsep ipa sekolah dasar kecamatan juhar kabupaten karo propinsi sumatera utara laporan penelitian perancangan software program komputer analisis nilai moral kepedulian lingkungan hidup mahasiswa keteknikan matlab 61 release 12 studi eksperimen mahasiswa teknik elektro politeknik negeri bandung studi tentang implikasi pengajaran biologi hubungannya pengembangan sikap pelestarian lingkungan hidup siswa sma negeri sengkang kabupaten wajo sulawesi selatan a abd lahil munir patawari hubungan antara kepemimpinan kepuasan kerja lingkungan kerja produktivitas pegawai lingkungan kerja produktivitas pegawai lingkungan biro keuangan sekretariat jenderal departemen kehakiman ham ri pengaruh tingkat penerimaan informasi lingkungan hidup pendidikan pendapatan per kapita keluarga kesadaran ibu rumah tangga pengelolaan limbah rumah tangga kecamatan cepogo boyolali laporan penelitian hubungan antara tingkat pendidikan tingkat penghasilan kepala keluarga persepsi lingkungan perilaku pencemaran sungai (masyarakat daerah aliran sungai brantas kotamadya kediri) siti nurkolisiyah hubungan perilaku manusia lingkungan binaan aspek persepsi penerapan pengendalian hama terpadu petani sekolah lapangan pengendalian hama terpadu kabupaten karawang jawa barat laporan penelitian pengukuran pengetahuan sikap kepedulian siswa sma lingkungan hidup studi ksus perbedaan pestasi blajar antara siswa sma mengikuti pramuka siswa sma tidak mengikuti pramuka tiga sma kota bekasi peranserta masyarakat upaya kelestarian lingkungan pesisir pantai daerah tingkat ii kabupaten minahasatinjau kesadaran hukum sikap masyarakat pelaksanaan undang-undang no 4 laporan penelitian analisa dampak lingkungan peranan pemerintah menggerakkan partisipasi masyarakat melestarikan ekosistim wilayah pantai menunjang pembangunan pariwisata kecamatan molas kodya laporan penelitian studi eksperimen pembelajaran masyarakat materi pendidikan kependudukan lingkungan hidup (pklh) pelibatan warga belajar penyusunan rencana program pembelajaran desa koto panjang kecamatan koto tengah studi ex post facto tentang peranan lingkungan keluarga iklim sekolah religiusitas pembentukan sikap perilakusiplin para siswa sekolah menengah tingkat atas propinsi bali (1990) laporan penelitian perilaku masyarakat pedalaman suku sakai beradaptasi lingkungan masyarakat luar/modern desa mandiangin kecamatan minas kabupaten siak riau kajian upayanya mempelajari nilai-nilai agama laporan penelitian struktur komunitas mangrove interaksinya denagan beberapa faktor lingkungan teluk pelita jaya seram barat community structure of mangrove and its interaction with some environmental factors in pelita jaya bay west seram hubungan antara perhatian orang tua motivasi berprestasi lingkungan tempat tinggal siswa aspirasi pendidikannya suatu studi siswa kelas ii a1 sma negeri se-kota singaraja tahun 1990/1991 laporan penelitian model penilaian kinerja dp3 pengaruhnya stres kepuasan kerja kinerja dosen lingkungan perguruan tinggi negeri kota makassar kajian rangka pengembangan model penilaian kinerja dosen lebih efektif penerapan model pembelajaran kooperatif jigsaw meningkatkan pemahaman pokok bahasan lingkungan sekitar mata pelajaran ilmu pengetahuan sosial siswa kelas iii sdn penanggungan kecamatan klojen kota malang sri rejeki penerapan strategi pembelajaran berbasis masalah (problem based learning) berbantuan modullengkapi problem terstruktur perkuliahan kimia fisika iii menciptakan lingkungan konstruktif pembelajaran laporan penelitian orientasi pertimbangan moral mahasiswa kelestarian lingkungan hidup studi mahasiswa perguruan tinggi negeri swasta sulawesi utaratinjau bidang ilmu status sosial ekonomi tingkat kuliah laporan persepsi analis hasil produksi perusahaan sikap ilmiah keinsinyuran perlunya penjabaran etika lingkungan berdasarkan nilai-nilai pancasila bandung semarang yogyakarta surabaya laporan penelitian pengaruh lingkungan sosial ekonomi alokasi waktu wanita telah kawin ibu rumah tangga dua desa ketawanggede kecamatan klojen kotamadya malang desa gedangan kecamatan gedangan kabupaten malang aspek lingkungan kebumian penyusunan tata ruang daearah jawa bagian selatan karakterisasi bencana gerakan tanah rayapan dusun sambeng desa seling kec sadang kab kebumen rangka penyusunan metoda mitigasi gerakan tanah pelatihan membuat alat peraga matematika ipa memanfaatkan sumber daya alam lingkungan sekolah bagi guru-guru sekolah dasar kecamatan muarakuang ogan komering ilir laporan pelaksanaan kegiatan pengabdian kepada masyarakat analisis efektivitas corporate social responsibility program kemitraan bina lingkungan pt (persero) pelabuhan indonesia iii cabang tanjung perak efektivitas program kemitraan mengembangkan usaha mitra binaan formulasi pupuk majemuk npk tablet lepas terkendali (controled release) efisien tanaman sayuran berdasarkan studi migrasi unsur-unsurnya terserap oleh tanaman tersimpan tanah terlolos ke lingkungan laporan penelitian hubungan persepsi siswa penerapan media pengajaran fisika sikap siswa gejala fisis terhadi lingkungan sekitar prestasi belajar fisika siswa kelas i smu negeri gondanglegi kabupaten malang umi kulsum hubungan pendidikan pelatihan kompetensi pegawai negeri sipil bidang pelayanan publik (studi pelaksanaan pendidikan pelatihan kepemimpinan tingkat iv angkatan v tahun 2008 lingkungan pemerintah kabupaten aceh tamiang) korporasi sebagai pelaku tindak pidana lingkungan hidupstudi tentang kendalahadapi aparat penegak hukum penerapan aturan pidana rangka penuntutan korporasi sebagai pelaku tindak pidana lingkungan hidup indonesia perlindungan hukum kawasan cagar alam nusakambangan studi tentang penegakan hukum lingkungan melalui instrumen hukum pidana setelah berlakunya uu no 5/1990 tentang konservasi sumber daya alam hayati ekosistemnya laporan hasil penelitian analisis pengaruh elemen store environment pembelian kembali giant plaza semanggi kepuasan pelanggan sebagai moderator (pada mahasiswa fakultas ekonomi manajemen aktif angkatan 2006 universitas atma jaya jakarta) studi tentang penambahan mata pelajaran muatan lokal pilihan sesuai keadaan lingkungan ciri khas sekolah lanjutan tingkat pertama rangka pelaksanaan pendidikan dasar sembilan tahun propinsi jawa barat laporan penelitian perbedaan faktor sosial budaya pengetahuan ibu keadaan lingkungan perumahan berpengaruh perbedaan morbiditasare balita antara dusun jumput dusun bunder desa ampeldento kecamatan karangploso zaimatus sa'ida_x000d_ pengembangan perangkat pembelajaran penilaian ketrampilan proses sains pendekatan sains-teknologi-masyarakat lingkungan studi pembelajaran sains sekolah dasar menuju pelaksanaan kurikulum berbasis kompetensi laporan penelitian hubungan antara persepsi siswa penerapan media pengajaran fisika sikap siswa gejala fisis terjadi lingkungan sekitar prestasi belajar fisika siswa kelas ii sltp 2 bandung kabupaten tulungagung etty ernawati hubungan perilaku manusia lingkungan binaan faktor-faktor berpengaruh proses pengambilan keputusan petani kegiatan agribisnis sayuran petani sayuran kabupaten cianjur propinsi jawa barat laporan penelitian pengaruh struktur desentralisasi informasi sistem akuntansi manajemen dukungan organisasional kinerja manajerial lingkungan pemerintah daerah (pemda) studi empiris pemda kota kabupaten propinsi daerah istimewa yogyakarta/ paul penerapan model pembelajaran kooperatif group investigation pendekatan salingtemas (sains-lingkungan-teknologi-masyarakat) meningkatkan kemampuan kerja ilmiah hasil belajar kognitif biologi siswa kelas x sma negeri 1 lawang santi nur ha karakteristik publik kawasan kampung menghadapi perubahan fisik kota konteks perkembangan fasilitas lingkungan pendidikan (kawasan kampung kota lingkungan universitas komputer indonesia jlpati ukur bandung) laporan penelitian pelaksanaan ketentuan-ketentuan hukum bidang pelestarian kemampuan lingkungan hidup sehubungan penggunaan aliran sungai mata air oleh perkumpulan petani pemakai air (p3a) wilayah kecamatan sigi biromaru kabupaten donggala laporan penelitian rencana pengelolaan lingkungan rkl (pemutakhiran rkl pil proyek jalan bypass cirebon 1993) peningkatan jalan bypass cirebon jawa barat ; proyek penanganan prasarana jalan perkotaan strategis (strategic urban road infrastructure project) september 1995 kajian tentang keberhasilan penataan lingkungan kumuh pola pendekatan program terpadu peningkatan peranan wanita menuju keluarga sehat sejahtera (p2w-kss) mandiri kelurahan tipes serengan kecamatan serengan kotamadya dati ii surakarta laporan pendekatan ekologis proses belajar mengajar bidang studi biologi mahasiswa jurusan pendidikan biologi fpmipa-ikip semarang semester ganjil tahun 1986/1987 meningkatkan keikutsertaan melestarikan lingkungan hudup sekitar kampus laporan penelitian rencana pemantauan lingkungan rpl (pemutakhiran rpl pil proyek jalan bypass semarang 1993) peningkatan jalan bypass semarang jawa tengah ; proyek penanganan prasarana jalan perkotaan strategis (strategic urban road infrastructure project) september 1995 rencana pengelolaan lingkungan rkl (pemutakhiran rkl pil proyek jalan bypass semarang 1993) peningkatan jalan bypass semarang jawa tengah ; proyek penanganan prasarana jalan perkotaan strategis (strategic urban road infrastructure project) september 1995 penentuan simultan logam-logam merkuri arsen antimon bismut serta beberapa logam berat lainnya sampel-sampel lingkungan menggunakan metode kromatografi cair kinerja tinggi (hplc) melalui pembentukan kompleksetilditiokarbamat laporan penelitian penerapan pembelajaran berbasis peta konsep pengajuan masalah problem posing secara kooperatif menggunakan bantuan materi ajaranlengkapi rangkuman konsep problem terstrukur suatu model menciptakan lingkungan belajar konstrukivitas laporan penelitian penggunaan model pengajaran kimia lingkungan melalui pendekatan sains-teknologi-masyarakat [s-t-m] studi kuasi eksperimen upaya mengembangkan penguasaan konsep sikap kepedulian siswa lingkungan keterampilan proses sains siswa kelas ii salah satu man sukabumi upaya meningkatkan pengetahuan pemahaman aplikasi konsep lingkungan hidup melalui kegiatan praktikum penugasan studi eksperimen pembelajaran ilmu alamiah dasar [iad] pokok bahasan pencemaran lingkungan sub pokok bahasan pencemaran udara mahasiswa jurusan administrasi negara status sosial ekonomi nilai budaya motif berprestasi berafiliasi sebagai faktor determinatif pembinaan perilaku kesadaran lingkunnga hidup anggota pramuka (studi deskriptif tentang kegiatan pramuka mengembangkan perilaku kesadaran lingkungan hidup kecamatan sukasari kotamadya bandung) faktor-faktor penentu usaha peningkatan sikap siswa sekolah teknologi menengah propinsi sumatera utarasiplin sekolah tinjauan pengaruh latar belakang keluarga lingkungan sekolah motivasi berprestasi sikap siswa stm propinsi sumatera utarasiplin sekolah laporan penelitian bali urban infrastructure project (buip) public - private partnership (ppp) for solid waste management pelaksanaan rekomendasi pengelolaan persampahan peluang bagi kerjasama pemerintah swasta proyek pembangunan infrastruktur bali tahap iia ibrd loan no 3913 - ind ; kajian lingkungan pembangunan tpa regional bali bagian selatan bali urban infrastructure project (buip) public - private partnership (ppp) for solid waste management pelaksanaan rekomendasi pengelolaan persampahan peluang bagi kerjasama pemerintah swasta proyek pembangunan infrastruktur bali tahap 2a ibrd loan no 3913 - ind ; terms of reference analisis mengenai dampak lingkungan (amdal) pembangunan tpa regional sembung gede-tabanan standarisasi keselamatan kerja i perusahaan validasi instrumen temperament structure scale model manajemen sumberdaya metacomputing pasar seni budaya tanjung bunga-makassar kulit mangium sebagai sumber tanin perekat minimisasi limbah kawasan industri pulogadung penelitian kualitas gas buang industri ban aspek-aspek penegakkan hukum penataan ruang fasilitas fisioterapi kesehatan surabaya file desk interface head-disk selaput cair manajemen penuaan reaktor nuklir ga siwabessy penelitian bahan saluran drainase sistem pracetak strategi pengelolaan pengembangan pelabuhan benoa stryrofoam bekas campuran bata beton ringan hubungan antara sense of humor stres kerja jawara budaya kekerasan masyarakat banten jurnal teknik mesin vol4 nomor 1 januari 2004 evaluasi baku mutu air limbah uji toksisitas pengawetan kayu okulasi karet teknik aseptik a sanctuary resort hotel tema integrated to nature desain arsitektur software networkedgital library penatalaksanaan infeksi helicobacter pylori anak sistem transportasiinginkan berdasarkan palet database pencemaran sumber air limbah berbasis website ledakan matahari pemicu anomalinamika atmosfer bumi perencanaan strategis rsud kota bekasi tahun 2005-2009 regulator keselamatan proses lisensi nuklir canada ampas tahu sebagai bahan penghancur tablet parasetamol database pencemaran sumber air limbah berbasis website isolasi bakteri termofilik penghasil etanol kompos kepentingan indonesia meratifikasi protokol kyoto perancangan implementasi 5s biro x universitas y analisa kepecahan struktur esa akibat beban ekstrem analisa kepuasan customer united fashion outlet (ufo) kompetisi populasi escherichia coli pembawa plasma makna ruang penataannya arsitektur rumah kudus pola konservasi sumberdaya air daerah aliran sungai siak pusat pendidikan pengembangan seni musik surabaya supercritical fluid extraction/chromatography (sfe/sfc) adaptasi lingkungan perkembangan kebudayaan talaud analisis kejahatan pencurian surakarta tahun 2002-2006 kuliah online berbasis web universitas komputer indonesia pengelolaan transportasi ramah lingkungan kota mataram perilaku petani sayuran menggunakan pestisida kimia analisis potensi pasar input limbah plastik kota malang kedudukan pengadilan pajak sistem hukum indonesia peran hakim penegakan hukum pidana lingkungan hidup peran tantangan peencanaan strategi perguruan tinggi telaah bioekologi penyakit embun tepung tanaman mawar mesin pendingin adsorpsi studi analitis eksperimental perkembangan pemanfatan abu terbang beton mutu tinggi rancangan bangun sistem akuisisi data cuaca telemetri sistem produksi pengadaan bakalan standardisasi daging tinjauan persoalan mikrobiologi rekayasa infrastruktur evaluasi daya dukung lingkungan zona industri genuk semarang kajian pencemaran bahan organik kawasan pesisir semarang kecelakaan radiasi terkait peralatan radioterapi pengembangan objek wisata pasar terapung kota banjarmasin efektivitas biodeinking pengolahan kertas bekas campuran inhibisi korosi baja karbon lingkungan karbonat-bikarbonat kecerdasan linguisitik anak kembar usia dua tahun tujuh bulan penaikan panas suhu rendah biji-biji besi lateritik pengenalan wajah citragital menggunakan metode hybrid produksi purifikasi enzim xylanase aspergillus niger sanksi pengaruh penyalahgunaan narkoba kalangan remaja sumber daya alam pembangunan sebuah perpektif komparatif analisis swot usaha kerajinan mebel bambu kabupaten gianyar implementasi intelliegent mobile agent based updater antivirus konstruksi identitas ke-cina-an kalangan pemuda etnis cina metode pengendapan plankton-plankton daerah pasang merah pananganan air limbah pabrik gula subang cara pemisahan perencanaan strategi rumah sakit wanita yadika tahun 2003-2004 simulasi pengaturan lampu lalu lintas menggunakan logika fuzzy struktur komunitas fauna krustasea pulau-pulau teluk banten analisis perencanaan strategisnas kesehatan kuantan singingi integrasi pendidikan budi pekerti lagu dolanan anak-anak pengaruh konsentrasi lindi hitam pertumbuhan chlorella strategi pengelolaan sampah kapal penumpang tipe pax 2000 wahana pengembangan kreativitas anak prasekolah tema atraktif aspek sosial penerapan teknologi geothermal daeraheng community participation in care's water and sanitation projects penelitian mutu limbah cair industri tahu kotamadya palembang pengaruh lalu lintas kapal erosi abrasi tepi sungai permintaan sukarela audit internal eksternal bisnis keluarga hak kesehatan lingkungan lembaga pemasyarakatan anak tangerang komunitas zooplankton perairan waduk krenceng cilegon banten laporan berkelanjutan; kompetensi baru profesi akuntan manajemen? perencanaan strategis pengembangan rs setia mitra tahun 2003-2007 pengaruh polusi udara implikasinya perkembangan tanaman proteksi katodik impressed current besi tulangan beton sistem informasi penerimaan karyawan baru hotel santika bandung sporulation of some amf isolates on several media and host plants faktor eksternal sustainability perusahaan jasa konstruksi keanekaragaman flora lingkungan kampus unud bukit jimbaran bali memahami fenomena romantic relationship lingkungan pesantren pelatihan jarak jauh berbasis web kasus modul pelatihan dasar gsm pestisida berasal residustilasi asam lemak minyak neem sistem pemantauan kewajiban pengembang kotamadya jakarta selatan etika ekobisnis sebagai landasan utama pengembangan perusahaan faktor-faktor strategi pengembangan daya saing konstruktor indonesia hubungan lingkungan fisik ruangan kerja produktivitas pekerja indonesia-us economic relations under apec problems and prospects kaji numerik eksperimental kinerja saluran talang tembolok tekuk menuju kajian terpadu wilayah cekungan bandung sebuah gagasan awal metoda peralatan mengurangi bahan buangan pabrik pulp pedagang kaki lima corak lingkungan pasarnya kawasan palmerah perancangan interior museum replika fosilnosaurus surabaya perbandingan ranging antara algoritma single vision stereovision rekayasa akuntansi manajemen lingkungan bisnis kompetitif analisa formulasi strategi pemasaran biru api event and communication fasilitasagnostik rehabilitasi medis internasional surabaya kemelimpahan jenis gulma tanaman wortel sistem pertanian organik pembangunan pengembangan data pengelolaan kualitas sumberdaya air pendugaan proses pencampuran limbah cair wilayah perairan estuaria pengolahan limbah batik proses kimia adsorpsi karbon aktif perilaku sosial penderita hiv/aids menghadapi reaksi masyarakat populasi planaria lokasi bukit tunggul maribaya bandung utara aplikasi voltametri penentuan logam berat bahan lingkungan evaluasi peningkatan teknik operasional persampahan kota surakarta faktor-faktor pendidikan menurut al-ghazali kitab ihya ulumuddin pengaruh lingkungan kekuatan geser komposit model three rail perancangan kampanye perkembangan kreativitas anak usiani (balita) perbandingan dua metode ekstraksi pengujian logam alat aas permukiman delta batanghari pesisir timur jambi abad 11-13 masehi pola kepemimpinan kerjasama tim lingkungan rayon usaha pam jaya struktur kedap air terapung produksi pengeboran lepas pantai fenomena akustik kompleks candi cetho lereng gunung lawu karanganyar obligasi ritel indonesia sebagai objek jaminan lingkungan perbankan pemilihan teknologi produksi hidrogen memanfaatkan energi nuklir peran auditor masyarakat penerapan good government governance profil dna plasmid e coliisolasi limbah cair rumah sakit program penanggulangan keadaan darurat radiasi p3tm-batam yogyakarta sifat-sifat fisiko-kimia lemak kakao faktor-faktor berpengaruh pembuatan sistem pengelolaan dosis radiasi karyawan rsg gas berbasis web pemeriksaan beberapa logam air sungai citarum hulu alat aas pengaruh infiltrasi uap air secara siklik ke campuran beton aspal pengaruh ph air laut proses bioakumulasi cd perna viridis perkembangan prosedur menyelesaikan sengketa pencemaran lingkungan rencana pengelolaan lansekap kawasan triau beratan-buyan-tamblingan suplementasi vitamin c sebagai penangkal cekaman panas ayam broiler kajian lingkungan kawasan industri perikanan muncar banyuwangi jawa timur pembuatan prototipe pabrik briket limbah batubara halus daerah kaltim peranan kelenjar seks asesori menentukan fertilitas mamalia jantan strategi bersaing pt xyz industri jasa penyelenggara akses internet surabaya convention and exhibition hall tema reflection of surroundings analisa aplikasi komunikasi data laboratorium kualitas udara bergerak analisa risiko potensi bahaya lingkungan kerja dunia fantasi jakarta development of spiral welded steel line pipe api 5l x-60 for sour service efikasi ekstrak daun tembakau hama sengon eurema blanda (bolsd) ekolabelling sebagai upaya menghasilkan produk berwawasan lingkungan integrasi metascheduler gridway lingkungan komputasi grid fasilkom ui pembuatan pulp bilangan kappa rendah proseslignifikasi berlanjut penelitian pendahuluan pengolahan limbaht kulit makanan ternak pengaruh penggunaan bottom ash karakteristik campuran aspal beton pengaturan kewenangan penambangan bahan galian golongan c kota semarang perencanaan pembangunan wilayah provinsi perpsektif pengelolaan das perencanaan ruang terbuka hijau kotamadyang propinsi sumatera barat rekonstruksi lingkungan percandian situs batujaya karawang jawa barat analisa performansi transmisi audio bluetooth akibat interferensi wlan identifikasi kompleksitas karakteristik sistem pengelolaan zona pantai penentuan parameter pemodelan fluktuasi migrasi cesium tanah perencanaan strategis pengembangan rsu bayu asih purwakarta tahun 2004-2008 potensi strategi pengembangan kelautan lingkungan institut teknologi sifat kayu tarik teras gubal acacia mangium karakteristik pulp tingkat urgensi pengujian polusi gas buang kendaraan bermotor indonesia dukungan sosial adaptasi transmigran upt tampa sp-2 kalimantan tengah kajian mata air tanah lingkungan kampus ui depok metoda geolistrik kajian ruang bermain terbuka (playground) sekolah tk alam bukit dago bandung pembangunan rumah susuntinjau aspek hukum aspek lingkungan hidup perancangan kampanye menjaga kebersihan lingkungan penyakit chikungunya kajian manajemen pelaksanaan sanitasi lingkungan pelabuhan pontianak kajian perubahan bentuk tata ruang lingkungan permukiman kauman surakarta karakter visual koridor pendukung kawasan(simpang lima semarang) kehidupan masyarakat permukiman kumuh rt 01 rw 06 kebon pala jakarta timur korelasi antara batuan induk minyak bumi cekungan salawati irian jaya korelasi fraksi volume kuat lentur komposit semen berpenguat serbuk rotan pengukuran kecepatan emanasi gas radon permukaan lubang bor long year-65 hotel butik puncak waringin kabupaten manggarai barat nusa tenggara timur hubungan work-family conflict psychological well-being ibu bekerja identifikasi parameter model sistem penyerap tenaga ombak jenis rongga osilasi karakteristik limbah pengolahan minyak sawit cara penanganan pengawasannya pembuatan komponen sofc penggabungannya pembentukan sel bahan bakar pembuatan pemanas air tenaga matahari kantin p universitas kristen petra penguatan modal sosial sebuah jalan keluar menyelesaikan korupsi indonesia perancangan perisai radiasi sinar-x mesin berkas elektron 800 kv/400 ma perencanaan aspek non teknis operasional pengelolaan persampahan kota magelang faktor-faktor berperan kinerja instruktur lima bppd pulau jawa integrasi ekoteknologi program perlindungan lingkungan udara kota surabya kajian penghijauan kawasan historis (kawasanponegoro' medan) penapisan bakteri penghasil enzim kitosanase berasosiasi spons laut pengaruh stressor kinerja karyawan bagian produksi pt mondrian klaten penuaan peralatan industri migas proses sertifikasi peralatan/instalasi migas penyebaran akar hara hubungannya penaburan pupuk tanaman karet perbandingan kinerja server melalui virtualization xen lingkungan terbatas perencanaan strategi pemasaran instalasi bedah sentral rumah sakit persahabatan strategi pengembangan sumberdaya manusia pt aneka gas industri modifikasi polietilin sebagai polimer komposit biodegradable bahan kemasan pemodelan manajemen air tanah menggunakan metode stokastik finite element pengaruh faktor lingkungan air laut ketahanan korosi baja karbon rendah pengaruh tradisi arsitektur lingkungan (rumah adat toraja) profil pengajaran sastra wacana pengembangan pengajaran sastra berbasis kawasan studi tentang faktor-faktor mempengaruhi minat mahasiswa berwirausaha (sistem seleksi penerimaan mahasiswa baru perguruan tinggi negeri) analisa karakteristik bahan bakar biodiesel berasal minyak kelapa sawit analisis keragaman fenotipik heritabilitas tiga kultivar kelapa unggul'stribution and characteristics of quarternary peat deposits in eastern jawa sea korelasi karakterisasi tanah karakterisasi plasma nutfah tanaman srikaya pengelolaan risiko kualitas tahap pelaksanaan konstruksi lingkungan ptx peran apolipoprotein e timbulnya penyakit kardiovaskuler populasi jawa perilaku administratif sistem pengelolaan sekolah dasar kalimantan barat pola penataan lingkungan permukiman kumuh sekitar kawasan bantaran sungai palu segi pencemaran udara penerapan teknologi pelapisan permukaan secara radiasi sistem penggerak mobil listrikterapkan marlip marmut listrik lipi analisis keberlanjutan teknologi tanaman pakan daerah aliran sungai bagian hulu efektifitas penerimaan pesan hubunganadik antar-budaya pt indogrs ekologi arsitektur menuju perancangan arsitektur hemat energi berkelanjutan hamming code kode informasigital standart tt and c satelit mikro orbit leo media tumbuh kultivar daya hantar listrik pupuk bunga anthurium potong pencegahan infeksi aspergillus flavus kontaminasi aflatoksin kacang tanah pengembangan basis data program kesehatan lingkungan puskesmas kabupaten bekasi pengujian konsentrasi limbah proses pemasakan tekstil katun bakteri aerob peran wanita pengelolaan sampah daerah perkotaan (kasus kota yogyakarta) rumah sakit ibu anak (mother and children hospital) tema healing environment analisa evaluasi sisa material konstruksi sumber penyebab kuantitas biaya evaluasi optimasi manajemen teknik operasional pengelolaan sampah kota magelang evaluasi kinerja penyusun penilai amdal komisi penilai amdal pusat komposisi bahan pembasmi atau pbmbunuh serangga cara pengendalian hama serangga pemanfaatan limbah polietilen serat tandan kosong kelapa sawit menjadi komposit pengaruh gas ammonia kandungan rendah udara lingkungan kerja fungsi paru pengaruh suhu hidrotermal awal pembentukan zeolit abu layang batubara program pendidikan life skills bagi siswa sekolah menengah atas wilayah pesisir solidifikasi stabilisasi steel slag serta pemanfaatannya sebagai fine aggregate teknologi pemanfaatan limbah pembalakan industri peningkatan nilai tambah evaluasi sistem keselamatan pemakaian radio therapy rsud dr soetomo surabaya faktor-faktor penghambat partisipasi wanita lampung pepadun keluarga berencana faktor-faktor penyebab ispa lingkungan rumah tangga jakarta tahun 1990/1991 karakteristik perumahan penduduk kawasan sempadan rel kereta api kodya malang metoda meningkatkan keliatan lapisan campuran aluminium - seng pelat baja pemanfaatan berbagai sumber nitrogen nonprotein pembesaran ikan bandeng laut pengujian skala penuh campuran emulsi bergradasi rapat lapisan permukaan jalan peningkatan peran kepolisian pemeliharaan pembinaan keamanan negeri recycle plastik secara kimiawi pemanfaatan styrofoam sebagai bahan koagulan polimer situs-situs gua prasejarah jawa timur kajian pola hubungan budaya lingkungan transesterifikasi minyak nabati bekas menjadi biodiesel menggunakan katalis zeolite analisis pengaruh peduli lingkungan sikap perilaku pembeli the body shop pemanfaatan kompos enceng gondok gambut tanaman buncis kabupaten karanganyar pengaruh kondisi sanitasi lingkungan kematian anak (analisis data sdki 1997) kritik sosial atas pemakaian teori penelitan pengungkapan sosial lingkungan pembuatan formulasi pestisida hayati pengendalian penyakit layu bakteri tembakau pengaruh keluargadalam masalah kecenderungan nakal siswa remaja sma-sma manado strategi pemasaran industri komponen baja cor tempa pt sumbermitra sarijaya adaptasi penghuni gua prasejarah leang burung kabupaten maros provinsi sulawesi selatan detail engineering design (ded) instalasi pengolahan air lindi tpa muarareja kota tegal hubungan antara persepsi kompetisi motivasi berprestasi siswa smp hubungan budaya organisasi kinerja perawat pelaksana rsud sumedang tahun 2009 kaji balik perkembangan litbang aplikasi teknik nuklir bidang pertanian peternakan kajian dampak penggunaan plastik pvc lingkungan alternatifnya indonesia oksigen terlarut apparent oxygen utilization perairan teluk klabat pulau bangka penerapan asas tanggung jawab mutlak kasus lingkungan hidup pengadilan negeri pengaruh budaya organisasi kinerja karyawan kanwil vii bea cukai surabaya pengembanganstilator surya tipe telkes unit penghampa penyediaan air pengendalian biaya waktu proyek bangunan gedung menggunakan konsep nilai hasil sine motu vita est sine laetitia anatomia est ubicumque anatomia non est nequaquan stasiun informasi observasi antariksa pendayagunaan energi surya surabaya teknologi transplantasi terumbu karang menunjang rehabilitasi kawasan konservasi bentuk-bentukstorsi kognitif narapidana wanita mengalami depresi lapas sragen implementasi prinsip-prinsip tanggunggugat penyelesaian sengketa lingkungan hidup penggunaan hopanoid sebagai marker keragaman status komunitas bakteri penyubur tanah selayang pandang kaitan antara lingkungan perilaku kanker serta cara pencegahannya stabilisasi logam berat sludge efektifitas penggunaannya pembuatan batako usulan strategi bersaing pt radio paksi menggunakan tahapan analisis strategi dampak cara pembuatan obat baik (cp0b) pelestarian fungsi lingkungan hidup evaluasi penyelesaian sengketa lingkungan hidup (kali tapak kota semarang) implementasi hyperelliptic curve cryptosystem menggunakan algoritma haleyoptimasi kajian peluang pelibatan masyarakat pengembangan hutan kota srengseng jakarta barat non-ulcer dyspepsia relation with environmental factors - a study in sub himalayas india peluang tantangan implementasi undang-undang no 7 tahun 2004 tentang sumber daya air pemanfaatan enterprice architecture planning perencanaan strategis sistem informasi pemetaan profil industri alternatif penanganannya kota denpasar (dsdp) penelitian tindakan kelas sebagai upaya mencari umpan balik bagi peningkatan kinerja guru pengaruh pupuk organik cair (bio urine kelinci) pertumbuhan hasil jagung gpm program pengembangan teknologi bahan elemen bakar nuklir pusat elemen bakar nuklir sistem pengetahuan arti primbon bagi orang jawa beradaptasi lingkungan kebijakan pemerintah kota melaksanakan relokasi pedagang kaki lima kota surakarta pembaharuan metode identifikasi kerusakan hutan mangrove menggunakan data inderaja sig penentuan suhu penguraian senyawa sulfataplikasikan insinerator air limbah perancangan billboard spanduk semen mortar utama cyber puzzle cv capink kinfun teknik radioperunut mempelajari karakteristik air tanahgkal ppta pasar jum'at analisisnamis metode pengukuran balanced scorecard pt tunaskarya indoswasta analisis karakteristik wirausaha mendorong kesuksesan pengrajin kulit tanggulangin fenotipe reproduksi dua galur puyuh jepang (coturnix coturnix japonica) dua suhu ruang pemantauan kadar petstisida organoklorin du beberapa muara sungai perairan teluk jakarta pengaruh inhibitor anorganik korosi baja karbon lingkungan larutan beton artifisial re-use material bekas desain bangunan = re-use of dumped materials in building design studi tentang kualitas pelayanan kinerja unit jaminan mutu (ujm) politeknik negeri bali study of pollutantstribution in benoa bay uasing numerical simulation and satellite data tingkat pengetahuan masyarakat denpasar bali tentang program talk show ajeg bali bali tv analisis perhitungan konsentrasi ozon rancangan mbe 300 kev/20 ma iradiasi lateks aspek nonteknis indikator efisiensi sistem pertanaman tumpangsari sayuran dataran tinggi cara memperoleh pengetahuan pembelajaran fisika (dari pandangan teori-teori psikologi) pengaruh ratio bahan naoh waktu proses pembuatan pulp enceng gondok naoh pengelolaan sampaht menunjang kebersihan rsup dr m djamilng tahun 2000 penyisihan fenol limbah industri pt xyz eceng gondok (eichhornia crassipes) seleksi saudara kandung kemajuan seleksi toleransi kekeringan jagung suatu studi etnografi dusun meluke desa sidomulyo kecamatan deket kabupaten lamongan) andal kawasan industri tangerang pemantauan air buangan industri kimia dasar lingkungan studi kualitatif pelayanan rujukan asfiksia bayi baru lahir kabupaten cirebon jawa barat analisis pengaruh kinerja menara pendingin faktor keselamatan operasi reaktor kartini pemantauan kualitas lingkungan semenanjung muria penentuan radioaktivitas cuplikan pantai pemerolehan bahasa indonesia anak tunarungu usia 7-10 tahun (tina viki) peran penyidik penyidik pembantu penyelesaian tindak pidana penipuan penggelapan teknik pengendalian parasit eksternal pemeliharaan induk ikan cobia rachycentron canadum analisis geohistori beberapa sumur eksplorasi cekungan sumatera utarasuatu nota pendahuluan evaluasi impedance control manipulator robot pengaturan posisi gaya end-effector evaluasi program penanganan pengelolaan limbah batik kota pekalongan (periode 2004 2009) identifikasistribusi biaya-manfaat kegiatan industri tekstril kawasan perkotaan rancaekek kebijakan sistem pertanggungjawaban pidana korporasi perundang-undangan lingkungan hidup pengaruh kepemimpinan motivasi kerja kinerja karyawan pt propan raya icc semarang pengembangan model simulasi mendukung pengambilan keputusan tender pembangunan kapal produksi biosurfaktan oleh bakteri hidrokarbonoklastik bioremediasi tumpahan minyak bumi the water-structure modifying behaviour of some components of 3-in-1 tpn intravenous admixtures desain perekayasaan area monitor berbasis mikrokontroler menggunakan detektor geiger muller hubungan faktor sosial ekonomi keluarga faktor lingkungan kejadianare balita kebiasaan makan talang mamak adaptasi peladang berotasi perubahan lingkungan laju dekomposisi serasah mangrove kontribusinya nutrien hutan mangrove reboisasi peer coaching sebagai wahana guru berkolaborasi melalui teknologi informasi komunikasi pemanfaatan sabut kelapa isolasi lingkungan iklim mikro tanah pasiran bertanaman permukiman nilai-nilai budaya pesantren konteks penataan kawasan sidosermo surabaya tugas akhir pengujian pembangkit listrik tenaga surya posisi plat photovoltaic horizontal analisis aspek keamanan jaringan wi-fi lingkungan fakultas ilmu komputer univresitas indonesia analisis runtun waktu bivariat metode box-jenkins pemodelan var (vektor autoregresif) bentuk partisipasi masyarakat atraksi wisata pendakian gunung slamet kawasan wisata guci ecopark cibinong science study kasus konsep pengembangan ruang terbuka hijau berbasis konservasi implementasi aplikasi context-aware lingkungan pervasive computing menggunakan upnp network isolasi penapisan mikroba probiotik unggas pertumbuhannya berbagai sumber gula kajian mekanisme kinetika reaksi reduksi limbah kromium lingkungan industri elektroplating lingkungan strategis kawasan asia tenggara stagnasi pertahanan indonesia periode 2001-2004 penentuan strategi pemasaran handycraft analisis swot (ud wapres pekalongan) penerapan metode dekomposisi wavelet learning vector quantization analisis citra korosi pengendalian penyakit sayurantanam sistem budidaya mosaik pertanian periurban perencanaan strategis analisa evaluasi posisi strategi meningkatkan keunggulan bersaing strategi-strategi adaptifgunakan nelayan madura kehidupan ekonomi perikanan lautnya studi evaluasi partisipasi desa adat beraban mengelola obyek wisata pura tanah lot biomarka senyawa beroksigen sedimen laut arafura (core md2967 kedalaman 1200 cm 2400 cm) gambaran kondisi higiene penjamah makanan sanitasi kantin lingkungan universitas airlangga kajian erosi pendangkalan embung pulau timor-ntt embung oemasi embung leosama komposisi fitopalnkton peluang blooming microcystis aeruginosa waduk karangkatesjawa timur model penjadwalan pemesanan multi itemnamis adanyaskon penggunaan gudang bersama pengaruh limbah rumah sakit pgi cikini penurunan kualitas badan air penerima (sciliwung) pengaruh pembuangan tailing bawah laut pt newmont minahasa raya perairan teluk buyat pengelolaan lingkungan sentra industri rumah tangga pengasapan ikan bandarharjo kota semarang perangkat lunak sistem pengakuisisi data aerodinamika pengujian aerofoil terowongan angin analisis pengaruh citra supermarket loyalitas konsumen toko mitra kartasura sukoharjo analisis tingkat maturity manajemen proyek perusahaan jasa konstruksi (pada pt x) faktor-faktor mempengaruhi kepuasan mahasiswa pascasarjana universitas muhammadiyah surakarta hubungan antara kematangan beragama remaja muslim motivasi menuntut ilmu pondok pesantren penentuan konsentrasi pb zn cu lapisan sedimen metode spektrometer pendar sinar-x penerapan coaching meningkatkan kinerja pegawai bagian sekretariat rumah sakit islam surabaya pengaruh iklim organisasi gairah kerja karyawan bengkel auto 2000 hr muhammad surabaya potensi iptek pemanfaatan keanekaragaman hayati peningkatan kesejahteraan hidup manusia proses penyelesaian perkara pidana pelaku anggota tni (studi wilayah kodam ivponegoro) sistem perangkai selubung dua instrumen salah satu atau keduanya berada bawah tekanan analisis kebijakan tentang kewajiban penyampaian spt secara elektronik bagi wajib pajak kpp madya hubungan beberapa faktor lingkungan kejadian malaria kecamatan salaman kabupaten magelang keberlanjutan usaha tani pola padi sawah-sapi potong terpadu kabupaten sragen pendekatan rap-cls pembuatan asam oksalat oksidasi plastik polyvinyl chloride (pvc) suhu tekanan tinggi pengaruh transformasi arsitektur tradisional bangunan kantor pemerintah kondisi termal perencanaan master plan 2004-2008 badan pendidikan pelatihan provinsi jawa timur kampus surabaya analisa kemampuan supervisi kepala ruangan rawat inap rumah sakit pelni petamburan jakarta barat analisis kesenjangan wilayah gerbangkertosusilatinjau aspek ekonomi sosial lingkungan analisis swot strategi pengembangan usaha warung makan ayam goreng ayam bakar ibu wiwi faktor risiko dermatitis kontak iritan petani rumput laut kabupaten bantaeng sulawesi selatan hubungan pengendalian emosi penerimaan oleh teman sebaya remaja awal shulhu huzaimah akram penanganan lk3 pengelolaan sumur tua wilayah pertamina operasi ep cepu oleh kud bogosasono sistem pengelolaan air buangan lingkungan permukiman dl kawasan rumah susun penjaringan sari surabaya implementasi tqm pencapaian sistem manajemen lingkungan iso 14001 unit pengolahan vi-balongan kajian aplikasi mesin berkas elektron (mbe) surface treatment hasil industri kerajinan kayu manipulasi pra- analisis ciri- ciri sinyal squaredfference rekognisi skema modulasi automatic partisipasi wanita kegiatan penghijauan lahan kritis kecamatan playen kabupaten gunung kidul pengaruh motivasi kompensasi kinerja pegawai perpustakaan uin syarif hidayatullah jakarta pengembangan agribisnis ternak domba wilayah pesisir selatan kecamatan galur kabupaten kulon progo peran hutan kota menurunkan tingkat kebisingan lingkungan (kota manggala wanabakti) perubahan struktur mikroanatomi intestinum ikan mas (cyprinus carpio) karena pemberian logam berat zn sel elektrokimiaperbaikilengkapi membran penukar ion serta pelat logam dwi kutub studii intervensi peningkatan perilaku hidup bersih sehat bagi anak sdn cisalak i depok tahun 2009 suatu alternatif lain analisa stratifikasi puskesmas sub-kegiatan kia se-kabupaten semarang tahun 1988 kajian prospek arahan pengembangan atraksi wisata kepulauan karimunjawa perspektif konservasi pengaruh tekanan internasional kebijakan indonesia rangka penghormatan hak asasi manusia penurunan kadar krom vi limbah cair industri pelapisan logam tegal zeolit gunung kidul perancangan implementasi kecerdasan -buatan robot pencari jalur berbasis mikrokontroler basic stamp perilaku delinkuentinjau kecerdasan emosi penyandang tunalaras slb-e bhina putera surakarta persepsi manajer menengah mengenai kinerjanya 23 perusahaan industri minyak kelapa sulawesi utara analisis kondisi lingkungan pengendalian (control environment) sistem pengendalian intern bank btn faktor-faktor berperan beratnya cedera penderita kecelakaan lalu-lintas mobil jalan tol funsionalisasi komposit oksida besi silika proses penyisihan pah air uji kinerjanya kajian kapasitas perpustakaangital perpustakaan lingkungan universitasi indonesia kajian keberadaan terminal tirtonadi surakartatinjau aspek kinerja fungsi pelayanan terminal keefektifan hukum tentang tata guna tanah pembangunan lingkungan pemukiman perkotaan jawa timur pemanfaatan sumur resapan sebagai upaya mengurangi resiko banjir kotamadya dati ii semarang tahap ii penggunaan istilah penamaan etnik cina indonesia tinjauan sosiolinguistis kaum muda jakarta potensi sumberdaya alam gunungapi merapi pengelolaannya mendukung kehidupan masyarakat sekitar prevalensi bisinosis pabrik tekstil hubungannya konsentrasi debu kapas lingkungan kerja prosiding seminar nasional kimia i peranan penelitian kimia penumbuhan pengembangan industri desain insinerator sebagai teknologi pendukung pengolahan persampahan tpa banyuurip kabupaten magelang efektivitas sterilisasisinfeksi kamar operasi ruang ugd rumah sakit umum bhakti yudha depok evaluasi parameter perancangan alat adsorpsi volatile organic compound (voc) udara tercemar hubungan lingkungan fisik rumah kejadian tb paru bta (+) kabupaten muaro jambi tahun 2005 kajian perencanaan manajemen lingkungan program pengendalian malaria kabupaten asmat tahun 2008 model endemisitasare (di rwo2 kelurahan pondok labu kecamatan cilandak jakarta selatan) pipa baja martensit kromium tinggi mempunyai tahanan lubang sangat baik metoda pembuatannya program antara banding pengukuran aktivitas 60co 137cs 131i antara p3krbin laboratorium batan studi alur biodegradasi pestisida glifosat media tanah menggunakan bakteri pseudomonas sp studi analitis eksperimental mesin pendinginan adsorpsi panas gas buang sebagai sumber energi studi pengaruh implementasi customer relationship management (crm) tingkatan kepuasan pelanggan' analisis variabel-variabel mempengaruhi kepuasan konsumen pembelian rumah kabupaten sidoarjostribusi logam berat merkuri (hg) kawasan pesisir teluk ratatotok kabupaten minahasa sulawesi utara faktor-faktor berpengaruh produktivitas kerja instruktur balai latihan kerja sejabotabek kajian manajemen lingkungan kejadian demam berdarah dengue (dbd) kota purwokerto jawa -tengah pemanfaatan open source software free hosting website pengembangan pendidikan kota balikpapan analisa sumber jenis informasi marketing intellegenceperlukan penawaran tender kontraktor analisis eksternal internal pengembangan pelayanan gawat darurat menjadi unggulan rsu fk uki analisis inderaja evaluasi turunnya kualitas lingkungan (perairan segara anakan cilacap) efisiensi pengolahan limbah oli bengkel menggunakan reaktorssolved air flotation skala laboratorium faktor lingkungan berpengaruh kejadian infeksi virus dengue (kota semarang) hubungan antara sanitasi lingkungan kejadianare desa penganjaran kecamatan bae kabupaten kudus penanganan ekosistem hutan secara rasional akibat ladang berpindah perambahan hutan sumatera selatan sestim pelindung peralatan elektronik gangguan elektromagnetik (electromagnetic interference/ emi) strategi mengatasi masalah kesehatan lingkungan hidup pemukiman kumuh lewat program pemasaran sosial analisis kemampuan daya gabung gen genotipe udang galah mendukung program seleksi hibridisasi kampanye pemeriksaan perawatan kendaraan bermotor; menyadarkan pengendara akan dampaknya bagi kesehatan kedudukan pengadilan pajak menurut undang-undang nomor 14 tahun 2002 lingkungan peradilan indonesia pendugaan daya dukung perairan teluk awarange bagi pengembangan budi daya bandeng keramba jaring apung penerapan it secara top-down implementasi sistem pengukuran kinerja peningkatan kinerja enterprise pengaruh environmental stressor tehadap stres kerja pegawai satpol pp seksi operasi pemerintah kota surabaya analisa yuridis eksploitasi sumber saya air tanpa izin kelurahan pasirwangi kecamatan ujungberung imbal jasa lingkungan pelestarian sumber daya air (kabupaten karanganyar kota surakarta) kegagalan baja tahan karat aisi 304 aisi 316 mendapat beban statik larutan asam sulfat 082 m pengaruh lingkungan pengalaman ciri-ciri pribadi sosialisasi masa kecil promosi pekerja wanita pengaruh suhu fotoperiode pemijahan ikan pelangi (melanotaenia boesemani) perilaku musim hujan proses partisipasi masyarakat program penataan lingkungan permukiman kumuh kelurahan tanjung unggat sumbangan konfusianisme taoisme bagi pembentukan humanisme environmen-talisme kebudayaan china the effect of ascariasis treatment and health education on the cognitive function of primary school children durasi hidup hippocampus kuda bleeker 1852 percobaan pemeliharaan kuda laut secara indoor maupun outdoor keterampilan harusmiliki jurnalis era konvergensi media 9perspektif jurnalis jakarta indonesia) penggunaan bakteri probiotik sebagai kontrol biologi produksi massal benih rajungan (portunus pelagicus) asuhan keperawatan nn f gangguan isolasi sosial menarikri bangsal srikandi rsjd surakarta minimasi sampah domestik kotamadya bandung tinjauan penerapan unit pengomposan skala rumah tangga multistage stochastic programming perencanaan kapasitas permintaan parameter biaya tidak pasti penyidikan penambangan batubara tanpa izin kecamatan tapin selatan oleh satuan reskrim polres tapin sistem pengelolaan kedaruratan bahan beracun berbahaya nasional (telaah penetapan pokok perencanaan sistem) analisis tata ruang lingkungan kamar operasi kamar bedah rumah sakit umum daerah kotamadya bekasi tahun 2000 application of constructed wetlands to remove nitrogenous and phosphorous compounds from leachate run-off liquid input-output lingkungan sektor industri pengolahan menunjang pembangunan berkelanjutan dki jakarta metode peralatan penggerak piringan beralur mengangkut mentransformasikan material partikulat pengaruh bau-bauan perfomansi kerja hasil pengujian menggunakan test hitungan stasiun kerja komputer prevalensi bronkitis kronis faktor faktor berhubungan pekerja pabrik tissu ptx karawang kontrol faktor resiko lingungan kejadian tb paru bta (+) kabupaten aceh barat tahun 1999 sumbangan faktor-faktor berkorelasi cognitive map neighbourhood quotient penghuni kebayoran barustorsi pembangunan kemerosotan lingkungan hidup etnik amungme kamoro kabupaten mimika provinsi papua hubungan antara lamanya penugasan ayah kepribadian prestasi belajar remaja lingkungan keluarga abri kasusare kecamatanlarang air sumur tidak memenuhi syarat air minum mengandung bakteri coli' meta-analysis of thestribution of daidzein genistein glycitein and their glucosidic conjugates in soy foods pengaruh implantasi ion molybdenum kekerasan laju korosi baja ss 304 lingkungan 0005 m hcl pengembangan program korelasi uji laboratorium ascope memenuhi persyaratan uji profesiensi iso/iec guide 43 tingkat hasil komponen hasil sistem intensifikasi padi (sri) tanpa pupuk organik daerah curah hujan tinggi tinjauan waktu kontak suhu pemanasan penyerapan fenol tandan kosong sawit (tks) sebagai adsorben analisa faktor-faktor membentuk keputusan warga lanjut usia surabaya memilih suatu aktivitas leisure kajian dampak lingkungan kegiatan penambangan pasir daerah sabuk hijau gunung sumbing kabupaten temanggung kajian kelayakan teknologi pengolahan sampah terpadu gedung perkantoran gedung bppt jakarta pusat pengaruh pengaruh kepuasan kerja pegawai pelayanan sosial panti asuhan anak se eks karesidenan surakarta pengurangan kadar lignin ramah lingkungan industri pulp kertas oleh enzim xilanase aspergillus niger praktik premanisme lingkungan pasar studi etnografi kalangan pedagang kaki lima pasar setonongulon surabaya studi deskriptif kelelahan tenaga kerja kuningan bagian bubut bor pt sampurna juwana pati tahun 2002 studi perbandingan penggunaan karbon aktif tempurung kemiri karbon aktif komersial solidifikasi cr(v) analisa barrier pengendalian kebisingan akibat transportasi jalan raya masjid kemayoran indrapura surabaya awig-awig desa adat tenganan pegringsingan kelestarian lingkungan sebuah kajian tentang tradisi perubahan studi pemilihan lokasi (site selection) tempat pembuangan akhir (tpa) sampah kota juwana kabupaten pati jawa tengah berbagai faktor dominan berkaitan kejadian kecelakaan lalu lintas angkutan umum (bemo) surabaya faktor-faktor mempengaruhi kegiatan pasar kota kupang kegiatan ekonomi petani desa wilayah sekitarnya kenakalan siswa madrasah salafiyah ula (di kelas 5 msu al ukhuwah joho sukoharjo tahun ajaran 2007/2008) pengaruh keadaan sosial-ekonomi-budaya kesehatan lingkungan permukiman rumah susun jakarta pengaruh lingkungan belajar budaya transformasional proses transformasi potensi sosial individu menjadi perencanaan strategik pusat kesehatan masyarakat tempat perawatan (dtp) mekar mukti bekasi tahun 2003 - 2008 studi prospek pengembangan ekowisata kawasan sekitar kars gombong selatan mendukung keberlanjutan wilayah tinjauan konsentrasi debu masing-masing unit operasi bagian spinning iii pt grand textile industry analisis kondisi lingkungan kerja partisipasi jalur karir sistem reward kinerja pegawai setda sragen aplikasi sistem penanganan air balas metode penyinaran uv perlakuan panas kapal star 50 buatan ptpal hubungan karakteristik ibu status ekonomi keluarga lingkungan sosial pemilihan tenaga penolong persalinan hubungan kualitas fisik lingkungan pola kehidupan lansia kelurahan pudak payung kec banyumanik semarang pelatihan mind shifting pengembangan budaya kerja lingkungan badan pengawasan keuangan pembangunan pusat pengendalian pencemaran lingkungan hidup industri tenun ikat desa troso kecamatan pecangaan kabupaten jepara perancangan konstruksi pengujian pembangkit listrik mikrohidro aliran badan air lingkungan kampus ui depok strategi manajemen lingkungan bantaran sungai brantas berpendudukt sub kajian buk gludug - alap-alap kota malang study perbandingan penggunaaan polyethylene fiberglass sebagai bahan dasar pembuatan kapal ikan ukuran 5 gt evaluasi pengaruh asam klorida asam sulfat korosi material pembangkit uap (ss 321 ss 304) cms 100 evaluasi sebaran logam hg cd cr co cuplikan air sedimen enceng gondoklokasi perairan surabaya iii hasil belajar persepsi siswa sma pembelajaran pencemaran lingkungan melalui investigative case based learning identifikasi hazard penanganan resikotimbulkanvisi peralatan industri agro pt barata indonesia innovative development of shrimp culture techniques for the improvement of efficiency and environmental sustainability perubahan lingkungan strategi serta implikasinya profitabilitas risiko bank umum devisa indonesia peternakan sapiwilayah-wilayah kecamatan amarasi kupang barat kupang tengah serta dampaknya lingkungan analisis persepsi manajer pemasaran hubungan antara product life cycle strategi struktur organisasi kinerja konsep keberlanjutan lingkungan perumahan massal perumahan massal perumnas bumi tlogosari semarang optimizing the roles of subsidiaries managers' position as a 'boundary-spanning' interactive communication perspective pengaruh dampak lingkungan biodiesel sebagai bahan bakar alternatif negara berkembang khususnya asia- tenggara peran mikroorganisme lingkungan menimbulkan infeksi nosokomial unit luka bakar rumah sakit ciptomangunkusumo rancang bangun sensor oksigen terlarut (disolved oxygen) menggunakan teknologi thick film pemantauan kualitas air upaya pemerintah provinsi kalimantan tengah melakukan pengawasan usaha pertambangan kalimantan tengah kehidupan masyarakat lokasi pelacuran boker rt 004 rt 008 rw 01 kelurahan ciracas kecamatan ciracas jakarta timur kontribusi kompensasi semangat kerja guru bantu lingkungan cabangnas pendidikan kecamatan babakan ciparay koordinasi kelembagaan pengelolaan ruang terbuka hijau (ruang terbuka hijau provinsi dki jakarta) pengaruh kerja shift lingkungan kerja produktivitas karyawan produksi pt indofood sukses makmur tbk perencanaan strategi penanggulangan hiv/aidskalangan tahanan narapidana rumah tahanan negara klas 1 jakarta pusat analisis hubungan karakteristik individu lingkungan kerja kinerja perawat unit rawat inap rs pertamina jaya antisipasi kebijakan perkembangan kota sesuai semangan undang-undang no 22 tahun 1999 tentang pemerintahan daerah green marketing keputusan pembelian studi dampak marketing communications the body shop pembelian produknya kesetimbangant cair protein dprotteinasi limbah cangkang udang menjadi kitin larutan natrium hidroksida pengaruh penggunaan kayu bakar batu bara sebagai bahan bakar pembuatan bata merah kualitas bata merah penilaian kepatutan penggunaan pronomina gue lu kalangan kelompok dosen mahasiswa universitas indonesia depok self-regulated learning mahasiswa fast track (sebuah penelitian kualitatif fenomenologis fakultas teknik industri itb) studi penanganan limbah solvent sisa analisis acidity pengendalian pencemaran lingkungan pertamina up iv cilacap studi tentang faktor-faktor kenakalan siswa penanggulangannya smu bhakti karya kaloran temanggung tahun 2009/2010 tingkat daya tahan panas ternak sapi perah fh produksi susu peternakan rakyat kecamatan tanjungsari sumedang upaya peningkatan hasil belajar siswa pokok bahasan fluida menggunakan peralatan sederhana lingkungan sekitar biaya manfaat pengelolaan hama gudang beras kajian pengelolaan hama gudang perum bulogvre dki jakarta sunter gambaran stres kerja beberapa faktor lingkungan kerja faktor demografi guru sltp jakarta barat bulan juli 2002 implementasi perda propinsi jatim nomor 10 th 1995 penanggulangan penambangan pasir tanpa izin oleh polres mojokerto penerapan metode green productivity upaya peningkatan produktivitas (pt sido muncul bergas semarang) penerapan new public management (npm) pemerintahan kabupaten kota wilayah propinsi daerah istimewa yogyakarta pengaruh strategi kemitraan pg trangkil kinerja pemasok tebu lingkungan bisnis sebagai variabel moderator peranan penagihan pajak mengatasi peningkatan tunggakan pajak kantor pelayanan pajak lingkungan kota bandung perangkat lunak analisa sistem pendukung keputusan metode analytic hierarchy process (ahp) berbasis object oriented sistem pengolahan bulu limbah cair industri potong ayam industri pemotongan ayam kebon pedes bogor sistem pewarisan kesenian rudat masyarakat kampung cikupa desa pusparahayu kecamatan puspahiang kabupaten tasikmalaya pengaruh motivasi lingkungan kerja produktivitas kerja karyawan pt kebon agung pabrik gula trangkil pati pengaruh motivasi kerja budaya organisasi kinerja pegawai lingkungannas bina marga propinsi jawa tengah penilaian kualitas pendidikan dasar berbagai lingkungan pendidikan serta hubungannya sejumlah variabel pendidikan perancangan sistem pengendalian ph sistem pengolahan limbah berbasis adaptive control variant forgetting factor studi kinerja uplink sistem kombinasi orthogonal frequencyvision multiplexing/spacevision multiple access (ofdm/sdma) uji aktivitas ekstrak buah mengkudu (morinda citrifolia linn) sebagai biopestisida hama bactrocera dorsalis hend analisis implementasi pendidikan latihan rangka pengembangan karir pegawai negeri sipil bappenas faktor-faktor lingkungan kerja berhubungan frekuensi denyut nadi tenaga kerja bagian weaving pt iskandartex hubungan faktor-faktor lingkungan rumah kejadian penyakit ispa anak balita kecamatan jambi selatan tahun 2002 iklim emosional kelas kegiatan praktikumskusi tipe think-pair-square materi lingkungan sman 2 bandung kajian penelitian tugas akhir mahasiswa strata berhubungan sistem informasi lingkungan universitas indonesia kajian teoretis kebijakan konservasi sumber daya alam hayati pembangunan ekonomi berkelanjutan bidang kehutanan pemanfaatan pemeliharaan jamban jamak proyek penyehatan lingkungan pemukiman kabupaten daerah tingkat ii bantul pembuatan program komputer menghitung dosis interna yodium penyebarannya reaktor kartini keadaan darurat penerapan penilaian kinerja (performance assesment) membentuk habits of mind siswa pembelajaran konsep lingkungan pengaruh kecepatan potong pemesinan kering bahan besi cor meningkatkan produktivitas industri logam kecil menengah peran serta masyarakat proses analisis mengenai dampak lingkungan penanganan permasalahan pt inti lndorayon utama analisis hubungan kepemimpinan kemampuan motivasi kinerja pejabat lingkungan kantor sekretariat wakil presiden analisis pengaruh faktor sosial ekonomi masyarakat pantai penebangan kayu bakau kabupaten langkat sumatera utara hubungan motivasi kerja lingkungan kerja kinerja pegawai administrasi survai iain syarif hidayatullah jakarta perencanaan tata bangunan lingkungan (rtbl) berbasis masyarakat mungkinkah? sebuah pembelajaran kabupaten semarang survei kondisi lingkungan kelusrga mempunyai balitaare tidakare desa kebonsari dempet kabupaten demak kemampuan kemauan masyarakat membayar retribusi kebersihan tahap kolektor lingkungan perumahan kota pemalang tinjauan strategi produk - pasar cn-235 guna merumuskan strategi bisnis situasi perubahan lingkungan industri bisnis hubungan antara faktor kondisi lingkungan produktivitas tambak penajaman kriteria kesesuaian lahan 2 kualitas tanah hubungan panas kelembaban prevalensi tinea kruris pekerja hot press sewing pabrik sepatu s tangerang pengaruh budaya organisasi locus of control penerapan sistem informasi kinerja aparat unit-unit pelayanan publik pengaruh faktor lingkungan kerja prestasi kerja karyawan bagian production engineer pt philips indonesia sidoarjo pengaruh masa kerja trait kepribadian kepuasan kerja iklim psikologis komitmen dosen universtias indonesia studi tentang hubungan iklim organisasi kepemimpinan kepuasan kerja pegawai lingkungan kantor sekretariat kabinet estetika penerangan fasilitas umum (pendekatan kebijakan konservasi energi perkotaan) kasus kotamadya daerah tingkat ii bandung evaluasi pengelolaan tempat pembuangan akhir (tpa) supiturang kelurahan mulyorejo kecamatan sukun kota malang margi santoso kontribusi karakteristik lingkungan keluarga terjadinya kekerasan anak usia 10-14 tahun kabupaten indramayu nilai produk wisata budaya bauran promosi sebagai faktor penentu keputusan membeli produk wisata budaya kalimantan timur pengaruh perubahan-perubahan terjadi tahap pelaksanaan kinerja biaya proyek konstruksi lingkungan bank bni rencana strategis rawat jalan sub bagian genekologi onkologi departemen obstetri -- genekologi rspad gatot soebroto jakarta 2002 analisis faktor-faktor mempengaruhi hasil penjualan pengusaha rumah makan (sepanjang jalan raya purwakarta) faktor risiko lingkungan berpengaruh kejadian leptospirosis berat (di rumah sakit dr kariadi semarang) faktor-faktor berhubungan kinerja pegawai non strukturalnas kesehatan provinsi nanggroe aceh darussalam tahun 2003 kontribusisiplin kerja kualitas kinerja pegawai lingkungannas tenaga kerja transmigrasi propinsi jawa barat pengaruh penerapan sistem preheater bahan bakar hsd efektifitas pembakaran turbin gas ptindonesia power ubp semarang pengaruh penggunaan sumber belajar alternatif hasil belajar siswa pembelajaran konsep pencemaran lingkungan smp penyidikan tindak pidana illegal logging oleh satreskrim polres berau (study kasus penyelundupan kayu hitam ke tawao malaysia) analisis faktor-faktor mempengaruhi perilaku berkoperasi siswa (pada siswa sma /smk negeri kabupaten kuningan) faktor risiko lingkungan berpengaruh kejadian leptospirosis berat (di rumah sakit dr kariadi semarang) menyokong organisasi petani pengelolaan irigasi berorientasi operasi pemeliharaan (op) menuju berorientasi bisnis pencemaran gas ammonia dampaknya pekerja masyarakat sekitar pt pupuk kujang cikampek jawa barat pengaruh lingkungan keausan daya koefisien gesek suhu kampas rem waktu pengereman kampas rem berbahan fiberglass pengaturan penerapan corporate social responsibility perusahaan pertambangan berbentuk perseroan terbatas indonesia desain kapal ikan multi fungsi ramah lingkungan sebuah konsep wahana baru kapal ikan kawasan indonesia bagian timur pengaruh penggunaan air sungai kejadian hepatitis e (studi 5 desa endemis kabupaten bondowoso jawa timur 2000-2001) praktikum pembuatan kertas daur ulang meningkatkan pemahaman konsep siswa sma kelas 2 pembelajaran pencemaran lingkungan suatu tinjauan fungsi pengawasan mahkamah agung pelaksanaan putusan hakim telah mempunyai kekuatan hukum tetap analisa pengaruh perbedaan lokasi antara hongkong chicken rise plasa surabaya supermal pakuwon indah standardisasi menu kependudukan daya dukung lingkungan pengembangan sumber daya air das serang das tuntang-jragung (wilayah jratunseluna) kualitas sungai kalimas analisis penegakan hukum lingkungan pengaruhnya kesehatan penduduk kotamadya surabaya pemahaman masyarakat bantaran sungai ciliwung tentang sanitasi lingkungan (di kelurahan kampung melayu jakarta timur) perencanaan portofolio sistem informasi pusat pendidikan pelatihan pengawasan badan pengawasan keuangan pembangunan bogor keterkaitan perkembangan permukiman terpadu perkembangan ekonomi lokal kawasan permukiman kecamatan rungkut surabaya strategi perguruan tinggi telaah bioekologi penyakit embun tepung tanaman mawar mesin pendingin adsorpsi studi analitis eksperimental perkembangan pemanfatan abu terbang beton mutu tinggi rancangan bangun sistem akuisisi data cuaca telemetri sistem produksi pengadaan bakalan standardisasi daging tinjauan persoalan mikrobiologi rekayasa infrastruktur evaluasi daya dukung lingkungan zona industri genuk semarang kajian pencemaran bahan organik kawasan pesisir semarang kecelakaan radiasi terkait peralatan radioterapi pengembangan objek wisata pasar terapung kota banjarmasin efektivitas biodeinking pengolahan kertas bekas campuran inhibisi korosi baja karbon lingkungan karbonat-bikarbonat kecerdasan linguisitik anak kembar usia dua tahun tujuh bulan penaikan panas suhu rendah biji-biji besi lateritik pengenalan wajah citragital menggunakan metode hybrid produksi purifikasi enzim xylanase aspergillus niger sanksi pengaruh penyalahgunaan narkoba kalangan remaja sumber daya alam pembangunan sebuah perpektif komparatif analisis swot usaha kerajinan mebel bambu kabupaten gianyar implementasi intelliegent mobile agent based updater antivirus konstruksi identitas ke-cina-an kalangan pemuda etnis cina metode pengendapan plankton-plankton daerah pasang merah pananganan air limbah pabrik gula subang cara pemisahan perencanaan strategi rumah sakit wanita yadika tahun 2003-2004 simulasi pengaturan lampu lalu lintas menggunakan logika fuzzy struktur komunitas fauna krustasea pulau-pulau teluk banten analisis perencanaan strategisnas kesehatan kuantan singingi integrasi pendidikan budi pekerti lagu dolanan anak-anak pengaruh konsentrasi lindi hitam pertumbuhan chlorella strategi pengelolaan sampah kapal penumpang tipe pax 2000 wahana pengembangan kreativitas anak prasekolah tema atraktif aspek sosial penerapan teknologi geothermal daeraheng community participation in care's water and sanitation projects penelitian mutu limbah cair industri tahu kotamadya palembang pengaruh lalu lintas kapal erosi abrasi tepi sungai permintaan sukarela audit internal eksternal bisnis keluarga hak kesehatan lingkungan lembaga pemasyarakatan anak tangerang komunitas zooplankton perairan waduk krenceng cilegon banten laporan berkelanjutan; kompetensi baru profesi akuntan manajemen? perencanaan strategis pengembangan rs setia mitra tahun 2003-2007 pengaruh polusi udara implikasinya perkembangan tanaman proteksi katodik impressed current besi tulangan beton sistem informasi penerimaan karyawan baru hotel santika bandung sporulation of some amf isolates on several media and host plants faktor eksternal sustainability perusahaan jasa konstruksi keanekaragaman flora lingkungan kampus unud bukit jimbaran bali memahami fenomena romantic relationship lingkungan pesantren pelatihan jarak jauh berbasis web kasus modul pelatihan dasar gsm pestisida berasal residustilasi asam lemak minyak neem sistem pemantauan kewajiban pengembang kotamadya jakarta selatan etika ekobisnis sebagai landasan utama pengembangan perusahaan faktor-faktor strategi pengembangan daya saing konstruktor indonesia hubungan lingkungan fisik ruangan kerja produktivitas pekerja indonesia-us economic relations under apec problems and prospects kaji numerik eksperimental kinerja saluran talang tembolok tekuk menuju kajian terpadu wilayah cekungan bandung sebuah gagasan awal metoda peralatan mengurangi bahan buangan pabrik pulp pedagang kaki lima corak lingkungan pasarnya kawasan palmerah perancangan interior museum replika fosilnosaurus surabaya perbandingan ranging antara algoritma single vision stereovision rekayasa akuntansi manajemen lingkungan bisnis kompetitif analisa formulasi strategi pemasaran biru api event and communication fasilitasagnostik rehabilitasi medis internasional surabaya kemelimpahan jenis gulma tanaman wortel sistem pertanian organik pembangunan pengembangan data pengelolaan kualitas sumberdaya air pendugaan proses pencampuran limbah cair wilayah perairan estuaria pengolahan limbah batik proses kimia adsorpsi karbon aktif perilaku sosial penderita hiv/aids menghadapi reaksi masyarakat populasi planaria lokasi bukit tunggul maribaya bandung utara aplikasi voltametri penentuan logam berat bahan lingkungan evaluasi peningkatan teknik operasional persampahan kota surakarta faktor-faktor pendidikan menurut al-ghazali kitab ihya ulumuddin pengaruh lingkungan kekuatan geser komposit model three rail perancangan kampanye perkembangan kreativitas anak usiani (balita) perbandingan dua metode ekstraksi pengujian logam alat aas permukiman delta batanghari pesisir timur jambi abad 11-13 masehi pola kepemimpinan kerjasama tim lingkungan rayon usaha pam jaya struktur kedap air terapung produksi pengeboran lepas pantai fenomena akustik kompleks candi cetho lereng gunung lawu karanganyar obligasi ritel indonesia sebagai objek jaminan lingkungan perbankan pemilihan teknologi produksi hidrogen memanfaatkan energi nuklir peran auditor masyarakat penerapan good government governance profil dna plasmid e coliisolasi limbah cair rumah sakit program penanggulangan keadaan darurat radiasi p3tm-batam yogyakarta sifat-sifat fisiko-kimia lemak kakao faktor-faktor berpengaruh pembuatan sistem pengelolaan dosis radiasi karyawan rsg gas berbasis web pemeriksaan beberapa logam air sungai citarum hulu alat aas pengaruh infiltrasi uap air secara siklik ke campuran beton aspal pengaruh ph air laut proses bioakumulasi cd perna viridis perkembangan prosedur menyelesaikan sengketa pencemaran lingkungan rencana pengelolaan lansekap kawasan triau beratan-buyan-tamblingan suplementasi vitamin c sebagai penangkal cekaman panas ayam broiler kajian lingkungan kawasan industri perikanan muncar banyuwangi jawa timur pembuatan prototipe pabrik briket limbah batubara halus daerah kaltim peranan kelenjar seks asesori menentukan fertilitas mamalia jantan strategi bersaing pt xyz industri jasa penyelenggara akses internet surabaya convention and exhibition hall tema reflection of surroundings analisa aplikasi komunikasi data laboratorium kualitas udara bergerak analisa risiko potensi bahaya lingkungan kerja dunia fantasi jakarta development of spiral welded steel line pipe api 5l x-60 for sour service efikasi ekstrak daun tembakau hama sengon eurema blanda (bolsd) ekolabelling sebagai upaya menghasilkan produk berwawasan lingkungan integrasi metascheduler gridway lingkungan komputasi grid fasilkom ui pembuatan pulp bilangan kappa rendah proseslignifikasi berlanjut penelitian pendahuluan pengolahan limbaht kulit makanan ternak pengaruh penggunaan bottom ash karakteristik campuran aspal beton pengaturan kewenangan penambangan bahan galian golongan c kota semarang perencanaan pembangunan wilayah provinsi perpsektif pengelolaan das perencanaan ruang terbuka hijau kotamadyang propinsi sumatera barat rekonstruksi lingkungan percandian situs batujaya karawang jawa barat analisa performansi transmisi audio bluetooth akibat interferensi wlan identifikasi kompleksitas karakteristik sistem pengelolaan zona pantai penentuan parameter pemodelan fluktuasi migrasi cesium tanah perencanaan strategis pengembangan rsu bayu asih purwakarta tahun 2004-2008 potensi strategi pengembangan kelautan lingkungan institut teknologi sifat kayu tarik teras gubal acacia mangium karakteristik pulp tingkat urgensi pengujian polusi gas buang kendaraan bermotor indonesia dukungan sosial adaptasi transmigran upt tampa sp-2 kalimantan tengah kajian mata air tanah lingkungan kampus ui depok metoda geolistrik kajian ruang bermain terbuka (playground) sekolah tk alam bukit dago bandung pembangunan rumah susuntinjau aspek hukum aspek lingkungan hidup perancangan kampanye menjaga kebersihan lingkungan penyakit chikungunya kajian manajemen pelaksanaan sanitasi lingkungan pelabuhan pontianak kajian perubahan bentuk tata ruang lingkungan permukiman kauman surakarta karakter visual koridor pendukung kawasan(simpang lima semarang) kehidupan masyarakat permukiman kumuh rt 01 rw 06 kebon pala jakarta timur korelasi antara batuan induk minyak bumi cekungan salawati irian jaya korelasi fraksi volume kuat lentur komposit semen berpenguat serbuk rotan pengukuran kecepatan emanasi gas radon permukaan lubang bor long year-65 hotel butik puncak waringin kabupaten manggarai barat nusa tenggara timur hubungan work-family conflict psychological well-being ibu bekerja identifikasi parameter model sistem penyerap tenaga ombak jenis rongga osilasi karakteristik limbah pengolahan minyak sawit cara penanganan pengawasannya pembuatan komponen sofc penggabungannya pembentukan sel bahan bakar pembuatan pemanas air tenaga matahari kantin p universitas kristen petra penguatan modal sosial sebuah jalan keluar menyelesaikan korupsi indonesia perancangan perisai radiasi sinar-x mesin berkas elektron 800 kv/400 ma perencanaan aspek non teknis operasional pengelolaan persampahan kota magelang faktor-faktor berperan kinerja instruktur lima bppd pulau jawa integrasi ekoteknologi program perlindungan lingkungan udara kota surabya kajian penghijauan kawasan historis (kawasanponegoro' medan) penapisan bakteri penghasil enzim kitosanase berasosiasi spons laut pengaruh stressor kinerja karyawan bagian produksi pt mondrian klaten penuaan peralatan industri migas proses sertifikasi peralatan/instalasi migas penyebaran akar hara hubungannya penaburan pupuk tanaman karet perbandingan kinerja server melalui virtualization xen lingkungan terbatas perencanaan strategi pemasaran instalasi bedah sentral rumah sakit persahabatan strategi pengembangan sumberdaya manusia pt aneka gas industri modifikasi polietilin sebagai polimer komposit biodegradable bahan kemasan pemodelan manajemen air tanah menggunakan metode stokastik finite element pengaruh faktor lingkungan air laut ketahanan korosi baja karbon rendah pengaruh tradisi arsitektur lingkungan (rumah adat toraja) profil pengajaran sastra wacana pengembangan pengajaran sastra berbasis kawasan studi tentang faktor-faktor mempengaruhi minat mahasiswa berwirausaha (sistem seleksi penerimaan mahasiswa baru perguruan tinggi negeri) analisa karakteristik bahan bakar biodiesel berasal minyak kelapa sawit analisis keragaman fenotipik heritabilitas tiga kultivar kelapa unggul'stribution and characteristics of quarternary peat deposits in eastern jawa sea korelasi karakterisasi tanah karakterisasi plasma nutfah tanaman srikaya pengelolaan risiko kualitas tahap pelaksanaan konstruksi lingkungan ptx peran apolipoprotein e timbulnya penyakit kardiovaskuler populasi jawa perilaku administratif sistem pengelolaan sekolah dasar kalimantan barat pola penataan lingkungan permukiman kumuh sekitar kawasan bantaran sungai palu segi pencemaran udara penerapan teknologi pelapisan permukaan secara radiasi sistem penggerak mobil listrikterapkan marlip marmut listrik lipi analisis keberlanjutan teknologi tanaman pakan daerah aliran sungai bagian hulu efektifitas penerimaan pesan hubunganadik antar-budaya pt indogrs ekologi arsitektur menuju perancangan arsitektur hemat energi berkelanjutan hamming code kode informasigital standart tt and c satelit mikro orbit leo media tumbuh kultivar daya hantar listrik pupuk bunga anthurium potong pencegahan infeksi aspergillus flavus kontaminasi aflatoksin kacang tanah pengembangan basis data program kesehatan lingkungan puskesmas kabupaten bekasi pengujian konsentrasi limbah proses pemasakan tekstil katun bakteri aerob peran wanita pengelolaan sampah daerah perkotaan (kasus kota yogyakarta) rumah sakit ibu anak (mother and children hospital) tema healing environment analisa evaluasi sisa material konstruksi sumber penyebab kuantitas biaya evaluasi optimasi manajemen teknik operasional pengelolaan sampah kota magelang evaluasi kinerja penyusun penilai amdal komisi penilai amdal pusat komposisi bahan pembasmi atau pbmbunuh serangga cara pengendalian hama serangga pemanfaatan limbah polietilen serat tandan kosong kelapa sawit menjadi komposit pengaruh gas ammonia kandungan rendah udara lingkungan kerja fungsi paru pengaruh suhu hidrotermal awal pembentukan zeolit abu layang batubara program pendidikan life skills bagi siswa sekolah menengah atas wilayah pesisir solidifikasi stabilisasi steel slag serta pemanfaatannya sebagai fine aggregate teknologi pemanfaatan limbah pembalakan industri peningkatan nilai tambah evaluasi sistem keselamatan pemakaian radio therapy rsud dr soetomo surabaya faktor-faktor penghambat partisipasi wanita lampung pepadun keluarga berencana faktor-faktor penyebab ispa lingkungan rumah tangga jakarta tahun 1990/1991 karakteristik perumahan penduduk kawasan sempadan rel kereta api kodya malang metoda meningkatkan keliatan lapisan campuran aluminium - seng pelat baja pemanfaatan berbagai sumber nitrogen nonprotein pembesaran ikan bandeng laut pengujian skala penuh campuran emulsi bergradasi rapat lapisan permukaan jalan peningkatan peran kepolisian pemeliharaan pembinaan keamanan negeri recycle plastik secara kimiawi pemanfaatan styrofoam sebagai bahan koagulan polimer situs-situs gua prasejarah jawa timur kajian pola hubungan budaya lingkungan transesterifikasi minyak nabati bekas menjadi biodiesel menggunakan katalis zeolite analisis pengaruh peduli lingkungan sikap perilaku pembeli the body shop pemanfaatan kompos enceng gondok gambut tanaman buncis kabupaten karanganyar pengaruh kondisi sanitasi lingkungan kematian anak (analisis data sdki 1997) kritik sosial atas pemakaian teori penelitan pengungkapan sosial lingkungan pembuatan formulasi pestisida hayati pengendalian penyakit layu bakteri tembakau pengaruh keluargadalam masalah kecenderungan nakal siswa remaja sma-sma manado strategi pemasaran industri komponen baja cor tempa pt sumbermitra sarijaya adaptasi penghuni gua prasejarah leang burung kabupaten maros provinsi sulawesi selatan detail engineering design (ded) instalasi pengolahan air lindi tpa muarareja kota tegal hubungan antara persepsi kompetisi motivasi berprestasi siswa smp hubungan budaya organisasi kinerja perawat pelaksana rsud sumedang tahun 2009 kaji balik perkembangan litbang aplikasi teknik nuklir bidang pertanian peternakan kajian dampak penggunaan plastik pvc lingkungan alternatifnya indonesia oksigen terlarut apparent oxygen utilization perairan teluk klabat pulau bangka penerapan asas tanggung jawab mutlak kasus lingkungan hidup pengadilan negeri pengaruh budaya organisasi kinerja karyawan kanwil vii bea cukai surabaya pengembanganstilator surya tipe telkes unit penghampa penyediaan air pengendalian biaya waktu proyek bangunan gedung menggunakan konsep nilai hasil sine motu vita est sine laetitia anatomia est ubicumque anatomia non est nequaquan stasiun informasi observasi antariksa pendayagunaan energi surya surabaya teknologi transplantasi terumbu karang menunjang rehabilitasi kawasan konservasi bentuk-bentukstorsi kognitif narapidana wanita mengalami depresi lapas sragen implementasi prinsip-prinsip tanggunggugat penyelesaian sengketa lingkungan hidup penggunaan hopanoid sebagai marker keragaman status komunitas bakteri penyubur tanah selayang pandang kaitan antara lingkungan perilaku kanker serta cara pencegahannya stabilisasi logam berat sludge efektifitas penggunaannya pembuatan batako usulan strategi bersaing pt radio paksi menggunakan tahapan analisis strategi dampak cara pembuatan obat baik (cp0b) pelestarian fungsi lingkungan hidup evaluasi penyelesaian sengketa lingkungan hidup (kali tapak kota semarang) implementasi hyperelliptic curve cryptosystem menggunakan algoritma haleyoptimasi kajian peluang pelibatan masyarakat pengembangan hutan kota srengseng jakarta barat non-ulcer dyspepsia relation with environmental factors - a study in sub himalayas india peluang tantangan implementasi undang-undang no 7 tahun 2004 tentang sumber daya air pemanfaatan enterprice architecture planning perencanaan strategis sistem informasi pemetaan profil industri alternatif penanganannya kota denpasar (dsdp) penelitian tindakan kelas sebagai upaya mencari umpan balik bagi peningkatan kinerja guru pengaruh pupuk organik cair (bio urine kelinci) pertumbuhan hasil jagung gpm program pengembangan teknologi bahan elemen bakar nuklir pusat elemen bakar nuklir sistem pengetahuan arti primbon bagi orang jawa beradaptasi lingkungan kebijakan pemerintah kota melaksanakan relokasi pedagang kaki lima kota surakarta pembaharuan metode identifikasi kerusakan hutan mangrove menggunakan data inderaja sig penentuan suhu penguraian senyawa sulfataplikasikan insinerator air limbah perancangan billboard spanduk semen mortar utama cyber puzzle cv capink kinfun teknik radioperunut mempelajari karakteristik air tanahgkal ppta pasar jum'at analisisnamis metode pengukuran balanced scorecard pt tunaskarya indoswasta analisis karakteristik wirausaha mendorong kesuksesan pengrajin kulit tanggulangin fenotipe reproduksi dua galur puyuh jepang (coturnix coturnix japonica) dua suhu ruang pemantauan kadar petstisida organoklorin du beberapa muara sungai perairan teluk jakarta pengaruh inhibitor anorganik korosi baja karbon lingkungan larutan beton artifisial re-use material bekas desain bangunan = re-use of dumped materials in building design studi tentang kualitas pelayanan kinerja unit jaminan mutu (ujm) politeknik negeri bali study of pollutantstribution in benoa bay uasing numerical simulation and satellite data tingkat pengetahuan masyarakat denpasar bali tentang program talk show ajeg bali bali tv analisis perhitungan konsentrasi ozon rancangan mbe 300 kev/20 ma iradiasi lateks aspek nonteknis indikator efisiensi sistem pertanaman tumpangsari sayuran dataran tinggi cara memperoleh pengetahuan pembelajaran fisika (dari pandangan teori-teori psikologi) pengaruh ratio bahan naoh waktu proses pembuatan pulp enceng gondok naoh pengelolaan sampaht menunjang kebersihan rsup dr m djamilng tahun 2000 penyisihan fenol limbah industri pt xyz eceng gondok (eichhornia crassipes) seleksi saudara kandung kemajuan seleksi toleransi kekeringan jagung suatu studi etnografi dusun meluke desa sidomulyo kecamatan deket kabupaten lamongan) andal kawasan industri tangerang pemantauan air buangan industri kimia dasar lingkungan studi kualitatif pelayanan rujukan asfiksia bayi baru lahir kabupaten cirebon jawa barat analisis pengaruh kinerja menara pendingin faktor keselamatan operasi reaktor kartini pemantauan kualitas lingkungan semenanjung muria penentuan radioaktivitas cuplikan pantai pemerolehan bahasa indonesia anak tunarungu usia 7-10 tahun (tina viki) peran penyidik penyidik pembantu penyelesaian tindak pidana penipuan penggelapan teknik pengendalian parasit eksternal pemeliharaan induk ikan cobia rachycentron canadum analisis geohistori beberapa sumur eksplorasi cekungan sumatera utarasuatu nota pendahuluan evaluasi impedance control manipulator robot pengaturan posisi gaya end-effector evaluasi program penanganan pengelolaan limbah batik kota pekalongan (periode 2004 2009) identifikasistribusi biaya-manfaat kegiatan industri tekstril kawasan perkotaan rancaekek kebijakan sistem pertanggungjawaban pidana korporasi perundang-undangan lingkungan hidup pengaruh kepemimpinan motivasi kerja kinerja karyawan pt propan raya icc semarang pengembangan model simulasi mendukung pengambilan keputusan tender pembangunan kapal produksi biosurfaktan oleh bakteri hidrokarbonoklastik bioremediasi tumpahan minyak bumi the water-structure modifying behaviour of some components of 3-in-1 tpn intravenous admixtures desain perekayasaan area monitor berbasis mikrokontroler menggunakan detektor geiger muller hubungan faktor sosial ekonomi keluarga faktor lingkungan kejadianare balita kebiasaan makan talang mamak adaptasi peladang berotasi perubahan lingkungan laju dekomposisi serasah mangrove kontribusinya nutrien hutan mangrove reboisasi peer coaching sebagai wahana guru berkolaborasi melalui teknologi informasi komunikasi pemanfaatan sabut kelapa isolasi lingkungan iklim mikro tanah pasiran bertanaman permukiman nilai-nilai budaya pesantren konteks penataan kawasan sidosermo surabaya tugas akhir pengujian pembangkit listrik tenaga surya posisi plat photovoltaic horizontal analisis aspek keamanan jaringan wi-fi lingkungan fakultas ilmu komputer univresitas indonesia analisis runtun waktu bivariat metode box-jenkins pemodelan var (vektor autoregresif) bentuk partisipasi masyarakat atraksi wisata pendakian gunung slamet kawasan wisata guci ecopark cibinong science study kasus konsep pengembangan ruang terbuka hijau berbasis konservasi implementasi aplikasi context-aware lingkungan pervasive computing menggunakan upnp network isolasi penapisan mikroba probiotik unggas pertumbuhannya berbagai sumber gula kajian mekanisme kinetika reaksi reduksi limbah kromium lingkungan industri elektroplating lingkungan strategis kawasan asia tenggara stagnasi pertahanan indonesia periode 2001-2004 penentuan strategi pemasaran handycraft analisis swot (ud wapres pekalongan) penerapan metode dekomposisi wavelet learning vector quantization analisis citra korosi pengendalian penyakit sayurantanam sistem budidaya mosaik pertanian periurban perencanaan strategis analisa evaluasi posisi strategi meningkatkan keunggulan bersaing strategi-strategi adaptifgunakan nelayan madura kehidupan ekonomi perikanan lautnya studi evaluasi partisipasi desa adat beraban mengelola obyek wisata pura tanah lot biomarka senyawa beroksigen sedimen laut arafura (core md2967 kedalaman 1200 cm 2400 cm) gambaran kondisi higiene penjamah makanan sanitasi kantin lingkungan universitas airlangga kajian erosi pendangkalan embung pulau timor-ntt embung oemasi embung leosama komposisi fitopalnkton peluang blooming microcystis aeruginosa waduk karangkatesjawa timur model penjadwalan pemesanan multi itemnamis adanyaskon penggunaan gudang bersama pengaruh limbah rumah sakit pgi cikini penurunan kualitas badan air penerima (sciliwung) pengaruh pembuangan tailing bawah laut pt newmont minahasa raya perairan teluk buyat pengelolaan lingkungan sentra industri rumah tangga pengasapan ikan bandarharjo kota semarang perangkat lunak sistem pengakuisisi data aerodinamika pengujian aerofoil terowongan angin analisis pengaruh citra supermarket loyalitas konsumen toko mitra kartasura sukoharjo analisis tingkat maturity manajemen proyek perusahaan jasa konstruksi (pada pt x) faktor-faktor mempengaruhi kepuasan mahasiswa pascasarjana universitas muhammadiyah surakarta hubungan antara kematangan beragama remaja muslim motivasi menuntut ilmu pondok pesantren penentuan konsentrasi pb zn cu lapisan sedimen metode spektrometer pendar sinar-x penerapan coaching meningkatkan kinerja pegawai bagian sekretariat rumah sakit islam surabaya pengaruh iklim organisasi gairah kerja karyawan bengkel auto 2000 hr muhammad surabaya potensi iptek pemanfaatan keanekaragaman hayati peningkatan kesejahteraan hidup manusia proses penyelesaian perkara pidana pelaku anggota tni (studi wilayah kodam ivponegoro) sistem perangkai selubung dua instrumen salah satu atau keduanya berada bawah tekanan analisis kebijakan tentang kewajiban penyampaian spt secara elektronik bagi wajib pajak kpp madya hubungan beberapa faktor lingkungan kejadian malaria kecamatan salaman kabupaten magelang keberlanjutan usaha tani pola padi sawah-sapi potong terpadu kabupaten sragen pendekatan rap-cls pembuatan asam oksalat oksidasi plastik polyvinyl chloride (pvc) suhu tekanan tinggi pengaruh transformasi arsitektur tradisional bangunan kantor pemerintah kondisi termal perencanaan master plan 2004-2008 badan pendidikan pelatihan provinsi jawa timur kampus surabaya analisa kemampuan supervisi kepala ruangan rawat inap rumah sakit pelni petamburan jakarta barat analisis kesenjangan wilayah gerbangkertosusilatinjau aspek ekonomi sosial lingkungan analisis swot strategi pengembangan usaha warung makan ayam goreng ayam bakar ibu wiwi faktor risiko dermatitis kontak iritan petani rumput laut kabupaten bantaeng sulawesi selatan hubungan pengendalian emosi penerimaan oleh teman sebaya remaja awal shulhu huzaimah akram penanganan lk3 pengelolaan sumur tua wilayah pertamina operasi ep cepu oleh kud bogosasono sistem pengelolaan air buangan lingkungan permukiman dl kawasan rumah susun penjaringan sari surabaya implementasi tqm pencapaian sistem manajemen lingkungan iso 14001 unit pengolahan vi-balongan kajian aplikasi mesin berkas elektron (mbe) surface treatment hasil industri kerajinan kayu manipulasi pra- analisis ciri- ciri sinyal squaredfference rekognisi skema modulasi automatic partisipasi wanita kegiatan penghijauan lahan kritis kecamatan playen kabupaten gunung kidul pengaruh motivasi kompensasi kinerja pegawai perpustakaan uin syarif hidayatullah jakarta pengembangan agribisnis ternak domba wilayah pesisir selatan kecamatan galur kabupaten kulon progo peran hutan kota menurunkan tingkat kebisingan lingkungan (kota manggala wanabakti) perubahan struktur mikroanatomi intestinum ikan mas (cyprinus carpio) karena pemberian logam berat zn sel elektrokimiaperbaikilengkapi membran penukar ion serta pelat logam dwi kutub studii intervensi peningkatan perilaku hidup bersih sehat bagi anak sdn cisalak i depok tahun 2009 suatu alternatif lain analisa stratifikasi puskesmas sub-kegiatan kia se-kabupaten semarang tahun 1988 kajian prospek arahan pengembangan atraksi wisata kepulauan karimunjawa perspektif konservasi pengaruh tekanan internasional kebijakan indonesia rangka penghormatan hak asasi manusia penurunan kadar krom vi limbah cair industri pelapisan logam tegal zeolit gunung kidul perancangan implementasi kecerdasan -buatan robot pencari jalur berbasis mikrokontroler basic stamp perilaku delinkuentinjau kecerdasan emosi penyandang tunalaras slb-e bhina putera surakarta persepsi manajer menengah mengenai kinerjanya 23 perusahaan industri minyak kelapa sulawesi utara analisis kondisi lingkungan pengendalian (control environment) sistem pengendalian intern bank btn faktor-faktor berperan beratnya cedera penderita kecelakaan lalu-lintas mobil jalan tol funsionalisasi komposit oksida besi silika proses penyisihan pah air uji kinerjanya kajian kapasitas perpustakaangital perpustakaan lingkungan universitasi indonesia kajian keberadaan terminal tirtonadi surakartatinjau aspek kinerja fungsi pelayanan terminal keefektifan hukum tentang tata guna tanah pembangunan lingkungan pemukiman perkotaan jawa timur pemanfaatan sumur resapan sebagai upaya mengurangi resiko banjir kotamadya dati ii semarang tahap ii penggunaan istilah penamaan etnik cina indonesia tinjauan sosiolinguistis kaum muda jakarta potensi sumberdaya alam gunungapi merapi pengelolaannya mendukung kehidupan masyarakat sekitar prevalensi bisinosis pabrik tekstil hubungannya konsentrasi debu kapas lingkungan kerja prosiding seminar nasional kimia i peranan penelitian kimia penumbuhan pengembangan industri desain insinerator sebagai teknologi pendukung pengolahan persampahan tpa banyuurip kabupaten magelang efektivitas sterilisasisinfeksi kamar operasi ruang ugd rumah sakit umum bhakti yudha depok evaluasi parameter perancangan alat adsorpsi volatile organic compound (voc) udara tercemar hubungan lingkungan fisik rumah kejadian tb paru bta (+) kabupaten muaro jambi tahun 2005 kajian perencanaan manajemen lingkungan program pengendalian malaria kabupaten asmat tahun 2008 model endemisitasare (di rwo2 kelurahan pondok labu kecamatan cilandak jakarta selatan) pipa baja martensit kromium tinggi mempunyai tahanan lubang sangat baik metoda pembuatannya program antara banding pengukuran aktivitas 60co 137cs 131i antara p3krbin laboratorium batan studi alur biodegradasi pestisida glifosat media tanah menggunakan bakteri pseudomonas sp studi analitis eksperimental mesin pendinginan adsorpsi panas gas buang sebagai sumber energi studi pengaruh implementasi customer relationship management (crm) tingkatan kepuasan pelanggan' analisis variabel-variabel mempengaruhi kepuasan konsumen pembelian rumah kabupaten sidoarjostribusi logam berat merkuri (hg) kawasan pesisir teluk ratatotok kabupaten minahasa sulawesi utara faktor-faktor berpengaruh produktivitas kerja instruktur balai latihan kerja sejabotabek kajian manajemen lingkungan kejadian demam berdarah dengue (dbd) kota purwokerto jawa -tengah pemanfaatan open source software free hosting website pengembangan pendidikan kota balikpapan analisa sumber jenis informasi marketing intellegenceperlukan penawaran tender kontraktor analisis eksternal internal pengembangan pelayanan gawat darurat menjadi unggulan rsu fk uki analisis inderaja evaluasi turunnya kualitas lingkungan (perairan segara anakan cilacap) efisiensi pengolahan limbah oli bengkel menggunakan reaktorssolved air flotation skala laboratorium faktor lingkungan berpengaruh kejadian infeksi virus dengue (kota semarang) hubungan antara sanitasi lingkungan kejadianare desa penganjaran kecamatan bae kabupaten kudus penanganan ekosistem hutan secara rasional akibat ladang berpindah perambahan hutan sumatera selatan sestim pelindung peralatan elektronik gangguan elektromagnetik (electromagnetic interference/ emi) strategi mengatasi masalah kesehatan lingkungan hidup pemukiman kumuh lewat program pemasaran sosial analisis kemampuan daya gabung gen genotipe udang galah mendukung program seleksi hibridisasi kampanye pemeriksaan perawatan kendaraan bermotor; menyadarkan pengendara akan dampaknya bagi kesehatan kedudukan pengadilan pajak menurut undang-undang nomor 14 tahun 2002 lingkungan peradilan indonesia pendugaan daya dukung perairan teluk awarange bagi pengembangan budi daya bandeng keramba jaring apung penerapan it secara top-down implementasi sistem pengukuran kinerja peningkatan kinerja enterprise pengaruh environmental stressor tehadap stres kerja pegawai satpol pp seksi operasi pemerintah kota surabaya analisa yuridis eksploitasi sumber saya air tanpa izin kelurahan pasirwangi kecamatan ujungberung imbal jasa lingkungan pelestarian sumber daya air (kabupaten karanganyar kota surakarta) kegagalan baja tahan karat aisi 304 aisi 316 mendapat beban statik larutan asam sulfat 082 m pengaruh lingkungan pengalaman ciri-ciri pribadi sosialisasi masa kecil promosi pekerja wanita pengaruh suhu fotoperiode pemijahan ikan pelangi (melanotaenia boesemani) perilaku musim hujan proses partisipasi masyarakat program penataan lingkungan permukiman kumuh kelurahan tanjung unggat sumbangan konfusianisme taoisme bagi pembentukan humanisme environmen-talisme kebudayaan china the effect of ascariasis treatment and health education on the cognitive function of primary school children durasi hidup hippocampus kuda bleeker 1852 percobaan pemeliharaan kuda laut secara indoor maupun outdoor keterampilan harusmiliki jurnalis era konvergensi media 9perspektif jurnalis jakarta indonesia) penggunaan bakteri probiotik sebagai kontrol biologi produksi massal benih rajungan (portunus pelagicus) asuhan keperawatan nn f gangguan isolasi sosial menarikri bangsal srikandi rsjd surakarta minimasi sampah domestik kotamadya bandung tinjauan penerapan unit pengomposan skala rumah tangga multistage stochastic programming perencanaan kapasitas permintaan parameter biaya tidak pasti penyidikan penambangan batubara tanpa izin kecamatan tapin selatan oleh satuan reskrim polres tapin sistem pengelolaan kedaruratan bahan beracun berbahaya nasional (telaah penetapan pokok perencanaan sistem) analisis tata ruang lingkungan kamar operasi kamar bedah rumah sakit umum daerah kotamadya bekasi tahun 2000 application of constructed wetlands to remove nitrogenous and phosphorous compounds from leachate run-off liquid input-output lingkungan sektor industri pengolahan menunjang pembangunan berkelanjutan dki jakarta metode peralatan penggerak piringan beralur mengangkut mentransformasikan material partikulat pengaruh bau-bauan perfomansi kerja hasil pengujian menggunakan test hitungan stasiun kerja komputer prevalensi bronkitis kronis faktor faktor berhubungan pekerja pabrik tissu ptx karawang kontrol faktor resiko lingungan kejadian tb paru bta (+) kabupaten aceh barat tahun 1999 sumbangan faktor-faktor berkorelasi cognitive map neighbourhood quotient penghuni kebayoran barustorsi pembangunan kemerosotan lingkungan hidup etnik amungme kamoro kabupaten mimika provinsi papua hubungan antara lamanya penugasan ayah kepribadian prestasi belajar remaja lingkungan keluarga abri kasusare kecamatanlarang air sumur tidak memenuhi syarat air minum mengandung bakteri coli' meta-analysis of thestribution of daidzein genistein glycitein and their glucosidic conjugates in soy foods pengaruh implantasi ion molybdenum kekerasan laju korosi baja ss 304 lingkungan 0005 m hcl pengembangan program korelasi uji laboratorium ascope memenuhi persyaratan uji profesiensi iso/iec guide 43 tingkat hasil komponen hasil sistem intensifikasi padi (sri) tanpa pupuk organik daerah curah hujan tinggi tinjauan waktu kontak suhu pemanasan penyerapan fenol tandan kosong sawit (tks) sebagai adsorben analisa faktor-faktor membentuk keputusan warga lanjut usia surabaya memilih suatu aktivitas leisure kajian dampak lingkungan kegiatan penambangan pasir daerah sabuk hijau gunung sumbing kabupaten temanggung kajian kelayakan teknologi pengolahan sampah terpadu gedung perkantoran gedung bppt jakarta pusat pengaruh pengaruh kepuasan kerja pegawai pelayanan sosial panti asuhan anak se eks karesidenan surakarta pengurangan kadar lignin ramah lingkungan industri pulp kertas oleh enzim xilanase aspergillus niger praktik premanisme lingkungan pasar studi etnografi kalangan pedagang kaki lima pasar setonongulon surabaya studi deskriptif kelelahan tenaga kerja kuningan bagian bubut bor pt sampurna juwana pati tahun 2002 studi perbandingan penggunaan karbon aktif tempurung kemiri karbon aktif komersial solidifikasi cr(v) analisa barrier pengendalian kebisingan akibat transportasi jalan raya masjid kemayoran indrapura surabaya awig-awig desa adat tenganan pegringsingan kelestarian lingkungan sebuah kajian tentang tradisi perubahan studi pemilihan lokasi (site selection) tempat pembuangan akhir (tpa) sampah kota juwana kabupaten pati jawa tengah berbagai faktor dominan berkaitan kejadian kecelakaan lalu lintas angkutan umum (bemo) surabaya faktor-faktor mempengaruhi kegiatan pasar kota kupang kegiatan ekonomi petani desa wilayah sekitarnya kenakalan siswa madrasah salafiyah ula (di kelas 5 msu al ukhuwah joho sukoharjo tahun ajaran 2007/2008) pengaruh keadaan sosial-ekonomi-budaya kesehatan lingkungan permukiman rumah susun jakarta pengaruh lingkungan belajar budaya transformasional proses transformasi potensi sosial individu menjadi perencanaan strategik pusat kesehatan masyarakat tempat perawatan (dtp) mekar mukti bekasi tahun 2003 - 2008 studi prospek pengembangan ekowisata kawasan sekitar kars gombong selatan mendukung keberlanjutan wilayah tinjauan konsentrasi debu masing-masing unit operasi bagian spinning iii pt grand textile industry analisis kondisi lingkungan kerja partisipasi jalur karir sistem reward kinerja pegawai setda sragen aplikasi sistem penanganan air balas metode penyinaran uv perlakuan panas kapal star 50 buatan ptpal hubungan karakteristik ibu status ekonomi keluarga lingkungan sosial pemilihan tenaga penolong persalinan hubungan kualitas fisik lingkungan pola kehidupan lansia kelurahan pudak payung kec banyumanik semarang pelatihan mind shifting pengembangan budaya kerja lingkungan badan pengawasan keuangan pembangunan pusat pengendalian pencemaran lingkungan hidup industri tenun ikat desa troso kecamatan pecangaan kabupaten jepara perancangan konstruksi pengujian pembangkit listrik mikrohidro aliran badan air lingkungan kampus ui depok strategi manajemen lingkungan bantaran sungai brantas berpendudukt sub kajian buk gludug - alap-alap kota malang study perbandingan penggunaaan polyethylene fiberglass sebagai bahan dasar pembuatan kapal ikan ukuran 5 gt evaluasi pengaruh asam klorida asam sulfat korosi material pembangkit uap (ss 321 ss 304) cms 100 evaluasi sebaran logam hg cd cr co cuplikan air sedimen enceng gondoklokasi perairan surabaya iii hasil belajar persepsi siswa sma pembelajaran pencemaran lingkungan melalui investigative case based learning identifikasi hazard penanganan resikotimbulkanvisi peralatan industri agro pt barata indonesia innovative development of shrimp culture techniques for the improvement of efficiency and environmental sustainability perubahan lingkungan strategi serta implikasinya profitabilitas risiko bank umum devisa indonesia peternakan sapiwilayah-wilayah kecamatan amarasi kupang barat kupang tengah serta dampaknya lingkungan analisis persepsi manajer pemasaran hubungan antara product life cycle strategi struktur organisasi kinerja konsep keberlanjutan lingkungan perumahan massal perumahan massal perumnas bumi tlogosari semarang optimizing the roles of subsidiaries managers' position as a 'boundary-spanning' interactive communication perspective pengaruh dampak lingkungan biodiesel sebagai bahan bakar alternatif negara berkembang khususnya asia- tenggara peran mikroorganisme lingkungan menimbulkan infeksi nosokomial unit luka bakar rumah sakit ciptomangunkusumo rancang bangun sensor oksigen terlarut (disolved oxygen) menggunakan teknologi thick film pemantauan kualitas air upaya pemerintah provinsi kalimantan tengah melakukan pengawasan usaha pertambangan kalimantan tengah kehidupan masyarakat lokasi pelacuran boker rt 004 rt 008 rw 01 kelurahan ciracas kecamatan ciracas jakarta timur kontribusi kompensasi semangat kerja guru bantu lingkungan cabangnas pendidikan kecamatan babakan ciparay koordinasi kelembagaan pengelolaan ruang terbuka hijau (ruang terbuka hijau provinsi dki jakarta) pengaruh kerja shift lingkungan kerja produktivitas karyawan produksi pt indofood sukses makmur tbk perencanaan strategi penanggulangan hiv/aidskalangan tahanan narapidana rumah tahanan negara klas 1 jakarta pusat analisis hubungan karakteristik individu lingkungan kerja kinerja perawat unit rawat inap rs pertamina jaya antisipasi kebijakan perkembangan kota sesuai semangan undang-undang no 22 tahun 1999 tentang pemerintahan daerah green marketing keputusan pembelian studi dampak marketing communications the body shop pembelian produknya kesetimbangant cair protein dprotteinasi limbah cangkang udang menjadi kitin larutan natrium hidroksida pengaruh penggunaan kayu bakar batu bara sebagai bahan bakar pembuatan bata merah kualitas bata merah penilaian kepatutan penggunaan pronomina gue lu kalangan kelompok dosen mahasiswa universitas indonesia depok self-regulated learning mahasiswa fast track (sebuah penelitian kualitatif fenomenologis fakultas teknik industri itb) studi penanganan limbah solvent sisa analisis acidity pengendalian pencemaran lingkungan pertamina up iv cilacap studi tentang faktor-faktor kenakalan siswa penanggulangannya smu bhakti karya kaloran temanggung tahun 2009/2010 tingkat daya tahan panas ternak sapi perah fh produksi susu peternakan rakyat kecamatan tanjungsari sumedang upaya peningkatan hasil belajar siswa pokok bahasan fluida menggunakan peralatan sederhana lingkungan sekitar biaya manfaat pengelolaan hama gudang beras kajian pengelolaan hama gudang perum bulogvre dki jakarta sunter gambaran stres kerja beberapa faktor lingkungan kerja faktor demografi guru sltp jakarta barat bulan juli 2002 implementasi perda propinsi jatim nomor 10 th 1995 penanggulangan penambangan pasir tanpa izin oleh polres mojokerto penerapan metode green productivity upaya peningkatan produktivitas (pt sido muncul bergas semarang) penerapan new public management (npm) pemerintahan kabupaten kota wilayah propinsi daerah istimewa yogyakarta pengaruh strategi kemitraan pg trangkil kinerja pemasok tebu lingkungan bisnis sebagai variabel moderator peranan penagihan pajak mengatasi peningkatan tunggakan pajak kantor pelayanan pajak lingkungan kota bandung perangkat lunak analisa sistem pendukung keputusan metode analytic hierarchy process (ahp) berbasis object oriented sistem pengolahan bulu limbah cair industri potong ayam industri pemotongan ayam kebon pedes bogor sistem pewarisan kesenian rudat masyarakat kampung cikupa desa pusparahayu kecamatan puspahiang kabupaten tasikmalaya pengaruh motivasi lingkungan kerja produktivitas kerja karyawan pt kebon agung pabrik gula trangkil pati pengaruh motivasi kerja budaya organisasi kinerja pegawai lingkungannas bina marga propinsi jawa tengah penilaian kualitas pendidikan dasar berbagai lingkungan pendidikan serta hubungannya sejumlah variabel pendidikan perancangan sistem pengendalian ph sistem pengolahan limbah berbasis adaptive control variant forgetting factor studi kinerja uplink sistem kombinasi orthogonal frequencyvision multiplexing/spacevision multiple access (ofdm/sdma) uji aktivitas ekstrak buah mengkudu (morinda citrifolia linn) sebagai biopestisida hama bactrocera dorsalis hend analisis implementasi pendidikan latihan rangka pengembangan karir pegawai negeri sipil bappenas faktor-faktor lingkungan kerja berhubungan frekuensi denyut nadi tenaga kerja bagian weaving pt iskandartex hubungan faktor-faktor lingkungan rumah kejadian penyakit ispa anak balita kecamatan jambi selatan tahun 2002 iklim emosional kelas kegiatan praktikumskusi tipe think-pair-square materi lingkungan sman 2 bandung kajian penelitian tugas akhir mahasiswa strata berhubungan sistem informasi lingkungan universitas indonesia kajian teoretis kebijakan konservasi sumber daya alam hayati pembangunan ekonomi berkelanjutan bidang kehutanan pemanfaatan pemeliharaan jamban jamak proyek penyehatan lingkungan pemukiman kabupaten daerah tingkat ii bantul pembuatan program komputer menghitung dosis interna yodium penyebarannya reaktor kartini keadaan darurat penerapan penilaian kinerja (performance assesment) membentuk habits of mind siswa pembelajaran konsep lingkungan pengaruh kecepatan potong pemesinan kering bahan besi cor meningkatkan produktivitas industri logam kecil menengah peran serta masyarakat proses analisis mengenai dampak lingkungan penanganan permasalahan pt inti lndorayon utama analisis hubungan kepemimpinan kemampuan motivasi kinerja pejabat lingkungan kantor sekretariat wakil presiden analisis pengaruh faktor sosial ekonomi masyarakat pantai penebangan kayu bakau kabupaten langkat sumatera utara hubungan motivasi kerja lingkungan kerja kinerja pegawai administrasi survai iain syarif hidayatullah jakarta perencanaan tata bangunan lingkungan (rtbl) berbasis masyarakat mungkinkah? sebuah pembelajaran kabupaten semarang survei kondisi lingkungan kelusrga mempunyai balitaare tidakare desa kebonsari dempet kabupaten demak kemampuan kemauan masyarakat membayar retribusi kebersihan tahap kolektor lingkungan perumahan kota pemalang tinjauan strategi produk - pasar cn-235 guna merumuskan strategi bisnis situasi perubahan lingkungan industri bisnis hubungan antara faktor kondisi lingkungan produktivitas tambak penajaman kriteria kesesuaian lahan 2 kualitas tanah hubungan panas kelembaban prevalensi tinea kruris pekerja hot press sewing pabrik sepatu s tangerang pengaruh budaya organisasi locus of control penerapan sistem informasi kinerja aparat unit-unit pelayanan publik pengaruh faktor lingkungan kerja prestasi kerja karyawan bagian production engineer pt philips indonesia sidoarjo pengaruh masa kerja trait kepribadian kepuasan kerja iklim psikologis komitmen dosen universtias indonesia studi tentang hubungan iklim organisasi kepemimpinan kepuasan kerja pegawai lingkungan kantor sekretariat kabinet estetika penerangan fasilitas umum (pendekatan kebijakan konservasi energi perkotaan) kasus kotamadya daerah tingkat ii bandung evaluasi pengelolaan tempat pembuangan akhir (tpa) supiturang kelurahan mulyorejo kecamatan sukun kota malang margi santoso kontribusi karakteristik lingkungan keluarga terjadinya kekerasan anak usia 10-14 tahun kabupaten indramayu nilai produk wisata budaya bauran promosi sebagai faktor penentu keputusan membeli produk wisata budaya kalimantan timur pengaruh perubahan-perubahan terjadi tahap pelaksanaan kinerja biaya proyek konstruksi lingkungan bank bni rencana strategis rawat jalan sub bagian genekologi onkologi departemen obstetri -- genekologi rspad gatot soebroto jakarta 2002 analisis faktor-faktor mempengaruhi hasil penjualan pengusaha rumah makan (sepanjang jalan raya purwakarta) faktor risiko lingkungan berpengaruh kejadian leptospirosis berat (di rumah sakit dr kariadi semarang) faktor-faktor berhubungan kinerja pegawai non strukturalnas kesehatan provinsi nanggroe aceh darussalam tahun 2003 kontribusisiplin kerja kualitas kinerja pegawai lingkungannas tenaga kerja transmigrasi propinsi jawa barat pengaruh penerapan sistem preheater bahan bakar hsd efektifitas pembakaran turbin gas ptindonesia power ubp semarang pengaruh penggunaan sumber belajar alternatif hasil belajar siswa pembelajaran konsep pencemaran lingkungan smp penyidikan tindak pidana illegal logging oleh satreskrim polres berau (study kasus penyelundupan kayu hitam ke tawao malaysia) analisis faktor-faktor mempengaruhi perilaku berkoperasi siswa (pada siswa sma /smk negeri kabupaten kuningan) faktor risiko lingkungan berpengaruh kejadian leptospirosis berat (di rumah sakit dr kariadi semarang) menyokong organisasi petani pengelolaan irigasi berorientasi operasi pemeliharaan (op) menuju berorientasi bisnis pencemaran gas ammonia dampaknya pekerja masyarakat sekitar pt pupuk kujang cikampek jawa barat pengaruh lingkungan keausan daya koefisien gesek suhu kampas rem waktu pengereman kampas rem berbahan fiberglass pengaturan penerapan corporate social responsibility perusahaan pertambangan berbentuk perseroan terbatas indonesia desain kapal ikan multi fungsi ramah lingkungan sebuah konsep wahana baru kapal ikan kawasan indonesia bagian timur pengaruh penggunaan air sungai kejadian hepatitis e (studi 5 desa endemis kabupaten bondowoso jawa timur 2000-2001) praktikum pembuatan kertas daur ulang meningkatkan pemahaman konsep siswa sma kelas 2 pembelajaran pencemaran lingkungan suatu tinjauan fungsi pengawasan mahkamah agung pelaksanaan putusan hakim telah mempunyai kekuatan hukum tetap analisa pengaruh perbedaan lokasi antara hongkong chicken rise plasa surabaya supermal pakuwon indah standardisasi menu kependudukan daya dukung lingkungan pengembangan sumber daya air das serang das tuntang-jragung (wilayah jratunseluna) kualitas sungai kalimas analisis penegakan hukum lingkungan pengaruhnya kesehatan penduduk kotamadya surabaya pemahaman masyarakat bantaran sungai ciliwung tentang sanitasi lingkungan (di kelurahan kampung melayu jakarta timur) perencanaan portofolio sistem informasi pusat pendidikan pelatihan pengawasan badan pengawasan keuangan pembangunan bogor keterkaitan perkembangan permukiman terpadu perkembangan ekonomi lokal kawasan permukiman kecamatan rungkut surabaya masa kini corak asuh kaitannya tumbuh-kembang anak sampai usia 2 tahun rscm implementasi etik penelitian menghasilkan high competitive product kajian pengembangan eco-industrial park kasus kawasan industri jababeka-bekasi multimedia interaktif belajar tentang matahari sumber energi anak-anak pengaruh kepercayaan feng shui harga rumah citraland surabaya barat perancangan pembuatan sistem e-office manajemen proyek software house teknologi adaptasi sosial suatu masyarakat desa cirimekar analisis implementasi budaya organisasi lingkungan universitas negeri jakarta analisis strategi bisnis pt kalbe farma tbk melalui aktifitas merger internal evaluasi pengelolaan lingkungan perairan waduk lahor kabupaten malang jawa timur mencermati sensemaking organisasi suatu pendekatan intelegensi organisasi partisipasi masyarakat pengelolaan sampah pemukiman kelurahan palmeriam pengaruh keberadaan pedagang kaki lima lingkungan fisik kota pekanbaru pengaruh pre heating penambahan biodiesel unjuk kerja mesinesel pola sirkulasi pencapaian pengunjung menuju komplek pesantren daarut tauhiid analisis struktur bahasa jawa kitabi serat mi'raj suatu kajian teks islam implementasi polmas oleh polsek jogoroto mengurangi tindak pidana pencurian pencegahan kejahatan eksploitasi sumber daya air oleh polres purbalingga peran apolipoprotein e timbulnya penyakit kardiovaskuler populasi jawa strategi pengembangan daya saing gas alam/lng indonesia pasar internasional bagian penera pt x tangerang upaya intervensi penerangan analisis pajanan merkuri anorgarik pekerja industri battery kering tahun 1998 interaksi keluarga remaja penderita skizofrenia tinjauan psikokultural jawa padmasan proses revitalisasi agama hindu pertengahan abad ke xx bali analisis hukum tentang akuisisi restrukturisasi perusahaan pt x analisis pemanfaatan ruang berwawasan lingkungan kawasan pesisir kota tegal korelasi antara penyebaran industri penyebaran penduduk kualitas udara pengaruh citra gerai sikap gerai kepuasan loyalitas pelanggan strategi pembangunan aceh pasca operasi militer perspektif ketahanan nasional kecelakaan keselamatan kesehatan kerja proyek pasar atum mall analisis pemanfaatan ruang berwawasan lingkungan kawasan pesisir kota tegal analisis perencanaan sumber daya aparaturnas kebersihan provinsi dki jakarta buku acara peringatan hut ke-5 fakultas ekonomi universitas indonesia september 1995 faktor resiko berhubungan kejadian dbd kota bandar lampung tahun 2002 perencanaan pengembangan sistem jaringan pipa penyaluran air buangan kawasan kuta strategi pengembangan pdam tirta musi palembang pendekatan balanced scorecard studi tentang evaluasi sistem kliring elektronik bank indonesia cabang surakarta desain instalasi pengolahan air limbah pt dua kelinci (unit morning kacang atom) kadar natrium serum pekerja terpapar panas pabrik peleburan baja pt bdj pelayanan prima kepuasan pelanggan pusat higiene perusahaan keselamatan kerja penegakan hukum penambangan pasir timah tanpa ijin oleh polres bangka tengah penegakan hukum tindak pidana pemanfaatan sumber daya air kabupaten peremajaan pemukiman rw 05 kelurahan karet tengsin jakarta pusat menjadi rumah susun talang mamak lingkungan lidupnya sistem adaptasi masyarakat peladang usulan perbaikan sistem kerja bagian packing proses pembuatan sweater pt xyz evaluasi pengembangan sistemstribusi air bersih kecamatan jebres kota surakarta kajian penggunaan pestisida endosulfan tambak udang kelurahan keputih surabaya motivasi menjadi wirausahakalangan mahasiswa fakultas ekonomi universitas brawijaya penegakan hukum penambangan batu besi tanpa ijin oleh satuan reskrim polres tanah laut pengaruh motivasi kinerja karyawan bagian produksi cv sutra utama sidoarjo peran usaha tani ternak ruminansia pembangunan/agribisnis berwawasan lingkungan perencanaan strategik balai besar pengawas obat makanan jakarta tahun 2003-2007 analisis perpindahan massa peruraian herbisida glifosat tanah tidak jenuh air dampak kebijakan perdagangan luar negeri kinerja sektor agroindustri indonesia evaluasi sistem pengenalan wicara berbasis rata metode dtw lingkungan bernois kehidupan komuniti pedagang sektor informal kelurahan kuningan timur jakarta selatan korosi baja tulangan beton industri soda penggunaan aditif pencegah korosi mencerdaskan masyarakat bidang parasitologi memperhatikan masalah lingkungan penanganan kemacetan lalu lintas jalan raya studi jalan margonda raya kota depok pengukuran kinerja biro administrasi kemahasiswaan alumni universitas kristen petra perancangan grid environment lingkungan fakultas ilmu komputer universitas indonesia perancangan media belajar melatih keterampilan motorik halus anak usia 2-3 tahun prosedur pelaksanaan pemungutan pajak hotel subnas pendapatan daerah pemerintah studi alur biodegradasi herbisida glifosat tanah oleh bakteri escherichia coli studi potensi kerjasama pemerintah swasta pengelolaan sampah kota batam analisis dampak peran pemerintah swasta menanggulangan bencana lumpur sidoarjo analisis kelayakan pengembangan usaha pembuatan produkdang perusahaan karya mekar hubungan antara penerimaanri kompetensi interpersonal remaja panti asuhan kerjasama polres karanganyarnas kehutanan penanggulangan illegal logging pembangunan aplikasi thin client menggunakan xml-rpc ironpython lingkungan net pengaruh budaya kerja efektivitas pelaksanaan tugas-tugas badan urusan logistik perencanaan pengembangan sistem penyediaan air minum ikk randudongkal kabupaten pemalang rancang bangun aplikasi context-aware mobile marketing berbasis jaringan wireless-fideli rencana strategis bagi pengembangan rumah sakit nazatra polda metro jaya tahun 1999-2002 rumah sakit khusus anak temamensi bentuk sebagai stimulan penyembuh penyakit anak analisis strategi logistik perusahaan menggunakan analytical network process (anp) migrasi sistem operasi windows 2000 server sistem operasi linux sebagai web server pembangunan tidak membangun kisah lsm tentang dampak industrialisasi dukuh tapak pembinaan kelompok sadar kamtibmas oleh babinkamtibmas kelurahan kelapa gading barat pencahayaan sebagai upaya pencegahan cekaman unggas tropis berwawasan animal welfare penempatan situs upacara masa hindu-buda kajian lingkungan fisik kabuyutan jawa barat pengaruh kebisingan lingkungan kerja gangguan pendengaran pekerja pabrik keramik perencanaan pengembangan sistem penyediaan air minum ikk randudongkal kabupaten pemalang perencanaan strategis pusat promosi kesehatan departemen kesehatan ri tahun 2003 - 2007 strategi pengembangan kawasan wisata thp kenjeran berdasarkan tingkat kepuasan pengunjung aktivitas petugas polmas polsek sukun polresta malang rangka pencegahan kejahatan optimasi kinerja jaringan jalan perkotaandasarkan atas konsep pembangunan berkelanjutan pengajaran bahasa lampung sebagai muatan lokal wilayah transmigrasi kab lampung tengah pengelolaan limbah rumah sakit pupuk kaltim bontang memenuhi baju mutu lingkungan peran kepolisian resort metropolitan jakarta barat pencegahan kenakalan anak jalanan revitalisasi kawasan bersejarah (di kawasan perdagangan lama braga bandung) algoritma rekonstruksinding atap bangunan pembuatan model bangunangital 3d analisis efektwitas kerja pegawai kantornas kebersiiian pertamanan kota denpasar detektor tingkat gas buang bensinesel udara ruangan berbasis mikrokontroler hubungan faktor lingkungan kejadian malaria kecamatan gebang kabupaten purworejo kajian korelasi tingkat kepadatan lalu lintas kota semarang konsentrasi co pb penanggulangan penambangan timah tanpa ijin oleh polres bangka selatan kecamatan toboali aspek mental tokoh utama novel nayla karya djenar maesa ayu tinjauan psikologi sastra pengaruh penambahan natrium tripolifosfat ph detergensi surfaktan hasil sublasi sistem informasi restitusi pemeliharaan kesehatan pegawai perum perumnas regional iv bandung strategi bisnis telkom rangka penciptaan kurva ke-dua (2nd curve) melalui jasa seluler hubungan kecelakaan variabel - variabel jalan lingkungan jalan bebas hambatan kepuasan pasien pelanggan jaminan non jaminan pelayanan rawat inap rs triapa pengaruh bentuk linguistikgunakan oleh kaum wanita indonesia pendidikan anak pengembangan instrumen akreditasi rumah sakit pendidikan rumah sakit fatmawati peranserta masyarakat pengelolaan kawasan condet pengembangan potensi wisata agro perilaku seksual wabal tinjau kualitas komunikasi orang tua-anak tentang seksualitas persepsi masyarakat karakter taman kota taman menteri supeno semarang proyek pembangunan pemindahan kampung stres masyarakat marunda besar jakarta utara alat penurun emisi gas buang motor mobil motor tempel mesin pembakaran tak bergerak kajian kecelakaan kerja bagian produksi departemen tambang pt x bogor jawa barat tahun 2003 pemodelan gas buang kendaraan bermotor berbahan bakar solar pendekatan regresi logistik pengaruh pemberitaan media penyebaran penyakit menular model epidemik tipe sirs sikap perilaku masyarakat baterai kering bekas (kasus enam lokasi dki jakarta) evaluasi pelaksanaan klinik sanitasi beberapa puskesmas kabupaten pandeglang tahun 2004 kajian eksperimen biodiesel sebagai bahan bakar alternatifbandingkan solar motoresel manajemen pembelajaran kreatif mata pelajaran sains fisika smp negeri 3 kartasura pengukuran perubahan potensial membran sel akar jagung sebagai indikator tingkat pencemaran air perencanaan strategis pengembangan departemen gawat darurat rspad gatot subroto tahun 2002-2004 satuan samapta polres nganjuk mencegah kejahatan pencurian kayu jati kabupaten nganjuk usulan peningkatan pengendalian kualitas produk gitar allegro usaha kecil menengah allegro bayesian semiparametrik analisis reliabilitas (optimasi tingkat keausan pahat) namika lingkungan sosial otonomi ibu hamil pemeliharaan kesehatan pedesaan malang manajemen pemeliharaan perawatan gedung rumah sakit umum daerah dr soeroto kabupaten ngawi peningkatan kualitas pendekatan lean sigma green company (fancy paper ptx) prototype penggunaan thermokopel sebagai alat pengukur energi listrik (kwh-meter) thermokonventer energi matahari sumber energi alternatif effisien handal ramah lingkungan indonesia pembangunan berkelanjutanlihat aspek hidrologi bumi serpong damai tangerang pembuatan perangkat lunak mengimplemantasikan hierarchical bounding volume ray tracing pengaruh kondisi stres kerja kinerja karyawan bagian produksi pt surya raya nusatama pengaruh unsur-unsur kimia korosif laju korosi tulangan beton ii lumpur rawa analisis strategi bisnis ekspor kopi indonesia ke pasar eropa pt putrabali adyamulia beberapa permasalahan pertanggungjawaban pidana pres suatu telaah menurut hukum positif indonesia interaksi komponen sistem usahtani tanaman-ternak ekosistem datara tinggi jawa barat makanan sesaji upacara pemujaan leluhur orang tionghoa penganut agama khonghucu cimanggis penerapan proses hirarki analisis pembuatan keputusan investasi jalan tol kota bandung pengaruh sanitasi lingkungan kejadianare balita propinsi jawa barat tahun 2005 rancangan program pelatihan ketangguhan (resilience) bagi petugas lapas anak pria (lpan) tangerang respons perusahaan pma/pmdn lingkungan usaha indonesia 1997-2001 suatu tinjauan makro analisis runtun waktu bivariat metode box-jenkins pemodelan vma (vector moving average) kajian kualitas kali surabayatinjau darl aspek lingkungan peraturan perundangan kelembagaan keberadaan taman lalu lintas polres madiun meningkatkansiplin masyarakat berlalu lintas respon risiko kinerja mutu penataan kawasan permukiman kumuh provinsi dki jakarta analisa perbandingan kinerja mesin pendingin menggunakan r12 sebelum sesudah proses recycle customer relationship managemen strategi peningkatan brand produk melalui periklanan media televisi hubungan bahan pencemar cd air sumurgkal biomarker penduduk daerah jakarta lingkungan perumahan massal (rumah susun tanah abang kebon kacang jakarta pusat) penempatan benda-benda megalitik kawasan lembah iyang-ijen kabupaten bondowoso jember jawa timur pengembangan database tugas belajar sumber daya manusia kesehatan lingkungan departemen kesehatan analisa produktivitas karyawan memiliki kebiasaan merokok f and b service resto nine surabaya evaluasi programklat aparatur model transfer of training kabupaten kepulauan riau(2002) hubungan pelatihan lingkungan kerja kinerja karyawan front office novotel nusa dua bali kehidupan pedagang warung pelacur jalan tegal rotan kecamatan pondok aren kabupaten tanggerang pengaruh faktor situasional struktur organisasivisional pt telekomunikasi indonesia pelaksanaan konsolidasi tanah secara swadaya desa watuagung kecamatan baturetno kabupaten wonogiri pengaruh genangan banjir akibat pasang air laut kondisi lingkungan permukiman bandarharjo pengaruh lingkungan sosial keputusan menjadi nasabah tabungan bri unit pajajaran bandung pengaruh temperatur lingkungan peran biosecurity pakan upaya menjamin keamanan produk ternak peranan bunga matahari (helianthus anuus) proses fitoremediasi tanah tercemar logam kromium perubahan bentuk rumah tata lingkungan pemukiman nelayan desa ujung alang segara anakan cilacap polisi siskamling lingkungan pemukiman kelurahan kebagusan kecamatan pasar minggu sifat listrik pengaruh annealing kontak ohmik logam perak film tipis galium antimoni beberapa faktor berhubungan kejadian campak wilayah puskesmas mlonggo i kabupaten jepara evaluasi strategi pelayanan unggulan kesehatan ibu anak rumah sakit bhakti yudha tahun 1998-2002 identifikasi bakteri patogen limbah cair instalasi pengolah air limbah rsud drmoewardi surakarta kemungkinan penerapan co-management pengelolaan ruang terbuka hijau pantai utara kota surabaya peranan anggaran program kemitraan bina lingkungan (pkbl) mengendalikan anggaran operasional pkbl perencanaan pelaksanaan rangka kegiatan pembinaan narapidana lembaga pemasyarakatan purwakarta perubahan bentuk rumah tata lingkungan pemukiman nelayan desa ujung alang segara anakan cilacap analisis persepsi petugas medis/paramedis klinik sanitasi puskesmas wilayah kabupaten tegal analisis strategi lembaga antariksa penerbangan nasional bisnis produk penginderaan jarak jauh evaluasi kinerja penggunaan pipa high strength low alloy steel (hsla steel) korosi retak tegang pencegahan tindak pidana penambangan pasir tanpa izin sungai ciapus kabupaten bogor oleh polres bogor pengaruh kompensasi motivasi lingkungan kerja kinerja gtt sma negeri kabupaten klaten pengaruh kualitas layanan kepuasan pelanggan restoran sari utama jember melalui metode servqual potensi perkembangan wilayah pengelolaan kawasan resapan air propinsi daerah istimewa yogyakarta potensi sumberdaya alam gunungapi merapi pengelolaannya mendukung kehidupan masyarakat sekitar strategi pemasaran produk rotan menghadapi era pasar bebas (pada pt tanamas industry) aspek kepribadian tokoh utama novel bahumu kubagi dukaku karya mira w tinjauan psikologi sastra berbagai faktor mempengaruhi pengelolaan limbah kecamatan setiabudi jakarta selatan inflamasi plasenta sebagai faktor ikterogenik neonatal inkompatibilitas golongan darah abo ibu-janin koordinasi polres tim terpadu daerah menanggulangi peti batubara kabupaten kutai kertanegara model pengembangan sistem bimbingan koseling fungsional lingkungan perguruan tinggi indonesia pengaruh ekstrak biji kapas (gossyplum hirsutum l) mortalitas larva spodoptera litura fabricius pengaruh lingkungan penerangan suasana ruang ruang kantor (gedung graha pena) peranan dakwah pembentukan kepribadian muslim majelis taklim tarbiyatul mu'awanah perencanaan pengembangan ruang optimum berdayadukung berkelanjutan perkotaan pesisir teluk banten perencanaan pondasi mesin bullet transfer press pt pindad malang metode lumped parameter system persepsi pegawai mengenai pengembangan karir sekretariat jendral kepanitiaan mahkamah konstitusi rekonstruksi el nino southern oscillation (enso) melalui pengkajian geokimia organik sedimen laut arafura faktor-faktor berhubungan terjadinya stress lansia panti wredha dharma bakti surakarta pengaruh kompensasi finansial nonfinansial kinerja karyawan cabang utama bank x surabaya pengaruh pt pupuk kujang pola hidup masyarakat desa dawuan kecamatan cikampek kabupaten karawang clostridium botulinum produk bahan panganolah panas (studi produk ikan kalengan) dampak industri kerajinan bata merah kondisi lingkungan kecamatan cireunghas kabupaten sukabumi faktor-faktor lingkungan perilaku berhubungan kejadian filariasis kabupaten bangka barat klasifikasi obyek menggunakan mahalanobis-taguchi system analisis regresi ridge logistik/probit ordinal penentuan kriteria paling berpengaruh prestasi kerja karyawan cv rimba sentosa sukoharjo pengaruh lebar kanal pelat sejajar perpindahan panas kondensor tipe serpentine konveksi bebas perancangan sistem life cycle komponen produk baterai dry cell kajian penerapan sustainable manufacturing standardisasi parameter pengukuran kinerja set-top box dvb-t implementasi tvgital indonesia analisis faktor-faktor mempengaruhi orientasi relationship jangka panjang (pada cv garuda) analisis tentang iklim organisasi kepemimpinan kepuasan kerja pegawai lingkungan sekretariat negara faktor-faktor strategik pemerolehan bahasa anak tunarungu (slb b karnnamanohara yogyakarta) optimasi kebutuhan lumpur aktif proses pengolahan limbah cair sentra industri tahu ngudi lestari pemberdayaan desa adat sanur penataan kawasan pantai matahari terbit kaitannya pariwisata penegakan hukum penambangan emas tanpa izin oleh satuan reskrim polres tebo kabupaten tebo jambi peran satuan intelkam poltabes subang upaya penanggulangan illegal logging wilayah kabupaten subang simulasi studi aliran daya sistem penyampaian listrik aliran atas kereta rel listrik jabotabek pspice tingkat pembelajaran rangka membangun organisasi pembelajaran cv nuri teknik kabupaten cianjur analisis hasil belajar siswa sma kelas x topik hujan asam melalui model sains teknologi masyarakat (stm) analisis manajemen lingkungan kejadian malaria kecamatan biak timur kabupaten biak - numfor papua analisis pembangunan pltu lombok baru 2 x 25 mw kaitannya krisis energi listrik nusa tenggara barat batas pelepasan (bp) tiap zat radioaktif ke atmosfir tiap instalasi nuklir batan serpong jawa barat cellullar automata pemodelan implementasi paralel simulasi arus lalulintas kendaraan jalan raya faktor-faktor berhubungan peningkatan kinerja pegawai sekretariat walikotamadya jakarta barat kajian manfaat biaya pengolahan sampah terpadu skala kawasan (tps rawa kerbau jakarta pusat) konsep eko efisiensi pemanfaatan keluaran bukan produk klaster industri mebel kayu bulakan sukoharjo masalah hukum bidang bioteknologi keamanan hayati produk pertanian hasil rekayasa genetik indonesia model pengelolaan kawasan resapan air hujan wilayah yogyakarta utara berdasarkan variasi kapasitas infiltrasi pemanfaatan mikroba kitinolitik sebagai agens hayati pengendalian nematoda puru-akar tanaman tomat penegakan hukum pencemaran laut wilayah pesisir laut kota balikpapan oleh polresta balikpapan peranan humas pt pindad (persero) bandung meningkatkan pelayanan kunjungan mahasiswa ke perusahaan persepsi masyarakat kejadian pencemaran udara (kecamatan palimanan cirebon jawa barat) daur ulang limbaht perekat kayu lapis sebagai bahan pengisi pt lakosta indah samarinda) evaluasi pengembangan sistem penyediaan air minum pdam kabupaten banyumas daerah pelayanan kota purwokerto gambaran tingkat kesegaran jasmani karyawan puskesmas kecamatan palmerah kotamadya jakarta barat tahun 2001 hubungan pengetahuan safe sex sikap safe sex kalangan pelaut suatu studi pelaut pria pt x penentuan faktor-faktor ergonomis berpengaruh kinerja operator menggunakan metode taguchi sistem upah buruh pt pisma putra kecamatan pait kabupaten pekalongan jawa tengah perspektif hukum islam studi pengujian tak merusak galvanostatik memperkirakan laju korosi bajadalam lingkungan beton analisis faktor risiko lingkungan perilaku penduduk kejadian malaria kabupaten asmat tahun 2008 evaluasi pengembangan sistem penyediaan air minum pdam kabupaten banyumas daerah pelayanan kota purwokerto evaluasi saluran pengumpul pengaruh lindi lingkungan sekitar tpa (tempat pembuangan akhir) keputih glassfibre reinforced plastic (grp) aplikasi kelautan pengaruh lingkungan sifat mekanik fisik identifikasi etnik kolegalitas kolaborasi; studi etnisitas interaksi sosial guru sma negeri 2 bekasi optimalisasi perkembangan pengembangan potensi anak meningkatkan sumber daya manusia berkualitas pengelolaan layanan madrasah aliyah walisongo pecangaan jepara perspektif total quality management (tqm) analisis karakteristik lingkungan kejadian leptospirosis kabupaten demak provinsi jawa tengah tahun 2009 analisis spasial kasus malaria kelurahan paya seunara kecamatan sukakarya kota sabang provinsi nad tahun 2008 entomopathogenitas metarrhizium anisopliae mortalitas periplaneta americana l (orthoptera blattidae) gambaran pengetahuan sikap perilaku merokok staf administrasi pria universitas indonesia tahun 2009 identifikasi pemeriksaan jumlah total bakteri susu sapi segar koperasi unit desa kabupaten boyolali manajemen sekuriti fisik bsp (bekapai senipah peciko) terminal total e&p indonesie senipah kalimantan timur pemberdayaan pengusaha kecil melalui bantuan kredit pendamping (kasus peserta proyek p4k kabupaten bogor) pengaruh ph pertumbuhan bakteri ikan mas (cyprinus carpio) penelitian eksperimental laboratorik strategi kompetisi bisnis interkoneksi layanan transt era interkoneksi cost based pt telkom tbk analisis spasial kasus malaria kelurahan paya seunara kecamatan sukakarya kota sabang provinsi nad tahun 2008 biomassa produktivitas fitoplankton perairan teluk jakarta serta kaitannya faktor-faktor lingkungan hubungan antara konsentrasi detergen kematian benih ikan lele dumbo (clarias gariepinus) hubungan antara persepsi mutu pelayanan pengobatan kepuasan pasien balai kesehatan karyawan rokok kudus hubungan kualitas udara ruangan `sick building syndrome' pekerja wanita mal blok-m jakarta pendekatan fuzzy goal programming alokasi pembuangan akhirnas kebersihan pertamanan kota surabaya penegakan hukum penambangan zirkon tanpa ijin desa tangar kecamatan mentaya hulu kabupaten kota waringin timur penerapan metodeskusi meningkatkan aktivitas belajar geografi siswa kelas viiia smpn 8 pamekasan luluk peran community worker perumahan lingkungan kumuh (di kota pontianak propinsi kalimantan barat permukiman tepi sungai kota palembang studi bentuk permukimantata letak tata guna ruang serta lingkungan program bimbingan perkembangan membantu kemandirian belajar siswa tunanetra tingkat dasar slbn-a bandung faktor berhubungan stres kerja tenaga kerja bagian pengantongan pt semen gresik (persero) tbk faktor-faktor berhubungan gangguan faal paru pegawai kasir delapan kantor bank indonesia tahun 2001 faktor-faktor mempengaruhi minat mahasiswa mengikuti programploma 1 (d1) universitas brawijaya malang pemantauan kualitas makanan ketoprak gado-gado lingkungan kampus ui depok melalui pemeriksaan bakteriologis pendekatan lingkungan penanggulangan penyakit demam tifoidsuatu kajian bidang epidemiologi lingkungan pengalaman keluarga merawat lansia demensia desa keloloan kelurahan gawanan kecamatan karanganyar pengaruh antara pemberian pelatihan pemberian kompensasi motivasi kerja karyawan the westin surabaya analisis pembangunan pltu batubara bangka baru 2x25 mw percepatan pemenuhan kebutuhan listrik pulau bangka kebudayaan birokrasi kebijakan pengelolaan hutan kajian perbandingan provinsi lampung kalimantan timur kejahatan kekayaan alam mengakibatkan rusaknya daya tampung airwilayah tanjung priok jakarta utara non-dirt house floor and the stimulant of environmental health decreased the risk acute respiratory infection (ari) pengaruh budaya daerah organisasi pemerintahan (kasus pemerintah daerah kabupaten solok sumatera barat) pengaruh perubahan perkembangan lingkungan aspek pemasaran eksistensi kawasan industri pulo gadung pengaruh pola pertunbijhan pedagang kaki lima (pkl) perencanaan lingkungan kawasan wang lima semarang peranan babinkamtibmas pencegahan penambangan pasir tanpa ijin wilayah hukum polsek ngoro polres mojokerto preferensi konsumen perumahan kondisi fisik ketersediaan infrastruktur wilayah kecamatan gunungpati prototipe sistem pendukung keputusan basis pengetahuan pengembangan produk kartu kredit bni mastercard analisa pengaruh pengurangan karyawan motivasi produktivitas karyawan bull's eye restaurant surabaya analisa strategi manajemen pengusahaan pertambangan mineral pelaksanaan otonomi daerah kabupaten musi rawas analisis kebijakan pengendalian pencemaran sungai siakkaitkan pelaksanaan otonomi daerah kabupaten siak analisis pengaruh persepsi mutu pelayanan rawat inap minat pemanfaatan ulang rsud kab brebes tahun 2008 asuhan keperawatan tnk gangguan persepsi sensori halusinasi pendengaran ruang amarta rsjd surakarta evaluasi kebijakan jalur hijau permukiman sungai code ledok ratmakan ledok gondolayu yogyakarta hubungan antara kadar debu total kapasitas vital paksa paru pedagang tetap terminal terboyo semarang pengaruh aksesbilitas lingkungan terdekat kawasan sentra primer baru timur harga tanah sekitarnya pengetahuan penjamah makanan tentang praktek hygiene sanitasi makanan kantin lingkungan kampus ui depok studi penetrasi ion klorida beton menggunakan metode percepatan meninjau faktor air semen umur beton upaya penanggungan kepadatan hunian (over capacity rumah tahanan negara lembaga pemasyarakatan dki jakarta beberapa faktor berhubungan kepuasan kerja perawat puskesmas rawat inap kabupaten banyumas tahun 2000 iklim pembelajaran matematika bilingual sekolah dasar berstandar internasional kelas iv sdii al-abidin surakarta kajian perencanaan pengajaran mata pelajaran kepedulianri lingkungan (kpdl) tingkat sd kota semarang penerapan learning organizationrektorat jenderal perlindungan hak asasi manusia departemen kehakiman ham pengaruh gas buangan paru-paru pengemudi kendaraan bermotor penumpang umum mesin bawah ruang duduk pengaruh program akselerasi minat belajar siswa madrasah tsanawiyah (mts) ppmi assalaam sukoharjo tahun 2008 peran satuan brimob daerah riau penanggulangan tindak pidana illegal logging wilayah hukum polsek bukit batu persepsi masyarakat fungsi ekologis buperta sebagai hutan kota (pada autan kota buperta cibubur) studi penetrasi ion klorida beton menggunakan metode percepatan meninjau faktor air semen kadar semen studi teknis pengoperasianesel genset (pltd) 3000 kva pt kayan river indah plywood sumber mas group samarinda peranan sistem informasi akuntansi persediaan terkomputerisasi koperasi wanita setia bhakti wanita surabaya studi pola ruang terbuka hijau lingkungan perumahan semarang lingkungan perumahan graha taman bunga bsb analisis perbaikan produktivitas menggunakan metode hoshin kanri (ptdjitoe itc surakarta) ajukan beberapa faktor berhubungan kepuasan pasien rawat inap rsud sunan kalijaga kabupaten demak tahun 2002 beberapa faktor berhubungan produktivitas kerja tenaga sanitasi puskesmas kabupaten magelang tahun 2000 identifikasi kemampuan berfikir kreatif siswa smkn i cimahi praktikum programklat teknik pengendali elektronika model perumahan permukiman daerah rawan banjir (desa bulutigo kecamatan laren kabupaten lamongan) pembangunan aplikasi skala prioritas usulan kegiatannas tata ruang permukiman (distarkim) propinsi jawa barat pengaruh pendidikan madrasahniyah awaliyah sikap beragama siswa madrasahniyah awaliyah syarif tahun 2008 perumusan rencana pembangunan jangka menengah daerah pendekatan pemasaran wilayah kabupaten lamongan proses penyusunan rencana tata ruang menjaga kelestarian fungsi lingkungan hidup wilayah propinsi jawa tengah standar penggunaan sistem sidik jari konvensional satuan reserse kriminal kepolisian kota besar bandar lampung analisis penurunan fungsi pendengaran akibat pajanan bising karyawan area finishing dyeing ptcoats rejo bogor analisis potensi minimisasi limbaht domestik instalasi gizi tata boga rumah sakit kanker dharmais tahun 2009 dampak industrialisasi kehidupan sosial ekonomi penduduk kecamatan karawang kabupaten karawang tahun 1997-2005 efektivitas ekstrak etanol daun rambutan (nephelium lappaceum l) kematian larva nyamuk aedes aegypti instar iii ekskresi kadmium urine komunitas terpajan kadmium air minum 12 kelurahan dki jakarta tahun 1997 faktor risikoare bayi balita indonesia systematic review penelitian akademik bidang kesehatan masyarakat faktor-faktor penyebab terjadinya perkelahian rumah tahanan negara rumah tahanan negara jakarta timur kajian pengelolaan lingkungan kawasan gunung sindoro sumbing (di desa sigedang desa butuh wonosobo) penerapan rkl rpl industri semen (pt semen gresik persero (tbk) pabrik tuban i ii iii jawa-timur) pengembangan model produktivitas kerja menggunakan faktor-faktor ergonomi pengolahan tanah pertama areal padi sawah penilaian terpadu dampak tumpahan minyak perairan balikpapan tumpahan sludge oil kapal mt panos g peranan guru penanggulangan penyalahgunaan napza lingkungan sekolah (pada sman jakarta selatan) perencanaan perancangan arsitektur (ppa) pusat informasi penelitian pengambangan pengolahan sampah surakarta perkembangan psikologi siswa sma ppmi assalaam pabelan sukoharjo tahun 2007 (mengenai hambatan perkembangan) tipologi kejahatan perkotaan daerah lingkungan permukiman real estate kodia semarang (di kodia semarang) analisis hubungan kondisi lingkungan rumah perilaku keluarga kejadian serangan asma anak kota semarang 2005 faktor-faktor mempengaruhi kejadian tb paru bta (+) penghuni rumah kebun kabupaten bengkulu utara tahun 2004 hubungan antara pengembangan lingkungan fisik kualitas hidup (kasus kampung sekitar kawasan pt sier surabaya) hubungan jarak penangkaran walet faktor risiko lainnya kejadian demam berdarah dengue kota medan tahun 2003 optimasi volume tetes kadar deterjen ekstraksi tetes mikro penentuan-(2-etilheksil) ftalat hplc pengaruh pembelajaran kooperatif tipe jigsaw hasil belajar siswa materi pokok pengelolaan lingkungan smp produksi puyer primer bacillus thuringiensis subsp israelensis memanfaatkan darah sapi melase terasi garam mineral studi komparatif pola morfologi kota gresik kota demak sebagai kota perdagangan kota pusat penyebaran agama islam beberapa faktor berhubungan tingkat kepuasan pasien rawat inap rumah sakit umum muhammadiyah roemani semarang hubungan faktor lingkungan kejadianare balita wilayah kerja puskesmas pondok gede kota bekasi tahun 2003 komputerisasi pengelolaan surat masuk surat keluar lingkungan ptperhutani (persero) unit iii jawa barat banten pola pendidikan kepribadian perspektif al qur'an studi hermeneutik surat al kahfi ayat 60-82 tentang khidir-musa as studi deskriptif kejadian kecelakaan kerja pt palur raya karanganyar bulan januari 2002 sampai bulan oktober 2002 dampak tempat pengumpulan sampah sementara (tps) tingkat kepadatan lalat rumah terdekat kota banjarnegara faktor-faktor mempengaruhi persatuan penyandang cacat indonesia (ppci) memperjuangkan hak asasi penyandang cacat initiallution ocean outfall tipe buoyant jet variasi sudut port kecepatan effluent lingkungan berarus kebijakan luar negeri amerika serikat konflik israel-palestina pasca 11 september 2001 (masa presiden george w bush) mekanisme penyidikan tindak pidana illlegal logging oleh sat reskrim polres bulungan (pt bagong putera serasi) prevalensi gangguan paru analisis faktor-faktor berhubungan tenaga kerja laki-laki pabrik keramik cikarang strategi adaptasi petani menghadapi musim kemarau(studi tentang adaptasi petani kecamatan jombang kelurahan tunggorono) analisis faktor-faktor pola asuh gizi ibu status gizi anak umur 0-36 bulan puskesmas wonosalam ii kabupaten demaknamika interaksi antara pemerintah lokal masyarakat sipil sektor privat kasus pencemaran air kali surabaya kajian risiko kesehatan lingkungan akibat pencemaran udara hidrogen sulfida semburan lumpur panas sidoarjo kepemimpinan abah junan komuniti islam desa kelapa dua kabupaten tanggerang jawa barat; sebuah sosok kiyai modern biopestisida berbahan aktif mikroba kitinolitik mengendalikan nematoda parasit (pratylenchus coffeae) tanaman kopi dunia orang sawu satu lukisan analitis tentang azas-azas penataan kebudayaan orang mahara sawu nusa tenggara timur evaluasi pelaksanaan pendidikan lingkungan hidup ppg lingkup kejuruan (di pppg teknologi malang bandung) faktor-faktor berpengaruh penyerahan prasarana sarana lingkungan perumahan oleh pengembang kabupaten sleman foto pemandangan gunung tangkuban parahu sebagai poster (aplikasi fotografi alam gunung tangkuban parahu sebagai poster umum) pendekatan interaksi sosial faktor mempengaruhi efektivitasnya penanggulangan illegal mining oleh polres bungo pengaruh perubahan bahan baku industri pulp kertas lingkungan pt kertas bekasi teguh bekasi jawa barat pengaturan izin usaha perikanan sebagai usaha pelestarian lingkungan hidup wilayaii perairan propinsi dati ii jawa tengah pengembangan sistem informasi penyehatan lingkungan pemukiman mendukung perencanaannas kesehatan kabupaten tegal pola-pola tindakan penyidik polri proses pemeriksaan tersangka pencurian kekerasan polda metro jaya hubungan pola kepribadian lingkungan kerja kepuasan kerja para manager bumn (suatu studi penerapan teori holland) kajian tentang penerapan safety management menekan resiko kecelakaan unit bisnis pertambangan emas pongkor jawa barat pengaruh kepemimpinan atasan motivasi kerja pegawai kreativitas kerja pegawainas sosial propinsi jawa timur studi deskriptif tentang peranan orang tua memfasilitasi penyesuaian anak kelompok bermain uptd skb kota bandung the influence of american black liberation to the major characters attitude changes in ernest j gaines a lesson before dying tradisi mondosiyo perspektif pendidikan tradisi bersih desa mondosiyo desa pancot kalisoro tawangmangu pengaruh ph penambahan amonium hidroksida elektrodekolorisasi metanil yellow menggunakan elektroda karbon besi kajian tempat pembuangan akhir (tpa) sampan pendekatan ekonomi lingkungan (studi eases tpa sampalijatibarang - semarang) pemanfaatan sarana komunal pembuangan tinja lingkungan permukimant (tinjauan mck kelurahan petamburan jakarta pusat) resiliensi remaja high risktinjau faktor protektif studi kelurahan tanah tinggi kecamatan johar baru jakarta pusat revitalisasi sumberdaya manusia lingkungan badan usaha milik daerah (bumd) dki jakarta menghadapi era perdagangan bebas uji pembuatan biogas kotoran gajah variasi penambahan urine gajah air (taman wisata candi borobudur) faktor-faktor mempengaruhi keinginan konsumen menabung bank syariah (pada bank syariah surakarta) implementasi pengungkapan kasus illegal loggig oleh penyidik satuan reskrim rangka penegakan hukum wilayah polres kampar kajian partisipasi masyarakat program penataan lingkungan permukiman kumuh kelurahan rejowinangun selatan kota magelang karakteristik pekerja faktor lingkungan kejadian kecelakaan kerja bagian produksi perusahaan ptayah makmur gombong market-led development pengaruhnya risiko ekologis negara dunia ketiga kasus teluk buyat indonesia (1986-2006) model fasilitasi pembelajaran orang tua meningkatkan kemampuan keterampilan berbahasa anak tunarungu lingkungan keluarga pengaruh kompensasi lingkungan kerja produktivitas kerja karyawan bagian produksi cv aneka ilmu semarang kajian pengelolaan lingkungan kawasan gunung sindoro sumbing (di desa sigedang desa butuh kabupaten wonosobo) kajian perencanaan strategi pemasaran jasa telepon bergerak selular generasi ke-3 teknologi akses cdma 2000 1x indonesia pemanfaatan limbah fly ash sebagai bahan campuran paving block mengurangi tingkat pencemaran lingkungan logam berat pb pengaruh jenis proses las salinitas sifat mekanik weld joint material baja underwater welding lingkungan laut pengaruh keberadaan bukit semarang baru kondisi sosial- ekonomi - fisik sekitarnya berdasarkan persepsi masyarakat lokal pengaruh kebisingan kegiatan bandar udara masyarakat pemukim sekitar bandar udara internasional jakarta soekarno-hatta pengaruh lingkungan toko (in-store environment) niat pembelian ulang konsumen giant supermarket wiyung surabaya penurunan fosfat penambahan kapur (lime) tawas filtrasi zeolit limbah cair (rs bethesda yogyakarta) survey penurunan kemampuan pendengaran karena kepaparan rising pt (persero) angkasa pura ii bandara soekarno- hatta tahun 2004 analisis faktor-faktor pelayanan mempengaruhi bed occupancy rate (bor) unit stroke center rs islam jakarta (tahun 2000 -2003) analisis faktor-faktor mempengaruhi kinerja pelayanan air minum perusahaan daerah air minum daerah khusus ibukota jakartastribusi risiko kesehatan logam merkuri lokasi pertambangan emas kabupaten minahasa selatan provinsi sulawesi utara tahun 2004 identifikasi kesulitan penerapan pendekatan sains teknologi masyarakat (stm) sub konsep lingkungan sub konsep sistem saraf pemimpin perempuan lingkungan pemerintahan organisasi pemerintahan pemerintah daerah propinsi dki jakarta peran serta masyarakat pengelolaan kualitas air pencemaran air sungai enim kabupaten muara enim sumatera selatan risiko infeksi dengue anak terkait faktor lingkungan wilayah puskesmas pandanaran karangayu bandarharjo kota semarang analiasis spasial sebaran kasus tuberkulosis parutinjau faktor lingkungan fisik luar rumah kabupaten pekalongan hubungan tingkat stres orang tua perilaku kekerasan verbal anak kelurahan jabungan kecamatan banyumanik kota semarang pengetahuan ibu rumah tangga mengenai vektor demam berdarah dengue faktor-faktor berhubungan paseban barat jakarta pusat sebaran kelimpahan foraminifera bentik serta catatan pertama tentang foraminifera agglutinin delta solo porong-jawa timur studi perbedaan stres kerja antara guru sd x guru sdlb y semarang menggunakan analisis ghq (general health questionnaire) faktor-faktor lingkungan kerja berhubungan frekuensi denyut nadi tenaga kerja bagian weaving ptiskandartex surakarta hubungan kepemimpinan lingkungan kerja serta pendidikan latihan semangat kerja pegawai setda propinsi jawa tengah kajian pengaruh keberadaan pelabuhan tanjung emas lingkungan masyarakat( kelurahan bandarharjo tanjungmas) pembuatan midlet handphone pengenalan wajah menggunakan metode principle component analysis hidden markov model peransain interior usaha mencapai efisiensi peningkatan produktivitas kerja perkantoran sistem otomasi indonesia strategi pengelolaan sampah permukiman deng an pola pendekatan karakteristik kawasan (kecamatan cakraneg ra kota mataram) namika populasi ikan lemuru sardinella lemuru bleeker 1853 (pisces clupeidae) perairan selat bali alternatif pengelolaannya kajian pencahayaan industri kecil pakaian jadi pembuatan tas perkampungan industri kecil penggilingan jakarta tahun 2008 kemungkinan pemanfaatan limbah industri perkayuan sebagai energi alternatif melalui gasifikasitinjauan minat pengusaha perkayuan pemilihan optimasi metode konstruksi bottom- up pembangunan basement bangunan bertingkat jakarta berbasis expert knowledge pengaruh strategi green marketing pilihan konsumen melalui pendekatan marketing mix (pada the body shop jakarta) pola komunikasi pt sarinah (persero) beradaptasi menempatkanri lingkungan (studi sarinah department store) rancangan program pelatihan petugas sebagai fasilitator meningkatkan ketangguhan remaja (anakdik) rutan kebon waru bandung studi tentang perbedaan kapasitas vital paksa paru lingkungan penggilingandan penambangan batu wilayah mangkang kotamadya semarang analisis pengaruh jenis tempo musik beban kerja mental pria wanita (mahasiswa teknik industri undip) bentuk-bentuk penggunaan senjata api oleh penyidik penyidik pembantu unit resmob polda metro jaya kejahatan kampak merah dampak penerapan kebijakan konversi hutan kerusakan lingkungan (pelepasan kawasan hutan perkebunan kelapa sawit) hubungan faktor lingkungn fisik rumah kejadian tuberkulosis paru bta positif kota batam propinsi kepulauan riau tahun 2005 identifikasi drug related problems (drps) pasien demam tifoid instalasi rawat inap rumah sakit umum daerah wonogiri tahun 2007 interferensi bahasa jawa karangan narasi berbahasa indonesia siswa kelas viii smp negeri 2 sawit boyolali tahun ajaran 2009/2010 pemilihan merk deterjen melalui pemposisiannya berdasarkan tingkat keputihan konsentrasi kandungan zat pencemar serta ke-ekonomisannya pengaruh perceived environwient uncertainty (pew hubungan antara karakterist1k sasaran penganggaran kinerja manajer1al peran tempat perindukan nyamuk kejadian malaria falsiparum kota pangkalpinang propinsi kepulauan bangka belitung tahun 2006 faktor-faktor mempengaruhi kualitas hidup petani ppkr kecamatan rambang lubai kabupaten muara enim sumatera selatan implementasi perpolisian masyarakat (polmas) mengurangi intensitas penambangan pasir ilegal kecamatan ngoro kabupaten mojokerto persepsi kepala ruang implementasi model praktik keperawatan profesional rumah sakit jiwa daerah dr amino gondohutomo semarang stres penyelam bekerja eksplorasi produksi minyak gas bumi lepas pantai serta pengaruhnya kesehatan mental struktur komunitas sebaran spasial bivalvia hubungannya karakteristik lingkungan teluk kotania seram karat maluku tengah hubungan kebersihan perorangan kejadian sakit leptospirosis kejadian luar biasa (klb) leptospirosis dki jakarta tahun 2002 identifikasi evaluasi sistem penyimpanan amoniak upaya pencegahan pencemaran lingkungan (di pt pupuk kaltim tbk) penerapan metodologi information economics mengukur nilai ekonomis implementasi sistem informasi geografisvisi komplek pertamina peranrektorat reskrim polda bali penegakan hukum tindak pidana pemeliharaan satwa liarlindungi denpasar bali perancangan sistem pengukuran kinerja metode performance prism(di hotel arini jl brigjen slamet riyadi no 361 solo) studi analisis pembangunan pltu batu bara mulut tambang 2 x 65 mw menunjang beban dasar sistem ketenagalistrikan kalimantan selatan analisis pemetaan kompetensi penilaian kebutuhan pendidikan pelatihan pejabat eselon iii lingkungan lembaga administrasi negaranamika penularan faktor-faktor berhubungan kejadian malaria kecamatan dusun hilir kabupaten barito selatan tahun 2004 faktor-faktor mempengaruhi efektivitas pengawasan suatu kajian pengawasan lingkungan inspektorat jenderal departemen negeri keberadaan pesantren darul hikam kiangreko transformasi nilai (menilik mutu pribadi ajengan hakekat pendidikan ips pesantren) model pengelolaan sungai cisadane intervensi kebijakan pengendalian limbah cair industri domestik kota tangerang penataan ruang terbuka hijau kota surabaya (studi analisis hukum kebijakan publik tentang pengelolaan tata ruang kota surabaya) pengaruh iklim organisasi kreativitas kerja karyawan (studi deskriptif karyawan pt edward forrer bandung-tahun 2007) pengaruh kompensasi pendidikan senioritas produktivitas kerja lingkungannas kebersihan pertamanan kota surakarta strategi peningkatan daya saing matahari department store menghadapi era globalisasi pt matahari putra primatbk faktor lingkungan berhubungan kejadian sick building syndrome (sbs) pusat laboratorium forensik uji balistik mabes polri faktor-faktor mempengaruhi kesadaran masyarakat program berseri (kotamadya daerah tingkat ii surakarta jawa tengah) gambaran kesehatan lingkungan faktor risiko kejadian infeksi nosokomial pneumonia ruang icu rsup fatmawati jakarta tahun 2003 - 2004 hubungan faktor karakteristik ibu rumah tangga praktek kesehatan lingkungan kelurahan bandung kecamatan tegal selatan tahun 2003 mengintegrasikan aspek lingkungan kebijakan lalu lintas perkotaan kota denpasar (parameter co sebagai indikator pencemar udara) penegakan hukum tindak pidana eksploitasi sumber daya air (air bawah tanah) kota semarang oleh sat reskrim polwiltabes semarang perbandingan tingkat berpikir kreatif berdasarkan gender praktikum pencemaran lingkungan menggunakan pembelajaran modifikasi cups perilaku pertuturan anak usia 2-5 tahun berbahasa ibu bahasa indonesia (sebuah studi deskriptif tentang jenis-jenis tindak tutur anak) strategi produksi bersih meningkatkan manajemen lingkungan industri skala kecil industri kerajinan batik k solo analisis keberadaan jalan lingkar perubahan peruntukan lahan (stud! kasus sepanjang jalan lingkar kaliwungu) kabupaten kendal hubungan kondisi lingkungan partisipasi masyarakat pengendalian demam berdarah (di kota pontianak kalimantan barat) hubungan lama pemaparan debu kapur tulis kapasitas fungsi paru (fvc fev1 guru sltp negeri i grobogan jawa tengah bulan juni 2001 kajian negosiasi makna siswa pembelajaran kooperatif think-pair-square menggunakan modul berprograma konsep pencemaran lingkungan pengaruh sikap tentang kebersihanri timbulnya skabies (gudik) santriwati pondok pesantren al-muayyad surakarta skripsi perbedaan em-4 starbio menurunkan kadar tss tds limbah cair batik brotojoyo desa pilang kecamatan masaran kabupaten sragen studi faktor lingkungan rumah perilaku masyarakat berhubungan kejadian malaria kecamatan agats kabupaten asmat papua 2009 televisi pergeseran konsep seks normatif pengaruh tayangan pornomedia televisi agama sikap seks mahasiswa s1 kota surabaya tinjauan pelaksanaan program pemugaran perumahan lingkungan desa secara terpadu (p2ldt) desa kurung kecamatan ceper kabupaten klaten analisa pengaruh kecepatan effluent perubahan sudut port initiallution ocean outfall jenis buoyant jet lingkungan bergelombang analisis pengendalian emisi kendaraan bermotor dki jakarta penerapan keputusan menteri lingkungan hidup no141 tahun 2003 analisis sistem informasi penempatan apoteker pelaksanaan wajib kerja sarjana lingkungan badan pengawas obat makanan (badan pom) beberapa faktor berhubungan praktek penggunaan pestisida secara tepat aman desa campur kecamatan gondang kabupaten nganjuk pengaruh gerakan pkk peningkatan peran wanita suatu kajian unit pemukiman transmigrasi/desa transmigrasi sungai bahar xvi jambi perencanaan strategis pemasaran (strategic marketing plan) unit pembedahan rawat sehari rumah sakit umum tangerang tahun 2004 - 2007 analisis karakteristik pembakaran karakteristik mekanik biobriket campuran batubara lokal ampas garut variasi tekanan kontribusi motivasi berprestasi kinerja mengajar guru sekolah dasar lingkungan cabangnas pendidikan kecamatan rancaekek bandung partisipasi para pihak penanggulangan pencemaran (industri kecil pencelupan pengecapan desa pemogan denpasar bali) pengaruh perkembangan permukiman pantai air tanah (kawasan pariwisata pantai pangandaran kabupaten ciamis jawa barat) studi perbandingan pengukuran pemetaanstribusi medan potensial listrik isolator tegangan menengah finite element method peranan orang tua menumbuhkan minat baca anak sejakni (pada keluarga desa jayagiri kecamatan lembang kabupaten bandung) analisis variabel-variabel mempengaruhi pengembangan inovasi meningkatkan kinerja pemasaran (studi bank mandiri jawa tengah) aplikasi teknologi penginderaan jauh sistem informasi geografis pemantauan tutupan lahan kualitas lingkungan dampak lumpur lapindo faktor faktor kondisi lingkungan kerja berhubungan kepuasan kerja karyawan bagian laboratorium rs telogorejo semarang tahun 2003 kepemimpinan ketua program studi pendidikan bahasa inggris fakultas keguruan ilmu pendidikan universitas sarjanawiyata tamansiswa yogyakarta keserasian sosial daerah perkotaan (suatu studi pola hubungan sosial antara etnik cina etnik bugis-makassar kotamadya ujungpandang) pemanfaatan teknik penginderaan jauh sistem informasi geografis (sig) memantau perkembangan kawasan permuktman baru kota sidoarjo pengaruh pelarut non ods (ozon depleting substances) berbasis hidrokarbon alifatik terpen proses pembersihan logam aluminium tipe 2024 pengaruh persepsi siswa tentang interaksi keluarga lingkuhgan sekolah tingkat aspirasi sikap siswa tentangsiplin sekolah pengetahuan lokal tentang pemanfaatan pelestarian lingkungan hidup masyarakat pesisir teluk tanah merah kabupaten jayapura propinsi papua peran forum kemitraan polisi masyarakat implementasi polmas mencegah penyalahgunaan narkoba wilayah hukum polsekta lowokwaru perancangan sistim pendukung keputusan perencanaan pengendalian proses perbaikan kapal docking (dl pt pal indonesia) perubahan fungsi ruang permukiman menjadi perdagangantinjau dart aspek penghuni (jalan utama lingkungan pe mukiman banyumanik) perubahan fungsi ruang permukiman menjadi perdagangantinjau dart aspek penghuni (jalan utama lingkungan pemukiman banyumanik) analisis tingkat risiko pekerjaan material manual handling gejala gangguan otot rangka pekerja pt pantja motor isuzu tahun 2003 hubungan faktor kesehatan lingkungan tinggi rendahnya house index (hi) jentik aedes desa endemis desa bebas dbd kotamadia semarang pariwisata berwawasan lingkungan (sebuah pemikiran ke arah kelembagaan pengembangan pariwisata daerah tingkat ii biak numfor-irian jaya) pengaruh pembuangan limbah industri ethanol kualitas air sungai surak kecamatan lawang kabupaten malang mauludina muhammad kuncahyo studi kebijakan pengembangan pulau-pulau kecil (kebijakan pengembangan pulau wawonii kabupaten kendari propinsi sulawesi tenggara) teknik penyidikan polri bidang tindak pidana pencemaran lingkungan pencemaran kali surabaya oleh pt sidomakmur pt sidomulyo faktor-faktor berhubungan praktek masyarakat daerah urban mengelola limbah domestik sekitar sungai garang kotamadya semarang pendekatan pembelajaran kontekstual konsep pencemaran lingkungan meningkatkan kemampuan berpikir kreatif siswa smpn lemahabang karawang penurunan konsentrasi cod tss total nitrogen air limbah domestik constructed wetlands menggunakan tanaman kangkung air (ipomoea aquatica) perencanaan sistem pengelolaan sampah terpadu kawasan kota baru terencana (pada kawasan bukit semarang baru (bsb) kota semarang) analisis kelayakan produksi bersih peningkatan efisiensi produktivitas usaha kecil menengah pt kusumapa nugraha dampak volatilitas lingkungan hubungan antara strategi unit bisnis evaluasi kinerja berbasis informasi akuntansi kesenjangan anggaran kajian baku mutu air permukaan indonesia menggunakan metode perbandingan antara baku mutu negara-negara asia tenggara indonesia faktor-faktor berhubungan kinerja petugas sanitasi puskesmas upaya peningkatan cakupan spal kabupaten lampung tengah tahun 2002 manfaat pemakaian masker perubahaan kadar fenol urin akibat pajanan benzen unit penatalaksanaan limbah ptv kalimantan timur 2000 analisa pengaruh masa kerja karakteristik pekerjaan tingkat stress pegawai administrasi tetap universitas kristen petra surabaya analisis pelaksanaan koordinasi lintas sektor kelompok kerja operasional (pokjanal) gerakan jumat bersih tingkat kabupaten ciamis tahun 1997 dasar-dasar program perencanaan perancangan arsitektur international concert hall surakarta (dengan pendekatan hi tech acouctical performance) gangguan faal paru pekerja batik tradisional kotamadya surakarta pekalongan hubungannya asap malam batik gas-gas alat pemanas hubungan faktor lingkungan rumah karakteristik balita kejadian penyakit ispa balita kecamatan lemahwungkuk kota cirebon tahun 2006 hubungan perilaku masyarakat pengendalian lalat kepadatan lalat rw 04 kelurahan kedungpane sekitar tpa sampah jatibarang semarang kontribusi pengajaran geografi pembentukan sikap multikultural siswa studi deskriptif-analitik lingkungan sltp negeri kota tangerang penetapan kadar polutan pb ikan lele (clarias batrachus l)budidayakan daerah nyanan bendo klaten secara spektrofotometri serapan atom perubahan penataan penggunaan ruang rumah tradisional masyarakat desa plumpungrejo kecamatan kademangan kabupaten blitar ira yuli krisnani studi deskriptif kebiasaan pekerja bekerja lingkungan kerja panas home industri jenang desa kaliputu kecamatan kota kabupaten kudus hubungan kesehatan lingkungan fisik rumah karakteristik anak balita kejadian penyakit campak balita kabupaten garut tahun 2000-2001 model pendidikan pelatihan account representative kantor pelayanan pajak lingkungan kantor wilayahrektorat jenderal pajak jawa timur i penetapan kadar fe zn tempe bungkus plastik daunjual pasar kartasura menggunakan metode pengaktifan neutron pengamanan wilayah penambangan emas gunung pongkor kabupaten bogor oleh sat brimobda jabar rangka mencegah praktek penambangan tanpa ijin (peti) analisa strategi pemasaran berdasarkan faktor lingkungan eksternal internal (ud yeni furniture badran serenan juwiring klaten) dampak perubahan penggunaan lahan limpasan permukaan kawasan cbd (central businessstrict) sekitarnya kota malang yusriyanshah faktor-faktor siswa berpengaruh angka melanjutkan siswa sd ke sltp penuntasan wajib belajar pendidikan dasar 9 tahun dki jakarta hubungan antara perumahan sangat sederhana kesehatan penghuni lingkungan perumahan sangat sederhana kotamadya dati ii tangerang material requirement planning (mrp) sebagai salah satu dasar kebijakan pembelian supply chain mangement (scm) pt perfetti van melle indonesia pendekatan manajemen resiko menentukan prioritas proyek infrastruktur jalan terhambat lingkungan kimpraswil (propinsi banten) pengaruh pelatihan kerja industri sikap kewirausahaan studi deskriptif analitik siswa sekolah menengah kejuruan negeri 2 majalengka analisis hubungan antara kepemimpinan lingkungan organisasi motivasi pegawai menuju penerapan good governancerektorat jenderal imigrasi analisis komunitas alstonia dataran tinggieng gunung kidul kemungkinantemukannya fenomena vikariasi antara alkaloida glikosida jantung estimasi daya dukung lingkungan pesisir pengembangan areal tambak berdasarkan laju biodegradasi limbah tambak perairan pesisir kabupaten serang faktor lingkungan rumah mempengaruhi hubungan kadar pm10 kejadian ispa balita wilayah puskesmas curug kabupaten tangerang tahun 2004 hubungan antara persepsi lingkungan tugas tingkah laku antrepreneur unjuk kerja manajer koperasi unit desa (kud) sulawesi selatan hubungan perilaku hidup bersih kejadian fasciolopsiasis anak sekolah dasar dua desa kecamatan jenamas kabupaten barito selatan tahun 2002 implementasi konsep perencanaan strategik bagi pengembangan program studi pendidikan agama islam (srudi kasus sekolah tinggi agama islam tasikmalaya) modelversifikasi usaha masyarakat pesisir implikasinya kesejahteraan serta kelestarian sumber daya wilayah pesisir kabupaten belu-ntt pengaruh keluarga partai politik lingkungan dprd perilaku bersih korupsi anggota fraksi partai keadilan sejahtera dprd jawa tengah pengaruh pengelolaan limbah cair peningkatan pendapatan petani (pabrik gula spiritus madukismo serta petani padi sekitarnya) persepsi pentingnya penguasaan bahasa asing selain bahasa inggris bagi staf front office peningkatan kualitas pelayanan hotel surabaya plaza perubahan peran sungai sebagai akibat pembukaan jalan darat sungai anjir serapat jalan trans kalimantan ruas kuala kapuas - banjarmasin studi deskriptif berhubungan kejadian luar biasa (klb) demam berdarah dengue (dbd) wilayah kerja puskesmas kartasura kabupaten sukoharjo hubungan struktur fungsional keluarga kebiasaan merokok remaja konteks keperawatan komunitas sltp kecamatan cilandak jakarta selatan pengaruh perilaku membeli berdasarkan kebiasaan loyalitas merek (studi konsumen amdk galon ades lingkungan warga kelurahan isola bandung) studi tentang pengetahuan persepsi sikap siswa implementasi layanan bimbingan konseling madrasah aliyah negeri 3 malang supriyanto hubungan antara karakteristik penyidikan satuan reskrim polres magelang efektifitas penegakan hukum penambangan pasir ilegal lereng gunung merapi peranan penggunaan bentukan tradisional tradisi pemeliharaan lingkungan kondisi lingkungan bangunan tradisional dukuh pancot tawangmangu tanggung jawab sosial perusahaan implementasi makna ekonomisnya bagi perusahaan masyarakat sekitar pt pabrik kertas tjiwi kimia faktor-faktor berhubungan keterampilan petugas laboratorium puskesmas pemeriksaan mikroskopis tb positif kota pontianak sekitarnya faktor-faktor berpengaruh perilaku pemakaian insektisida petani bawang merah kelurahan tanjung sari kecamatan wanasari kabupaten pengaruh penerapan paket binaan program penyehatan lingkungan pemukiman peningkatan perilaku sanitasi perumahan desa pongangan gresik tahun 2001 arahan pengendalian perubahan fungsi lahan perumahan menjadi lahan perdagangan jasa perumahan tipe menengahsederhana perumahan sawojajar 1 malang efektivitas pembelajaran anak melalui pemanfaatan sentra-sentra kegiatan (learning centers) taman kanak-kanak (di taman kanak-kanak bianglala) iniplementasi uu no 23 tahun 1997 upaya pencegahan pencemaran lingkungan (industri kimia pt indo acidata_ma kabupaten karanganyar) pengaruh pembelajaran kooperatif tipe stad (student team-achievementvision) peningkatan hasil belajar siswa sma konsep pencemaran lingkungan pengaruh sumber kekuasaan metode mempengaruhi kepuasan kerja studi para pns lingkungannas perhubungan daerah istimewa yogyakarta peran warga negara asing kegiatan illegal logging wilayah hukum polres kapuas hulu (tsk chien lok ung als alok anak chien tig lai dkk) teritorialiti deteritorialisasi reteritorialisasi kajian perilaku lansia penghuni sasana tresna werdha karya bhakti ria pembangunan cibubur jakarta timur laporan hasil penelitian analisis pengarui1 lingkungan pekerjaan teriiadap perilaku kerja karyawan (kasus pt primatexco indonesia batang jawa tengah) membangun keunggulan kompetitif melalui aliansi stratejik meningkatkan kinerja perusahaan (pada pt pos indonesia wilayah vi jatengy) pengaruh motivasi kerja kepemimpinan kepala sekolah lingkungan kerja kinerja guru (suatu studi berdasarkan persepsi guru smk negeri kota tegal) pengaruh motivasi peran serta masyarakat penerapan sistem pemantauan berkala terpadu pengendalian pencemaran sungai akibat industri pemukiivtan pengaruh pelaksanaan pengawasan intern oleh satuan pengawas intern efektivitas kerja pegawai lingkungan kantor wilayah perum pegadaian yogyakarta perencanaan perancangan arsitektur (ppa) rumah sakit paru-paru surakarta (dengan pendekatan konsep green architecture sebagai proses penyembuhan pasien pesantren kesehatan studi antropologi mengenai kebudayaan pesantren manajemen perilaku kesehatan santri pondok pesantren putri walisongo jombang survei bahan restorasi gigi plastisgunakan rumah sakit puskesmas lingkungan kabupaten bireuen selama agustus 2007 sampai agustus 2008 analisis penyusunan strategi pemasaran pt sinar sosro produk teh botol sosro berdasarkan analisis swot matrik perencanaan strategi kuantitatif (mpsk) hubungan beberapa faktor sanitasi lingkungan rumah perilaku kesehatan kejadian tifoid penderita berobat rumah sakit banyumanik semarang komunikasi orang tua anak membina nilai-nilai agama keluarga tentang pembinaan nilai-nilai agama sebagai pendidikan umum keluarga pemanfaatan bakteri pemecah minyak proses bioremediasi (pengolahan tanah terkontaminasi minyak minas sbu pt caltex pasific indonesia riau) hubungan fungsi manajemen kepatuhan perawat pelaksana upaya pencegahan infeksi nosokomial ruang perawatan bedah rsup fatmawati jakarta tahun 2004 kepuasan pasien pelayanan dokter perawat fasilitas medis/non-medis/obat-obatan lingkungan ruang rawat makanan/menu ruang rawat inap rsu fatmawati pengaruh !kum kerja mot1vasi kerja budaya kerjasiplin kerja pegawai lingkungan sekretariat daerah kabupaten badung propins1 bali tahun 2002 pengaruh partisipasi penganggaran j08 relevant information (jai) volatilitas lingkungan kinerja manajerial perusahaan manufaktur indonesia partisipasi masyarakat pelaksanaan kebijakan publik tentang penanggulangan sampah (di kelurahan leuwigajah kecamatan cimahi selatan kota cimahi) pengaruh sertifikat wadiah bank indonesia swbi) kurs inflasi kinerja return on asset (roa) bank muamalat indonesia januari 2001-desember 2005 peranan sistem pengasuhan anak perubahan lingkungan desa namba kabupaten bogor jawa barat kajian tentang hubungan antara kebudayaan kesehatan jiwa studi tingkat pemenuhan tugas keluarga bidang kesehatan keluarga penderita hipertensi wilayah kerja uptd puskesmas tuntang kabupaten semarang tinjauan yuridis aspek cost recovery kontrak kerja sama migas indonesia pascaberlakukannya undang-undang no 22 tahun 2001 tentang minyak gas bumi biaya transaksi ekonomi badan usaha milik daerah badan usaha milik daerah berbentuk perusahaan daerah perseroan terbatas lingkungan dki jakarta hubungan antara persepsi kompensasisiplin kerja awak ka pt kereta api indonesia (persero) daerah perasi v lingkungan stasiun besar purwokerto hubungan lingkungan rumah karakteristik responden berhubungan kejadian filariasis wilayah kerja puskesmas bantar gebang ii kota bekasi tahun 2004 orientasi nilai latar belakang biografis mahasiswa iain raden intan bandar lampung (studi ke arah pengembangan rancangan program layanan bimbingan konseling analisis pengaruh lingkungan eksternal fokus konsumen fokus pesaing kinerja industri perhotelan (studi hotel-hotel kelas melati surakarta) hubungan antara faktor-faktor kualitas lingkungan fisik rumah kejadian tb paru bta positif kecamatan cilandak kota administratif jakarta selatan tahun 2008 analisis kelayakan usaha air minum kem asan mel alui proses sedimentasi microfilterasi teknologi ozonisasi ultraviolet pt tlrta gemilang magelang beberapa faktor berhubungan terjadinya pencemaran tanah oleh telur cacing desa karanganyar kecamatan kalibening kabupaten banjarnegara tahun 2000 emannamika faktor-faktor timbulnya tindak kriminallakukan wanita mengenai wanita membunuh suami lembaga pemasyarakatan wanita tangerang pelaksanaan gugatan perwakilan (class actions) perusahaan pemerintah kasus lingkungan hidup indonesia (studi beberapa kasus putusan pengadilan) analisis pengaruh faktor internal eksternal sumber daya manusia efisiensi kerja karyawan operasional industri kerajinan garmen cv mama leon denpasar kajian eksistensi persistensi koprostanol upaya mendapatkan alternatif indikator pencemaran limbah domestik lingkungan tekanan lingkungan tinggi perancangan sistem alat bantu penentuan lokasi usaha kecil-menengah metode analytyc hierarchy process (ahp) (study kasus perusahaan cetak undangan ath nguter) pola keterpaduan program community development sebagai strategi community relations perusahaan-perusahaan zona indusri (zona industri lhokseumawe aceh) hubungan antara program community development melalui kegiatan bina lingkungan citra pt pln (persero) area pelayanan jaringan bandung (apjb) masyarakat hubungan beberapa faktor lingkungan perilaku masyarakat kejadian demam berdarah dengue wilayah kerja puskesmas cirebon barat kabupaten cirebon tahun 2004 kandungan chromium perairan sedimen kerang darah (anadara granosa) wilayah pantai sekitar muara sungai sayung desa morosari kabupaten demak jawa tengah faktor-faktor mempengaruhi petani menggunakan pestisida terlarang lingkungan padi sawah petani padi sawah kabupaten bekasi provinsi jawa barat hubungan faktor lingkungan kerja praktek pengelolaan pestisida kejadian keracunan pestisida tenaga kerja tempat penjualan pestisida kabupaten subang pengaruh limbah air panas pltu muara karang komposisi jeniskejerahandan sebaran makrofauna serta pengamatan toleransi suhu ikan bandeng udang api-api pengaruh orientasi wirausaha kinerja perusahaan kecil lingkungan strategi sebagai variabel moderat (pada industri aneka kota semarang) pengaruh penerapan sistem manajemen mutu iso 9002 kinerja biaya mutu perusahaan industri konstruksi proyek lingkungan pt waskita karya sikap masyarakat pedalaman jawa lingkungan alam sosial agama lereng gunung merapi - merbabu desa paras kecamatan cempogo kabupaten boyolali jawa tengah studi analitik pembelajaran mataklat perawatan perbaikan kelistrikan motor (study kasus kompetensi pedagogik guru implementasi kurikulum smk 2004) hubungan antara sikap perilaku prajurit abri kinerja pegawai negeri sipil lingkungan kerja sekolah staf komando tentara nasional indonesia angkatan darat faktor-faktor penentu masuknya vietnam menjadi anggota asean ke-7 studi perubahan politik luar negeri vietnam asean komitmen asean pencapaian asean - 10 optimasi sistem kebijakan pengelolaan limbah perusahaan migas salah satu perusahaan minyak gas bumi beroperasi laut natuna propinsi riau pengaruh pola asuh orang tua lingkungan tempat bermain ketrampilan gerak dasar siswa studi kausal komparatif anak sekolah dasar kelas vi kota bandung program bantu penjadwalan pembuatan ice can berbasis optimasi waktu industri semi mass production bahasa pemrograman c (di pt esstar indorim tegal) analisa strategi pemasaran sarinande beach inn menghadapi krisis kunjungan wisatawan mancanegara upaya meningkatkan tingkat hunian pasca teror bom bali 12 oktober 2002 pengembangan model pembelajaran inkuiri berorientasi lingkungan ipa penelitian deskriptif tindakan kelas sd negeri cikutra kec cibeunying kaler kota bandung studi efektivitas partisipasi masyarakat program rehabilitasi instalasi pengolahan lupur tinja (iplt) upaya pengelolaan lingkungan kelurahan sukajaya palembang pengembangan kebijakan pengelolaan daerah aliran sungai bagian efektivitas waduk das citarum hulu efektivitas waduk saguling provinsi jawa barat peran serta masyarakat pemeliharaan jalan sehubungan pelaksanaan otonomi daerah lingkungan perumahan cimanggu permai duta kencana ii kota bogor undang-undang nomor 7 tahun 1989 masalah pelaksanaan putusan pengadilan agama tentang pelaksanaan (eksekusi) putusan pengadilan agama kotamadya yogyakarta analisis faktor-faktor berhubungan dosis radiasi eksterna pekerja radiasi pusat penelitian tenaga nuklir serpong badan tenaga nuklir nasional tahun 2000/2001 studi deskriptif gambaran deteksini attention deficit hyperactivitysorder (adhd) anak sekolah sd gedang anak 01 03 kecamatan ungaran timur kabupaten semarang hubungan kadar timah hitam (pb) udara lingkungan kerja kadar timah hitam(pb) darah kadar hemoglobin darah petugas parkir plasa simpang lima semarang meningkatkan iunerja lingkungan perusahaan melalui strategi good housekeeping pt unggul jaya sejahtera pekalongan pt sandang asia iviaju abadi semarang studi tentang keanekaragaman kemelimpahan zooplankton sebagai dasar pertimbangan budidaya perikanan laut sistem tambak muara sungai rejoso pasuruan hafid zain muttaqien analisis pengaruh motivasi kerja pelatihan kerja kondisi lingkungan kerja prestasi kerja karyawan produksi industri mebel (pada citra jepara semarang) analisis sistem pendidikan pelatihan (diklat) pegawai lingkunganrektorat jenderal cipta karya tentang pengaruh pendidikan pelatihan penulisan pengembangan turbin air mikrohidro cross flow ringan murah head rendah (2-3 m) daya efektif 3-4 kw aliran badan air lingkungan kampus universitas indonesia perancangan sistem informasi pengedalian lingkungan surveilans penyakit malaria berbasis sistem informasi geografis (sig) nas kesehatan kabupaten (dkk banjarnegara analisa yuridis tindak pidana illegal logging kabupaten sumba barat (putusan pengadilan negeri waikabubak perkara nomor 73/pidb/2006/pnwaikabubak) hubungan jenis sumber informasi ketepatan pemberian makanan pendamping air susu ibu (mp asi) desa kota kabupaten kulon progo propinsi daerah istimewa yogyakarta hubungan kinerja jangka panjang saham pasca-ipo optimismevergensi opini investor serta tindakan oportunis emiten (studi empiris perusahaan go public bej 1992-2002) analisis penentuan faktor paling berpengaruh prestasi kerja karyawan opersional metode analytical hierarchy process (ahp) (di pp burung mas solo) penurunan logam berat cu menggunakan adsorben rumput laut jenis gracilaria verrucosa secara batch kontinyu (limbah industri elektroplating cv kanigoro juwana-pati) pelaksanaan csr (corporate social responsibility) sebagai tanggung jawab perusahaan berdasarkan undang-undang nomor 40 tahun 2007 tentang perseroan terbatas (studi pt air mancur) kajian tentang partisipasi masyarakat sekitar setu kegiatan konservasi pelaksanaan konservasi setu rawa besar kelurahan depok kecamatan pancoran maskota depok penepatan analisis bahaya pengendalian titik kritis secara mikrobiologis tempe mendoanwarung-warung makan kelurahan tembalang kecamatan tembalang kota semarang tahun 2000 peranan lingkungan pendidikan motif berprestasi keyakinan spiritual penelitian kalangan siswa berbakat memimpin sekolah menengah umum unggulan-nonunggulan dki jakarta arah kebijaksanaan pemerintah kota semarang pemberian ijin proyek pembangunan perumahan (real estat) sebagai upaya pengembangan kota berwawasan lingkungan berkelanjutan faktor-faktor mentoring tarbiyah mempengaruhi tingkat kecerdasan emosional kecerdasan siswa (studi korelasi unit kegiatan rohani islam sman 06 sman 34 jakarta) pengaruh proyek penyediaan air bersih penyehatan lingkungan pemukiman perubahan skor rumah sehat orang tua murid sd panjangwetan 3 kotamadya dati ii pekalongan tahun 1999 pengembangan sistem informasi surveilans kualitas air non perpipaannas kesehatan propinsi jawa tengah untui mendukung penga1vibilan keputusan perencanaan program air bersih pengaruh rumah susun sederhana peningkatan kehidupan sosial ekonomi penghuninya rumah susun sederhana penjaringan kotamadya jakarta utara propinsi dki jakarta hubungan antara tingkat pemaparan partikel debu udara kapasitas fungsi paru (studi pekerja industri peleburan timah hitam lingkungan industri kecil bugangan baru semarang) pengaruh pencemaran industri tapioka perubahan sosial-ekonomi lingkungan kecamatan margoyoso kabupaten dati ii pati jawa tengah (suatu kajian ekonomi agroekosistem) strategi peningkatan pemakaian internet sebagai media komunikasi transaksi rangka pengembangan lingkungan telekomunikasi indonesia era pro kompetisi bidang telekomunikasi hubungan faktor lingkungan rumah kebersihan perseorangan kejadian infeksi saluran reproduksi istri supir tahun 2005 studi cross sectional pt tegas pt tjadik gazali hubungan perumahan tradisional infeksi saluran pernapasan akut (ispa) bayi anakbawah lima tahun (balita) desa yiwika kecamatan kurulu kabupaten jayawijaya irian jaya penegakan hukum lingkungan pencemaran udara oleh kendaraan bermotor dki jakarta (enforcement of environment law towards air pollution produced by motor vehicles in dki jakarta) penerapan pembelajaran kooperatif model tgt (teams games tournament) meningkatkan motivasi aktivitas hasil belajar siswa kelas x sma negeri 19 malang maria yosiana dwi anggraeni pengaruh anggaran partisipasi komtimen organisasi k1nerja manajerial ketidakpastian lingkungan sebagai variabel moderating (pada perum perhutani unit i jawa tengah) analisis pengaruh karakteristik perusahaan strategi internasional kinerja ekspor perusahaan lingkungan sebagai moderating variabel (studi ukm eksportir semarang) kualitas layanan faktor-faktor mempengaruhi dampaknya kinerja kemampulabaan (studi mitra kerja lingkungan pt (persero) angkasa pura i bandar udara ahmad yani semarang) pengaruh temperatur laju korosi baja karbon baja laterite lingkungan air = the influence of temperature to corrosion rate of carbon steel and laterite steel in natural water fungsi lkmd sebagai wadah partisipasi masyarakat pengelolaan ruang terbuka hijau pertamanan pengelolaan rth pertamanan kecamatan grogol-petamburan wilayah jakarta barat keanekaragaman serangga lahan persawahan-tepian hutan indikator kesehatan lingkungan = insectversity at the forest margin-rice field interface indicator for a healthy ecosystem pengaruh faktor manajerial lingkungam organisasional intensitas perencanaan strategis peningkatan kinerja finansial (studi empiris bank perkreditan rakyat jawa barat) perbandingan karakteristik akseptor lingkungan program antara pengguna kontrasepsi iud non-iud wilayah administrasi puskesmas jati warna kecamatan pondok melati bekasi tahun 2009 pendekatan neighborhood unit development tata bangunan lingkungan permukiman nelayan kasus desa segarajaya kec tarumajaya-bekasi tema penataan bertumpu kepada karakter lokal upaya pengembangan bakat minat siswa smp negeri 11 kota bandung menggambar (penelitian deskriptif siswa smp negeri 11 kota bandung menggambar tahun ajaran 2005/2006) faktor-eaktor mempengaruhi peningkatan suhu tubuh denyut nadi pekerja terpajan panas (di departemen corvisi tampa cor pt pindad (persero) bandung tahun 2003) legal standing dewan perwakilan daerah ketiadaan norma perkara pengujian undang-undang undang-undang dasar 1945 mahkamah konstitusi (putusan mk no 10puuvi/2008) strategi pengembangan organisasi perguruan tinggi swasta kabupaten sumedang (studi deskriptif kesiapan beberapa perguran tinggi swasta menjelang pembentukan universitas sebelas april sumedang) analisis faktor-faktor mempengaruhi hubungan antara agen pelumas pengecer pelumas ketidakpastian lingkungan (kasus pemasaran pelumas pertamina wilayah ex karesidenan surakarta) pengaruh sanitasi lingkungan status gizi anak usia 1-3 tahun permukiman nelayan (di wilayah tambaklorok kelurahan tanjung mas kecamatan semarang utara kota semarang tahun 2003) perancangan website bagian pemeliharaan sarana prasarana lingkungan balai pengelolaan pelabuhan laut angkutan sungaiau penyebrangan (bpplasdp) nas perhubungan provinsi jawa barat beberapa faktor lingkungan keluarga berhubungan kepatuhanit penderitaabetes mellitus (pada pasienabetes mellitus unit kedokteran metabolik irj rsup dr kariadi semarang) pendidikan lingkungan taman nasional strategi konservasi dunia kegiatan interpretasi alam = environmental education and national parks the wcs values and naturalist interpretive activities hubungan pengetahuan praktik penjamah makanan mengenai higiene sanitasi makanan keberadaan escherichia coli nasi rames (studi kantin lingkungan universitasponegoro tembalang) pengaruh program pelaksanaan keselamatan kesehatan kerja kinerja karyawan bagian lingkungan keselamatan kesehatan kerja (lk-kk) pt pertamina (persero) unit pengelolaan v balikpapan kelayakan ekonomi rural overlay network (ronet) dampak positifnya program universal service obligation (uso) kecamatan lengayang kab pesisir selatan propinsi sumatera barat faktor-faktor berhubungan kejadian kurang energi protein anak usia 6 - 23 bulan propinsi sumatera barat tahun 2002 analisis data sekunder studi epidemiologi gizi sumatera barat tahun 2002) penerapan prinsip pencegahan pencemaran pabrik kelapa sawit (penggunaan sumberdaya air pabrik kelapa sawit sei mangkei kecamatan bosar malinggas kabupaten simalungun sumatera utara) hubungan antara mentoring ambiguitas peran konflik peran kesan ketidakpastian lingkungan kinerja niat pindah lingkungan auditor yunior (pada kantor akuntan publik indonesia) interaksi sosial antara siswa kurang awas teman sebaya lingkungan sekolah (pada siswa kurang awas tentang interaksi sosial teman sebayanya lingkungan slbn-a citeureup cimahi) peran polmas cibatu cikarang bekasi warga perumahan taman cibiru cikarang bekasi mendesain lingkungan melalui pengamanan fisik kegiatan sosial sebagai suatu bentuk strategi pencegahan kejahatan hubungan antara trasfer pengetahuan keterampilan efektivitas pelaksanaan praktek kerja industri penelitian korelasional siswa sekolah menengah kejuruan negeri 1 bandung jurusan penjualan analisis pengaruh keahlian menjual lingkungan kerja mendukung kompensasi kinerja tenaga penjualan hubunganya kinerja pemasaran (studi tenaga penjualan hp nokia semarang) analisis pengaruh kemilian menjual lingkungan kerja mendukung kompensasi kinerja tenaga penjualan hubunganya kinerja pemasaran (studi tenaga penjualan hp nokia semarang) membangun learning organization mencapai keunggulan kompetitif lingkungan perusahaan kecil-menengah studi empiris wirausaha mebel rotan sentra industri mebel rotan desa trangsan gatak sukoharjo pendekatan s-t-m perkuliahan plsbt meningkatkan kemampuan memecahkan masalah konsep lingkungan (penelitian tindakan kelas mahasiswa jurusan bahasa perancis semester genap tahun 2004 2005) pengendalian limbahoksin pemanfaatan bahan pemutih ramah lingkungan suatu kajian pemanfaatan oksidator berbasis klor industri pulp melalui simulasi model system dynamics analisis kebijakan perilaku mekanik durabilitas beton mutu tinggi campuran copper slag sebagai cementitious (on the mechanical behavior and durability of high strength concrete with copper slag as cementitious material) dampak operasional mesin amp kegiatan pengangkutan material kualitas udara sekitar industri amp pt karisma agung perkasa (dukuh watu gajah desa waringin putih kecamatan bergas kabupaten semarang) peningkatan hasil belajar biologi pendekatan contextual teaching and learning (ctl) pokok bahasan pencemaran kerusakan lingkungan siswa kelas vii smp muhammadiyah 1 surakartatahun ajaran 2008/2009 pembuatan karakteristik beton geopolimer berbahan dasar abu terbang abu dasar sebagai agregat halus = production and characteristic of fly ash based geopolymer concrete with bottom ash as fine aggregate pengaruh strategi pemasaran kinerja pemasaran kinerja perusahaan lingkungan persaingan sebagai variabel moderating (perusahaan jasa konstruksi kelas kecil menengah kota semarang) kajian antisipasi pemerintah daerah pengembangan jaringan layanan telekomunikasi daerah sehubungan pelaksanaan otonomi daerah deregulasi telekomunikasi obyek kajian pemerintahan kota depok analisis pengaruh faktor lingkungan persaingan komitmen sumber daya pertumbu'han penjualan melalui orientasi strategi inovasi produk industri farmasi industri jamu jawa tengah) penyesuaian sosial anak tunagrahita ringan berdasarkan mental age (studi deskriptif komparatif tentang penyesuaian sosial anak tunagrahita ringan splb-c yplb cipaganti sdn gegerkalong 2 sdn putraco indah bandung) upaya menciptakan lingkungan belajar sosial melalui pembelajaran kooperatif meningkatkan motivasi pelajaran matematika smp negeri 4 sumberlawang (ptk siswa kelas vii semester 2 smp negeri 4 sumberlawang) peranan international non-governmental organizations (ingos) pengelolaan konflik mediasi icraf konflik sumberdaya hutan lindung kabupaten lampung barat propinsi lampung indonesia tahun 2000-2002 proses berkarya melalui pendekatan fenomena sosial lingkungan mentransformasikan fenomena sosial lingkungan terjadi masyarakat kota bandung ke karya seni rupa - tema tersisih; terdesak analisis pengaruh karakteristik top management karakteristik perusahaan lingkungan strategi inovasi implikasinya kinerja perusahaan kecil (industri manufaktur kecil uk bugangan semarang) hubungan antara higiene sanitasi lingkungan warung praktek pengolahan mie ayam angka kuman (environmental sanitation and hygyene of stale and chicken noodles processing practice in relation with microorganism number) indonesiajin nihongo gakushuusha no kanji shuutoku ni tsuite=pemerolehan kanji pembelajaran bahasa jepang mahasiswa indonesia mahasiswa angkatan 2001 jurusan pendidikan bahasa jepang universitas negeri surabaya pendekatan inkuiri meningkatkan aktivitas belajar siswa pembelajaran ips kelas iv sdn isola 1 sukasari bandung (penelitian tindakan kelas siswa kelas iv sekolah dasar negeri isola 1 kec sukasari kota bandung) analisis pengaruh peran kepemimpinan motivasi komitmen organisasi kepuasan kerja meningkatkan kinerja pegawai (studi pegawai lingkungan pemerintah daerah kabupaten sukamara propinsi kalimantan tengah) proses perkembangan kota perubahan sosial ekonomi masyarakat pinggiran kota jakarta suatu studi tentang perubahan pola pemilikan lahan struktur okupasi sosial-budaya desa bojonggede kecamatan bojonggede kabupaten bogor budaya organisasi ketidakpastian lingkungan sebagai variabel moderating hubungan antara gaya evaluasi atasan tekanan kerja kepuasan kerja bawahan (studi pt bank perkreditan rakyat wilayah kantor bi solo) keberhasilan industri kecil propinsi sumatera barat (suatu studi tentang faktor-faktor internal eksternal termasuk faktor program kemitraan industri kecil pt semenng berperan keberhasilan industri kecil) kegiatan belajar mengajar pendidikan pancasila kewarganegaraan (ppkn) sekolah menengah kejuruan (smk) tentang implementasi kegiatan belajar mengajar membina siswa menjadi warganegara baik smkn 1 garut kontribusi pembangunan perumahan permukiman pendapatan daerah beban pemerintah daerah pembiayaan prasarana lingkungan fasilitas sosial utilitas umum suatu kabupaten daerah tingkat ii tangerang rancang bangun panggilan otomatis kereta listrik (tram) stasiun menggunakan programmable controller master - k120s = design and build automatic call of light rail train (tram) at station using programmable logic controller master-k120snamika berfikir siswa sekolah dasar mengantisipasi perkembangan sains teknologi (suatu studi eksperimental rangka meningkatkan kemampuan berfikir kritis siswa melalui pengajaran ipa sd pendekatan pemecahan masalah) studi tentang perilaku konsumsi rumah tangga kebutuhan lingkungan bersih sehat kelas menengah kompleks perumahan pondok timur indah i desa mustika jaya kecamatan bantar gebang kabupaten bekasi jawa barat) dampak sosial operasionalisasi tempat pembuangan akhir (tpa) sampah bantargebang kesejahteraan masyarakat masyarakat kelurahan ciketing udik cikiwul sumur batu kecamatan bantargebang kota bekasi provinsi jawa barat pengaruh partisipasi penyusunan anggaran kejelasan sasaran anggaran kesulitan sasaran anggaran umpan balik kinerja manajerial ketidakpastian lingkungan sebagai variabel moderating (studi empiris pabrik gula indonesia) pengaruh struktur desentralisasi partisipasi penyusunan anggaran komitmen organisasi orientasi nilai manajer inovasi sebagai variabel moderating (studi empiris perguruan tinggi swasta lingkungan kopertis wilayah vi jawa tengah) faktor-faktor kesulitan pembinaan nilai-nilai agama usia transisi serta upaya penanggulangannya guru siswa orang tua siswa tingkat sekolah dasar sekolah menengah pertama nurul huda nyalindung kabupaten bandung penerapan model pembelajaran science technology society and environment (stse) sub pokok bahasan sistem koloid dampak penggunaan deterjen lingkungan (analisis penguasaan konsep keterampilan berkomunikasi keterampilan mengambil keputusan) peran serta masyarakat pengelolaan sampah sebagai upaya melestarikan lingkungan hidup (swastanisasi pengelolaan sampah) (the participation of society on sewage management as an effort to protect our life environment) (privateness on sewage management) peran serta masyarakat pengelolaan sampah sebagai upaya melestarikan lingkungan hid1113 (swastanisasi pengelolaan sampah) (the participation of society on sewage management as an effort to protect our life environment) (privateness on sewage management pengaruh lingkungan pertumbuhan fisik kebugaran jasmani serta ketrampilan gerak dasar anak-anak sd pesisir pantai anak-anak sd kota kabupaten kendari studi kausal komparatif sd daerah pesisir pantai sd kota kabupaten kendari aplikasi eko arsitektur rumah panggung mengantisipasi kondisi termal lingkungan (tinjauan konstruksi bahan bangunan) application of eco architecture house on stilts in anticipating the condition of environmental termal (evaluation construction and material) efektifitas model pembelajaran konstruktivisme melalui pendekatan sts [k-sts] meningkatkan kemampuan memahami konsep kepedulian lingkungan sekitarnya pembelajaran listrik statis smu suatu studi pembelajaran remedial smu negeri 1 cipatat pengembangan hukum islam wewenang peradilan agama melalui putusan mahkamah agung bidang lingkungan peradilan agama masalah sumbangan putusan mahkamah agung bidang lingkungan peradilan agama pengembangan hukum islam menjadi wewenang peradilan agama keterkaitan antara kemampuan manajerial hasil pelatihan kecerdasan emosional kinerja ibu-ibu menduduki jabatan struktural instansi pemerintah studi ibu-ibu menduduki jabatan struktural lingkungan kantor gubernur kepala daerah tingkat i jawa barat perubahan pemanfaatan ruang lingkungan pemugaran kebayoran baru kaveling tanahjalan cikajang jalan ciranjang blok q kebayoran baru the alteration of space use restoration area of kebayoran baru case study land lot on cikajang and ciranjang street block q kebayoran baru pengaruh pemahaman peraturanrektur jenderal perbendaharaan nomor per 12/pb/2007 tentang prosedur tata cara permintaan serta pembayaraan uang m akan bagi pegawai negeri sipil motivasi kerja kinerja pegawai negeri sipil lingkungan kantor departem en agama kabupaten klaten efektivitas pendidikan ekonomi pembentukan nilai-nilai perilaku ekonomi (studi tentang faktor-faktor mempengaruhi efektivitas pembelajaran ekonomi implikasinya nilai-nilai perilaku ekonomi berdasarkan asas kekeluargaan siswa sma negeri kota bandung) pendidikan ips pengembangan model pembelajaran inkuiri akrab lingkungan mengembangkan keterampilan berfikir meningkatkan prestasi belajar siswa bidang sains sekolah dasar studi eksperimen menguji efektifitas model pembelajaran inkuiri akrab lingkungan pokok bahasan energi panas sekolah dasar kota madya malang penerimaan pengeluaran barang gudang studi proses sedimentasi pantal teluk ambon inhibisi korosi baja karbon larutan kebudayaan korporat pt pasindogriya semarang analisis penerapan imt-2000/umts indonesia aplikasi data karyawan toserba yogya badan kearsipan daerah propinsi jawa barat office management system berbasis sms gateway pengolahan limbah karet secara kontak biologi peraturan penghunian kondominium indonesia proses hukum wajar gideon rencana induk universitas indonesia 1974-1979 the tale of obesity challenges and solutions sistem pakar penyakit osteoporosis wanita gedung i pusat lingkungan geologi (plg) perancangan sistem pendukung keputusan kelompok prototipe pemanfaatan sistem informasi geografik pusat persalinan perawatan tubuh surabaya laporan pengantar kerja praktek cv graha citra monitoring sistem keamanan rumah via jaringan pstn penyebaran zooplankton beberapa situ jawa barat perlakuan bahan bata merah berserat abu sekam padi studi pembuatan minyak bio-diesel biji jaraknamika kelompok sosialis indonesia (1945-1950) gedung rektorat universitas muhammadiyah surakarta induksi akar batang bawah mawar aklimatisasinya perspektif keperawatan kesehatan jiwa masa depan well-being lansia tinggal panti werdha aktualisasi peran sosial wanita cina jabodetabek' berebut kebenaran governmentality kasus lapindo pengolahan limbah cair industri batik secara biologi perencanaan strategis manajemen pengetahuan lapan suplai-diman serat sutera riau sumatera barat analisa tegangan riser clamp struktur jacket zua analisis kebijakan pengelolaan pasar bunga rawabelong analisis prospek budidaya tambak kabupaten brebes implementasi regulasi perdagangan emisi indonesia kampanye bahasa kemasan produk makanan bagi kesehatan perancangan promosi event seni beladiri merpati putih rancangan kampanye upaya pencegahan tindak pedophilianamika gaya hidup metroseksual pria dewasa awal peran nuklir rangka mendukung ketahanan nasional perancangan multimedia company profile sas advertising analisis beban kerja fisik manusia bagian produksi pengamanan arus lebih mengunakan mikrokontroller aplikasi fluida superkritis ekstraksi minyak atsiri mikrobiologi suatu tantangan menyongsong hari esok model pola asuh penderita skizofrenia () pembangunan perangkat lunak editor halaman web sederhana sistem informasi akademik smu negeri i cileunyi bandung ketahanan oksidasi baja aisi 316l temperatur tinggi bahan bakar alternatif motoresel minyak biji kapok kaidah-kaidah ergonomi mendesainsplay kontrol kajian zoosemiotik lambang sma negeri kota bandung pengukuran respon impuls ruangan berbasiskan komputer rumah susun sewa kawasan industri kabupaten karanganyar tindak pidana kehutanan khususnya mengenai pembalakan liar latar belakang pemerintah rusia meratifikasi protokol kyoto minat kreativitas siswa sltp bina bakti karawitan pembinaan jenjang karier pustakawan pemda dki jakarta pengaruh pemberian kadmium respon imun tikus putih strategi pengembangan bisnis kosmetika pt mustika ratu tbk daerah malang selatan masa perang kemerdekaan 1947-1949 ekstraksi logam berat limbah cair mixer-settler kebijakan pengelolaan sumberdaya perairan kabupaten bogor kesesuaian pemanfaatan lahan wilayah pesisir kabupaten demak sistem informasi data nilai siswa smp providentia bandung fosil geologi sebagai ide dasar bagi ekspresi karya seni rupa jalan panjang mewujudkan kebebasan memperoleh informasi malpaktek apakah itu medical error atau criminal malpractise pembelajaran bahasa jerman secara otodidak suatu perancangan pengembangan sistem penggerak kendaraan surya proses transesterifikasi minyak biji nyamplung metanol rehabilitasi wanita hamil luar nikah panti asuhan anak kondisi fisik pesisir moramo konawe selatan sulawesi tenggara mekanisme arsip aktifnas perhubungan propinsi jawa baratnas pertanian perkebunan kehutanan kabupaten bekasi pengaturan pelaksanaan national single window indonesia pengembangan indeks keluarga sejahtera provinsi jawa timur perencanaan perancangan interior pondok pesantren al-falah pt (persero) angkasa pura ii bandar udara husein sastranegara survey on utility of internet-basedapplications for supporting karbonisasi batubara temperatur rendah sistem rexco kekuatan mengikat pengangkatan anak beragama hindu bali konversi html ke wml pengaksesan halaman web berbasis wap model keputusan penentuan tenaga kerja pengelolaan proyek model penanggulangan intensif demam berdarah dengue surabaya pengolahan limbah besi asam sulfat membentuk feri sulfat potensi pakan ruminansia pengembangan kawasan agropolitan redesain pesantren mahasiswa universitas islam bandung (unisba) evaluasi kawasan lindung dataran tinggieng kabupaten wonosobo interaksi sosial anak sekolah kelas bawah tomang banjir kanal isotop stabil 13cng lamun enhalus acoroides teluk banten peran serta masyarakat kependudukan keluarga berencana perancangan corporate identity properti fortune city surabaya strategi pengelolaan kawasan terumbu karang kepulauan kangean coping kaum gay penyesuaian sosial masyarakat yogyakarta sistem informasi pemeliharaan sarana rumah sakit al islam bandung kemampuan berbagai jenis tanaman menyerap gas pencemar udara (no2) kontroversi lingkungan air tanah jakarta intrusi atau salinisasi simulasi analisis peningkatan performansi tcp layanan ubr arahan pengembangan permukiman buruh kawasan industri sier surabaya optimalisasi database server mysql sistem operasi linux optimasi pupuk usahatani leisa bawang merah dataran rendah questioning the popularity of agency theory in accounting research sistem informasi geografis penanganan masalah perumahan kumuh timbulan limbaht domestik wilayah kecamatan sukmajaya depok tinjauan pengelolaan limbah cair rumah sakit x jakarta pusat (suatu survei pelanggan pt hm sampoerna tbk unikom bandung) analisis ekonomi lingkungan model input-output modifikasi keragaman somaklonal heritabilitas beberapa sifat tanaman nilam' konservasi mangrove sebagai pendukung sumber hayati perikanan pantai kuantitas kualitas ruang terbuka hijau (rth) permukiman kota tinjauan penerapan store atmosphere formen factory outlet bandung hubungan negara masyarakat kapitalisme transportasi publik kewenangan pemerintah daerah kaitannya reklamasi pantai pengaruh harga energi listrik perkiraan kebutuhan energi listrik pengembangan perpustakaan fakultas kedokteran universitas padjadjaran persepsi masyarakat pembangkit listrik tenaga nuklir (pltn) tanggung jawab hak asasi manusia kasus lapindo (studi hak anak) aplikasi motor stepper sebagai alat rotasi kamera melalui port paralel pengaruhsiplin kerja karyawan prestasi kerja karyawan perencanaan lingkungan jalur pedestrian jalan mt haryono semarang sistem informasi penagihan listrik pt pln (persero) upj bandung timur faktor-faktor mempengaruhi jenis penggunaan lahan pesisir semarang kelimpahan ikan putihan hubungannya pemunculan pesut mahakam konflik kawasan cagar alamau dendam tak sudah kota bengkulu memanfaatkan webcam sebagai kamera keamanan ruangan mendeteksi perbaikan prasarana sebagai upaya peningkatan kualitas permukiman kumuh perkembangan struktur kota bekasi kaitannya lingkungan hidup pertanggungjawaban pidana atas semburan lumpur panas pt lapindo brantas rancangan kinerja sistem pembangkit uap energi biomassa industri kecil desain interior lobby rumah sakit mata undaan ii image eco-modern nu politik (studi tentang konflik politik internal nu 1952-2003) perbedaan memori jangka pendek siswatinjau pemberian aromaterapi proses penyaluran pembinaan pasca penyalurana pinjaman unit pkbl studi tentang faktor-faktor penetapan harga produk perumahan surabaya terapi perilaku mengatasi anak retardasi mental suka mencuri (di kelurahan bandarharjo kelurahan tanjung mas semarang) peranan heterogenitas masyarakat mempertahankan permukiman marjinal perancangan sistem pengendalian kualitas pt bina satria abadi sentosa wewenang pemerintahan penataan ruang suatu model pendekatan sistem formulasi strategi perusahaan kontraktor listrik mekanikal skala kecil penerapan manajemen pengetahuan islam (shuratic process) bank indonesia pengaruh musim plankton perairan riau kepulauan sekitarnya perencanaan strategis rs wijaya kusumah kabupaten kuningan tahun 2005 2009 periklanan wanita iklan surat kabar surabaya post (1953 - 1965) protein sejenis silicatein sponge sebagai katalis polimerisasi silika strategi koping korban kecelakaan lalu lintas mengalami amputasi the effect of fiberet on colonic cancer formation the role of butyrate efektivitas beberapa teknik konservasi tanah air menurunkan erosi fungsi ruang terbuka kesehatan manusia lingkungan permukimant hubungan antara hargari asertivitas perilaku prososial remaja human motion recognition menggunakan support vector machine secara realtime pengolahan data tunjangan keluarga pegawai balai besar logam mesin perancangan green house ideal tanaman anthurium berkualitas masyarakat desa audit lingkungan sistem pengelolaan air limbah pt wonderful estimasi batas radiasi lingkungan gerakan beam antena radar heritabilitas beberapa sifat kuantitatif kedelai berbagai lingkungan kebijaksanaan pengelolaan lingkungan hidup propinsi kalimantan selatan metodologi pendidikan lingkungan kemaritiman suatu penyajian eksploratif pemanfaatan satelit lingkungan cuaca monitoring kebakaran hutan penduduk pembangunan lingkungan potensi permasalahan tantangan penelitian lingkungan hidup studi genetika rhizobium skala laboratorium pengembangan lingkungan hidup; 1 juni 1978 (kumpulan tulisan th 1978/79) pentingnya pembangunan industri berorientasi wawasan lingkungan dakwaan pelaku tindak pidana korporasi bidang lingkungan hidup peran serta dunia usaha mewujudkan usaha berwawasan lingkungan peranan permodelan struktur alamiah pencegahan masalah lingkungan pertumbuhan pemukiman masyarakat lingkungan perairan; daerah jawa timur studi faal tentang produktivitas sapi perah kondisi lingkungan panas aspek pengelolaan pelabuhan belawan tinjau lingkungan hidraulik budidaya kentang tahan hama ramah lingkungan malino kabupaten gowasiplin nasional suatu analisa makro penerapannya lingkungan kampus kebijaksanaan program perbaikan lingkungan pemukiman repelita iii laporan hasil penelitian tentang perilaku nyamuk lingkungan rumah tangga model metode pendugaan dampak lingkungan kegiatan pembangunan pertanian penerapan sanksi perdata korporasi sengketa lingkungan hidup pengelolaan pengembangan kota sebagai lingkungan hidup menjelang tahun 2000 penggunaan media komunikasi komunikasi lingkungan penyimpangan kebijakan alih fungsi lahan pelestarian lingkungan hidup ketertiban umum kebersihan lingkungan wilayah propinsi dki jakarta koordinasi pembangunan bidang sumber daya alam lingkungan hidup ta 2008 no 10/2000 tgl28 januari 2000 tentang badan pengendalian dampak lingkungan pembangunan lingkungan meningkatkan harkat kehidupan (file menneg klh) pencegahan pencemaran pelestarian lingkungan hidup perairan indonesia uji durabilitas beton berserat limbah karet roda lingkungan agresif audit lingkungan atas pengolahan limbah cair bir pt delta djakarta tbk desain penataan lingkungan permukiman bantaran sungai deli kota medannamika penduduk lingkungan kemiskinan; kasus minahasa lombok timur evaluasi data pemantauan radioaktivitas lingkungan kawasan reaktor kartini no 27/1999 tgl 7 mei 1999 tentang analisis mengenai dampak lingkungan hidup organisasi tata kerja instansi vertikal lingkungan departemen keuangan perkembangan teknologi informasi (dan pengaruhnya lingkungan bisnis) phasing out lead from gasoline world wide experience and policy implications usaha polsekta pabean lantikan-surabaya pengamanan lingkungan pertokoan analisis financial pemamfaatan limbah pabrik kelapa sawit kabupaten kampar analisis pembelian minyak pelumas lingkungan pt chevron pacific indonesiasiplin nasionaltinjau aspek penegakan hukum lingkungan masyarakat ilmu pemerintahan lingkungan institut ilmu pemerintahan (sebuah perspektif) pembangunan berkelanjutan antara kenyataan lingkungan harapan pembangunan peran serta masyarakat pengelolaan lingkungan hidup kawasan perumahan pertumbuhan pemukiman masyarakat lingkungan perairan; daerah sumatera utara adaptasi ekonomi masyarakat nelayan alternatif ketidakpastian lingkungan derajad pencemaran bakterial air sungai kalimassurabaya tahun 1985-1986 hubungan antara lingkungan kerja kinerja kepala sdn kota tanjung pinang hukum perlindungan konsumen perjanjian standar lingkungan perbankan indeks keanekaragaman hewan makrobentos indikator kualitas lingkungan perairan pengaruh penggunaan pestisida lingkungan hidup kecamatan sei bingei pentingnya sistem manajemen lingkungan melaksanakan pembangunan nasional pertanggugjawaban perdata ptpupuk iskandar muda pencemaran lingkungan resiko pemajanan formaldehid sebagai bahan pengawet tekstil lingkungan kerja tunjangan jabatan struktural lingkungan kepolisian negara republik indonesia aspek teknologi lingkungan upaya pengelolaan lingkungan hidup indonesia dampak lingkungan proses pembangunansta aceh sekarang mendatang gambaran oseanografi variabilitas lingkungan perairan cirebon jawa barat implementasi kebijaksanaan pengelolaan lingkungan hidup pemanfaatan energi konflik pengelolaan lingkungan catatan tahun 2004 agenda pemerintahan baru no 196/1998 tgl 26 nopember 1998 tentang badan pengendalian dampak lingkungan perkembangan penggunaan herbisida indonesia dampaknya lingkungan perlindungan anggota masyarakat pembuangan effluen radioaktif ke lingkungan tunjangan jabatan struktural lingkungan organisasi tentara nasional indonesia critical environmental pressure points; informasi dasar/baseline information 2006 dampak eksploitasi hutan filipina kehidupan masyarakat lingkungan dampak lingkungan hidrologi suatu analisa beberapa permasalahannya informasi singkat proyek-proyeka luar negeri lingkunganrjenkdasmen konsumerisme lingkungan hidup suatu kajian hak konsumen lingkungan meningkatkan layanan informasi budaya daerah lingkungan hidup perpustakaan penyelesaian sengketa lingkungan hidup menurut undang-undang nomor 23 tahun 1997 peran media pers rangka pengelolaan lingkungan hidup (di medan) perdagangan luar negeri komoditas udang ; isu lingkungan standar mutu makanan perjanjian pembiayaan almudharabah lingkungan bank muamalat cabang medan 2001 riset korporat sistem inovasi nasional pembenahan lingkungan kondusif studi penyusunan status lingkungan hidup kabupaten bantaeng; konsep laporan kahir teknik eliminasi latar pembacaan dosimeter pasif pemantauan lingkungan dampak perubahan lingkungan usaha infrastruktur hukum bisnis indonesia faktor-faktor lingkungan kelas menghambat keberhasilan siswa studi matematika pendayagunaan tenaga kesehatan lingkungan pengendalian pencemaran lingkungan pendekatan lingkungan studi ilmu hubungan internasional pendidikan lingkungan upaya menuju pembangunan berkelanjutan era otonomi daerah pengaruh lingkungan kerja kinerja karyawan hotel bumi karsa bidakara pengaruh lingkungan sebaran foraminifera plankton teluk kau halmahera pengembangan wilayah pedesaan sudut pandang kependudukan lingkungan hidup tanggung jawab perusahaan pelestarian fungsi lingkungan kepada masyarakat urgensi perpustakaan menunjang sukses belajar-mengajar lingkungan sekolah usaha perbaikan gizi keluarga (upgk) lingkungan katolik (file dep agama) akuntability perusahaan lingkungan (studi mengenai pt toba pulp lestari) keanekaragaman hayati ketahanan energi lingkungan berbasis iptek nasional kualitas air konteks hidrologi kaitannya berbagai aspek lingkungan pendidikan lingkungan hidup cerita rakyat masyarakat sumbawa pulau sumbawa penilaian indeks lingkungan pabrik kelapa sawit (pks) metode parametrik teknik isolasi pembiakan mikroba perombak biosida bioteknologi lingkungan tunjangan jabatan bagi pejabat negara lingkungan lembaga tertinggi/tinggi negara tunjangan umum bagi anggota kepolisian negara ri lingkungan kepolisian negara ri manajemen bioregional jabodetabek profil strategi pengelolaan sungai aliran air no 51/1993 tgl 23 oktober 1993 tentang analisis mengenai dampai lingkungan (amdal) pembangunan lingkungan hidup mewujudkan keterpaduan pembangunan berkelanjutan pendayagunaan sumberdaya alam secara lestari tinjauan segi ekonomi lingkungan pengaruh lingkungan toko perilaku belanja kaum wanita giant hypermarket pengaruh penyedian luasan rumah kepadatan lingkungan pemukiman surakarta sikap perilaku jender kebersihan lingkungan rumah tangga mencapai suatu tinjauan tentang sifat kebersamaan lingkungan kehidupan masyarakat rumah susun uji adaptasi lingkungan (jenis pakan) ikan pelangi melanotaenia herbertaxelrodi analisis pelestarian lingkungan hidup menggunakan pendekatan pajak lingkungan isolasi seleksi jamur pendegradasi lignoselulosa beberapa lingkungan ekstrim pedoman penanganan penggantian kerugian negara lingkungan kementerian ppn/bappenas penegakan hukum lingkungan indonesia melalui peningkatan kesadaran lingkungan pengaruh lingkungan toko perilaku belanja (ex plaza indonesia) pertumbuhan pemukiman masyarakat lingkungan perairan daerah khusus ibukota jakarta relasi kemiskinan degradasi lingkungan bentuk konteksnya lingkup perkotaan analisis faktor-faktor mempengaruhi penurunan kualitas lingkungan hidup indonesia hubungan kualitas lingkungan perumahan derajat ibu balita sumatera utara konsep design arsitektur berwawasan lingkungan kawasan permukiman perkotaan laporan hasil penelitian kebijakan pegawai lingkungan departemen kehakiman meningkatkan peran polres tangerang menegakkan hukum kasus pencemaran lingkungan pemanfaatan prinsip hukum perusahaan menanggulangi masalah pencemaran lingkungan pengaruh pendidikan lingkungan kesadaran siswa pemeliharaan lingkungan pertanggungjawaban pidana korporasi pencemaran perusakan lingkungan hidup sikap lingkungan alam (ditinjau islam menyelesaikan masalah lingkungan) tatakrama lingkungan formal nonformal masyarakat berbagai daerah indonesia birokrasi kenaikan pangkat pegawai negeri sipil lingkungan pemerintah propinsi riausiplin murid smta lingkungan pendidikan formal beberapa propinsi indonesia fitoaleksin strategi tanaman menanggapi serangan patogen atau cekaman lingkungan kali surabaya pollution control study; final report vol analytical results river water manajemen bioregional jabodetabek profil strategi pengelolaan situ rawaau pengaturan tentang kelembagaan pengelolaan lingkungan indonesia peran serta media pers rangka pengelolaan lingkungan hidup (di medan) perangkat mengintegrasikan keanekaragaman hayati analisis dampak lingkungan suatu lingkungan belajar mengundang (lbm) menghindari kesengsaraan emosional dampak perang kerusakan lingkungan hidup menurut hukum lingkungan internasionalsain tempat sampah meningkatkan kesadaran masyarakat kebersihan lingkungan kendaliri anak yatim kelas v sd se-kecamatan kuantan mudik tahun pelajaran 2005/2006 pembangunan lingkungan hidup dampak pembangunan lingkungan masyarakat pedesaan pertanggungjawaban pidana korporasi pencemaran atau kerusakan lingkungan hidup skenario pelestarian kemampuan lingkungan mencapai pertambangan berkelanjutan hubungan antara perilaku lingkungan suatu kajian teori psikologi lingkungan kemitraan pembangunan nasional tinjauan khusus pembangunan perkotaan lembaga penyedia jasa pelayanan penyelesaian sengketa lingkungan hidup luar pengadilan pengaruh kebisingan manusia lingkungan tinjauan studi psikologi lingkungan penyelesaian sengketa lingkungan hidup melalui mekanisme alternatif penyelesaian sengketa perkembangan konvensi-konvensi imo perlindungan lingkungan laut pencemaran pertanggungjawaban pidana korporasi pencemaran perusakan lingkungan hidup pola pembinaan pengawasan kesehatan pengelolaan sampah/kebersihan (file depkes) ringkasan sistem partisipasi komunitas manajemen lingkungan lingkungan kampung upaya meningkatkan peran polri penegakan hukum lingkungan hidup polda jawa timur hubungan pelaksanaan pendidikan lingkungan hidup partisipasi siswa smu kajian background studi dokumen rpjm 2010-2014 bidang lingkungan hidup; laporan awal metode penentuan faktor-faktor mempengaruhi pelaksanaan audit lingkungan indonesia partisipasi masyarakat pengelolaan lingkungan mewujudkan program bestari pengaruh kepuasan kerja karyawan sikap karyawan perubahan organisasi bpmigas pengaruh tempat tinggal anak prilaku prososial pengelolaan lingkungan hidup peranan pusat studi lingkungan rangka menunjang sistem jaringan informasi lingkungan perlindungan anak khususnya anak-anak lingkungan lokalisasi wanita tuna susila persepsi partisipasi siswa sekolah dasar pengelolaan sampah lingkugan sekolah beberapa aspek lingkungan berhubungan angka kejadian malaria desa suka jaya kajian background studi dokumen rpjm 2010-2014 bidang lingkungan hidup; laporan akhir peran serta masyarakat meningkatkan kualitas lingkungan daerah aliran sungai ciliwung analisis perancangan infrastruktur jaringan kos lingkungan universitas bina nusantara desain percobaan ipa bahan lingkungan penerapannya pembelajaran smp instrumen ekonomi atau privatisasi pengelolaan lingkungan? komentar atas ruu jasa lingkungan islam lingkungan hidup pokok-pokok pikiran; 9 juni 1979 (kumpulan tulisan th 1978/79) kajian background studi dokumen rpjm 2010-2014 bidang lingkungan hidup; laporan tengah kajian pengaruh program inres desa tertinggal kondisi sosial ekonomi lingkungan konsep pelestarian kemampuan lingkungan hidup nelayan tradisional kotamadia semarang konsep pelestarian kemampuan lingkungan hidup nelayan tradisional kotamadya semarang partisipasi guru sains smp negeri kota pekanbaru pengelolaan lingkungan sekolah penerapan audit persaingan pin bowling alley rangka peningkatan strategi bersaing penerapan pola pengamanan lingkungan komdak vii/metro jaya kecamatan grogol jakarta barat pengaturan tentang analisis mengenai dampak lingkungan hak pengusahaan hutan tanman industri sistem pendeteksi lingkungan sekitar wahana gerak mandiri menggunakan sensor ultrasonik studi tentang faktor-faktor lingkungan dominan mempengaruhi industri penerapan analisis kinerja karyawan perusahaan daerah air minum (pdam) tirta kampar bangkinang faktor lingkungan berhubungan pengalaman karies gigi pengunjung puskesmas kajian hidrologis banjir bandang sungai belanting kecamatan sambela kabupaten lombok timur pencemaran lingkungan pengelolaan lingkungan teknologi penangannya tantangan masa depan penerapan ganti rugi biaya pemulihan masalah pencemaran lingkungan akibat industri penggunaan legal standing organisasi lingkungan hidup rangka penegakan hukum lingkungan suatu tinjauan mengenai fungsi usaha industri sebagai instrumen pelestarian lingkungan hidup analisis kelayakan tambak udang berwawasan lingkungan berdasarkan faktor fisik kimiawi audit lingkungan atas upaya pengelolaan pemantauan lingkungan industri plastik pt x debt for nature swap peluang pendanaan alternatif; mengurangi utang menyelamatkan lingkungan feasibility study tentang pembukaan jurusan fakultas baru lingkungan universitas jember hubungan pelaksanaan pendidikan kependudukan lingkungan hidup partisipasi siswa smu pelaksanaan binkamtibmas swakarsa lingkungan pemukiman oleh polsek metro tebet jakarta selatan penerapan pola pengamanan lingkungan terpadu oleh polri proyek jenggolo kabupaten pati peningkatan kemampuan aparat pemerintahan daerah pembangunan lingkungan hidup tahun 2020 peranan koordinasi antara instansi pengelolaan lingkungan hidup bahan galian persepsi wanita mengenai pengelolaan sampah lingkungan kampus ipb darmaga kabupaten bogor petunjuk pelaksanaan penyiapan pemukiman lingkungan tahun anggaran 1995/96 (file deptrans) tinjauan atas peraturan perundang-undangan berkaitan perlindungan lingkungan hidup upaya polri mencegah kasus pencemaran perusakan lingkungan hidup polda metro jaya usaha-usaha pembinaan pabrik tapioka menjaga kualitas lingkungan hidup daerah lampung desain fabrikasi sistem sensor gas karbon monoksida berbasis sno2 memantau lingkungan efektifitas komunikasi pegawai administratif lingkungan rektorat univeristas riau pekanbaru kebijakan nasional pembangunan air minum penyehatan lingkungan (ampl) berbasis masyarakat kebijakan pengelolaan lingkungan hidup menurut undang-undang nomor 23 tahun 1997 kota binjai modifikasi rumah tinggal sebagai strategi mengatasi tekanan lingkungan (perumnas pemanfaatan mikroba bioremediasi suatu teknologi alternatif pelestarian lingkungan pengaruh pengelolaan kawasan ekowisata bukit gundaling lingkungan kesejahteraan perbedaan masalah siswa sekolah lingkungan pasar siswa sekolah pedesaan perilaku masyarakat pengelolaan lingkungan studi muara pantai boom kota banyuwangi pertimbangan lingkungan hak masyarakat pengaturan investasi pertambangan indonesia tunjangan umum bagi anggota tentara nasional indonesia lingkungan tentara nasional indonesia hubungan kualitas lingkungan perumahan derajat kesehatan ibu balita sumatera utara pengaturan prinsip keterbukaan perusahaan publik perlindungan lingkungan hidup pasar peranan pemerintah daerah meningkatkan pengawasan bidang lingkungan hidup kab taput strategi mengurangi kerusakan lingkunganakibatkan oleh gempa gelombang tsunami urgensi penerapan pidana korporasi tindak pidana lingkungan hidup (analisis pengaruh kawasan industri medan lingkungan sosial ekonomi masyarakat sekitar fungsi hukum sebagai instrumen pengendalian kualitas lingkungan pembangunan berlanjut hubungan perilaku sosial penghuni lingkungan kumuh partisipasi program pembangunan karakteristik zeolit penyerapan polutan timah hitam (pb) gas buang kendaraan bermotor komite negosiasi antara pemerintah konvensi acuan tentang perubahan iklim (fiel menneg klh) lingkungan alam konsep ekologi ekosistem perencanaan lingkungan tandjung shalihuddin djalal partisipasi masyarakat pengelolaan lingkungan mewujudkan program bestari kotamadya pemberdayaan peran serta masyarakat upaya menunjang keamanan lingkungan pt perkebunan pembinaan anak kaitan lingkungan fisik rangka peringatan hari lingkungan hidup penataan ruang nasional agenda menuju pembangunan daerah berwawasan lingkungan (file menneg klh) pengangkatan anak lingkungan hukum adat minangkabau tinjauan atas beberapa penetapan hakim peranan masyarakat pengelolaan lingkungan hidup kontribusinya penegakan hukum perkembangan ketentuan tentang perlindungan lingkungan laut pencemaran indonesia persepsi pegawai pemindahan pejabat struktural lingkungan universitas riau pekanbaru proses pembuktian pertanggungjawaban pidana korporasi tindak pidana lingkungan hidup suatu tinjauan tentang inventarisasi gulma airrawa senggreng bureng malang jawa timur suatu tinjauan tentang sifat kebersamaan lingkungan kehidupan masyarakat rumah susun kelurahan usaha-usaha lurah kepala lingkungan pengelolaan lingkungan hidup kelurahan (studi beberapa catatan mengenai kondisi lingkungan kebijakan umum pengelolaan lingkungan teluk ambon dampak eksternal sosial ekonomi pt indah kiat pulp and paper kecamatan tualang kabupaten siak kesejahteraan sosial pengembangan lingkungan hidup; 23 mei 1978 (kumpulan tulisan th 1978/79) pengaruh kelompok belajar usaha peningkatan kualitas sumberdaya manusia lingkungan peranan polri rangka siskamtibmas swakarsa lingkungan kerja wilayah polres pasuruhan perpaduan pertambahan pengelolaan lingkungan menghadapi kecenderungan isu lingkungan global tanggung jawab perusahaan pemanfaatan hasil hutan kayu kelestarian lingkungan hutan analisis hukum pelaksanaan kortvensi internasional bidang lingkungan hidup indonesia dampak penambangan bahan galian golongan c lingkungan sekitarnya kabupaten deli serdang faktor-faktor mempengaruhi kepuasan kerja karyawan ptjasa raharja (persero) cabang riau iklim kerja pegawai administrasi golongan ii lingkungan kantor pusat universitas riau pekanbaru kajian pengaruh program inpres desa tertinggal kondisi ekonomi lingkungan perumahan hubungan konversi hutan mangrove kemelimpahan kepiting bakau (scylla serrata) pantai napabalano sulawesi tenggara pemberdayaan masyarakat oleh polsek nanggung mencegah kerusakan lingkungan akibat penambangan emas tanpa ijin pongkor kabupaten bogor analisa pengaruh penggunaan elektronik gas booster bahan bakar bensin kinerja emisi gas buang motor bensin empat langkah analisis pengaruh human relation kondisi fisik lingkungan kerja leadership etos kerja karyawan kantor pendapatan daerah pati implementasi bml amdal perizinan lingkungan rangka pengendalian pencemaran udara pt semen gresik pabrik tuban lapoan penelitian pelaksanaan audit lingkungan sistem manajemen lingkungan perusahaan keterkaitannya standardisasi internasional iso seri 14000 pengaruh kepemimpinan motivasi pelatihan lingkungan kerja kinerja karyawan (survey pd bpr bank pasar kabupaten boyolali) sistem perencanaan jalur metode d*lite (d star lite) penentuan kecepatan putaran motor logika fuzzy wahana gerak mandiri evaluasi kesesuaian lahan rencana kawasan kompleks perkantoran pemerintah saumlaki kabupaten maluku tenggara barat/ elvis t watumalawar hubungan antara indeks standar pencemar udara kejadian infeksi saluran pernafasan akut balita kota medan tahun 2005/ arapenta bangun kajian pemanfaatan pesisir berwawasan lingkungan (desa batubarani desa guangobotu kecamatan kabila kabupaten bonebolango) pengaruh kepemimpinan motivasi pelatihan lingkungan kerja kinerja karyawan perusahaan tekstil pt kosoema nanda putra klaten pengaruh pengalaman kerja lingkungan kerja kepuasan kerja karyawan perusahaan kapas desa duwetan candirejo ngawen klaten hubungan antara program kemah konservasi pengetahuan sikap lingkungan (taman nasional gunung gede pangrango) penetapan prioritas program kegiatan pengendalian kualitas lingkungan udara kota surabaya pendekatan analytical hierarchy process (ahp) pengaruh kenakalan remaja lingkungan keluarga prestasi belajar mata pelajaran ekonomi siswa kelas viii smp muhammadiyah 2 surakarta pengembangan media mock-up pembelajaran konsep perubahan lingkungan fisik oleh hujan kelas iv sdit al-hikmah blitar pengukuran laju penjalaran retak korosi tegang baja tahan karat tipe 304 kaitannya pengaruh cemaran nacl dilingkungan 5n h2so4 persepsi peran spesialis industri etika bisnis etika lingkungan kasus wilayah industri botabek evaluasi sosial ekonomi ekologi perubahan sempadan pantai menjadi permukiman kota masohi kabupaten maluku tengah/ hasrah latuamury implementasi peran satuan pengamanan stabilitas keamanan ketertiban lingkungan perusahaan pt kertas basuki rahmat kabupaten banywangi pengaruh komitmen organisasi lingkungan kerja motivasi kerja kepuasan kerja karyawan dinas kebersihan pertamanan kota surakarta pengaruh pengetahuan kesehatan lingkungan perilaku hidup sehat para ibu rumah tangga rw 08 kelurahan lebak siliwangi kecamatan coblong analisis daya dukung lingkungan berdasarkan optimalisasi penggunaan sumberdaya lahan bagian hulu daerah aliran sungai way seputih lampung tengah hubungan antara persepsi guru gaya kepemimpinan kepala sekolah tingkat kepuasan atas pemenuhan kebutuhan smp 154 jakarta selatan pengaruh keselamatan kesehatan kerja motivasi kerja jaminan sosial lingkungan kerja semangat kerja karyawan rumah sakit islam klaten pengaruh peran serta masyarakat pengelolaan sanitasi peningkatan kesehatan lingkungan daerah studi kelurahan mergosono kota malang perubahan lingkungan strategi profesi akuntan publik menghadapi scripless trading pasar modal kaitannya penciptaan good governance' potensi kendala keadaan lahan pertanian bali rangka usaha meningkatkan kesejahteraan petani memelihara kelestarian lingkungan alam dukungan perhatian orang tua kondisi ekonomi lingkungan sosial prestasi belajar matematika kelas x smk negeri 1 banyudono boyolali efek shot peening korosi retak tegang (scc) baja karbon rendah milling tempering lingkungan air laut hubungan kondisi fisik rumah lingkungan sekitar rumah serta praktik pencegahan kejadian desa buaran kecamatan mayong kabupaten jepara identifikasi faktor-faktor mempengaruhi minat berwiraswasta alumni fakultas ekonomi jurusan manajemen universitas kristen petra tahun 1997-2000 implementasi manajemen personel meminimalisir pelanggaran disiplin tindak pidana lingkungan satuan ii pelopor (detasemen c) kearifan lingkungan masyarakat baduyfaktor-faktor mempengaruhi pelestarian fungsi lingkungan perubahannya kabupaten lebak banten pengaruh kondisi lingkungan kerja kepuasan kerja karyawan bagian sdm organisasi pt pln (persero) distribusi jawa barat banten arahan kebijakan pengelolaan hutan mangrovekasus pantai utara kecamatan aesesa kabupaten ngada flores propinsi nusa tenggara timur/ emanuel kora konstruksi perilaku hubungan komuniti nelayan taka bonerate lingkungan lautnya sebelum sesudah menjadi taman nasional pengaruh ketidakpastian lingkungan kinerja manajerial karakteristik sistem informasi akuntansi manajemen sebagai variabel intervening strategi taktik corporate social responsibility perusahaan petrochina lingkungan eksplorasi eksploitasi migas sorong papua barat studi jender tentang kedudukan peranan para pengambil keputusan lingkungan pemerintah daerah tingkat i sulawesi tengah hubungan antara pengetahuan geografi persepsi siswa tentang lingkungan hidup sikap siswa lingkungan hidup smp kota bandung hubungan persepsi anak kekerasan pola asuh otoriter konsep diri tinjau dari lingkungan etnis sabu etnis rote kota kupang motivasi jepang mengeluarkan kebijakan second phase of the japanese whale research program under special permit in the antarctic (jarpa ii) tahun 2005 pemberian izin industri rangka public service pemerintah daerah melakukan upaya pengendalian dampak lingkungan hidup (study kota medan) pengaruh kemampuan administrasi pendidikan supervisi lingkungan kerja kepala sekolah efektivitas implementasi mbs smp surakarta studi operasional perencanaan lingkungan jangka panjang pendekatan model dinamika ekosistem pulau analisis situasi pulau lombok bidang sosial kajian air kolam pengendapan areal pengolahan batubara kualitas sungai berau persepsi masyarakat kasus tambang batubara kabupaten berau koperasi pegawai republik indonesia sebagai bagian dari gerakan koperasi merupakan alat perjuangan ekonomi upaya meningkatkan taraf hidup rakyat mekanisme jasa asuransi sebagai sarana penunjang penerapan aspek hukum prinsip tanggungjawab mutlak (strict liability principle) hukum lingkungan pemanfaatan lingkungan sebagai sumber belajar pembelajaran ilmu pengetahuan sosial sekolah dasar negeri sumbersari kota malang penelitian strategi kebijaksanaan penanggulangan kemiskinan peningkatan kualitas lingkungan daerah pedesaan sulawesi selatan peran serta masyarakat rehabilitasi lahan konservasi tanah kawasan hulu das lasolo kabupaten konawe provinsi sulawesi tenggara/ la ode ilu usulan restrukturisasi kurikulum program studi teknik lingkungan - undip berdasarkan kriteria accreditation board for engineering and technology (abet evaluasi penerapan audit lingkungan menilai efektivitas sistem manajemen lingkungan sebagai implementasi iso 14001 2004 pt petrokimia gresik partisipasi masyarakat pembangunan prasarana lingkungan melalui program pemberdayaan masyarakat kelurahan (ppmk) kelurahan marunda jakarta utara pelaksanaan tugas penyidikan pegawai negeri sipil lingkungan dinas lalu lintas angkutan jalan rangka penegakan hukum lalu lintas jakarta pengaruh pemberian tugas secara individual kelompok melalui lembaran kerja hasil belajar siswa materi lingkungan pencemaran sma perbedaan sikap remaja awal remaja akhir hukuman fisik dari orang tua (studi sltp smu bunda hati kudus (bhk) grogol jakarta barat) perilaku eksploitasi sumberdaya perikanan taka konsekuensi lingkungan konteks internal eksternal kasus nelayan pulau sembilan pertumbuhan sintasan perkembangan gamet bioaktifitas ekstrak fraksi spon aaptos aaptos schmidt ysng fitrsndplsntsdi lingkungan berbeda perubahan lingkungan daerah transmigrasi sumatera selatan kasus desa tanjungraya kecamatan belitang kabupaten oku propinsi sumatera selatan analisis hubungan kondisi lingkungan kerja komunikasi kompensasi kepemimpinan semangat kerja pegawai balai latihan kerja industri surakarta evaluasi purna huni aspek sosial lingkungan pembangunan rumah susun (rumah susun kelurahan sukaramai ii kecamatan medan area kota medan) hubungan beberapa faktor beban tambahan lingkungan kerja kelelahan tenaga kerja wanita shift pagi dibagian packing pt palur raya karanganyar kajian iklim mikro ruang antara tegakan jambu mete desa camplong ii kecamatan fatuleu kabupaten kupang nusa tenggara timur/ alfred umbu kuala ngaji pengaruh jaminan sosial kesehatan kesehatan kerja serta lingkungan kerja semangat kerja karyawan pt cahaya surya tunas tapioka wonogiri pengaruh penambangan batugamping air tanah desa bedoyo kecamatan ponjong kabupaten gunungkidul daerah istimewa yogyakarta/ himawati widyastuti alternatif pengembangan struktur organisasi kepolisian masalah-masalah kawasan industrikasus kawasan industri kabupaten bekasi jawa barat manajemen usaha pengolahan susu pasteurisasi koperasi susu warga mulya sleman yogyakarta kajian sanitasi lingkungan produksi peralatan pekerja pengaruh kedisiplinan siswa perhatian orang tua kondisi lingkungan kelas hasil belajar matematika (pada siswa kelas ii smp negeri i bumiayu) penggunaan lingkungan sekitar sebagai sumber belajar pelajaran ips kelas 3 sekolah dasar negeri langensari ii kecamatan lembang kabupaten bandung peranan pembinaan petani-ternak secara berkelompok menerapkan zooteknik beternak sapi potong kondisi kesehatan petani-ternak lingkungan bagaimana pengaruh kepemimpinan motivasi lingkungan kerja kinerja pegawai negeri sipil dinas kehutanan perkebunan kabupaten jepara keterkaitan faktor linkungan aktivitas perekonomian pembangunan masa otonomi daerahpendekatan model input output lingkungan kota bogor pemanfaatan limbah cair pabrik tahu sebagai media pertumbuhan phytoplankton rangka penanggulangan pencemaran lingkungan perairan peranan pengelolaan sumber daya hutan program perhutanan sosial guna peningkatan pendapatan masyarakat pelestarian lingkungan kabupaten kendal sintetis film kemasan ramah lingkungan dari komposit pati khitosan asam polilaktat pemlastik gliserolmorfologi karakteristik mekanik studi operasional perencanaan lingkungan jangka panjang pendekatan model dinamika ekosistem pulau analisis situasi pulau lombok bidang kependudukan studi operasional perencanaan lingkungan jangka panjang pendekatan model dinamika ekosistem pulau analisis situasi pulau lombok bidang perekonomian valuasi lingkungan model pengelolaan sumberdaya terumbu karang berkelanjutan kawasan gili indah pulau lombok aplikasi stated choice method (scm) pengaruh lingkungan belajar kecerdasan spiritual prestasi belajar ekonomi siswa kelas x sma muhammadiyah 2 surakarta tahun ajaran 2009/2010 pengaruh temperatur flame stess relieving laju perambatan retak fatik sambungan las busur rendam baja astm a572 grade 50 lingkungan air laut adat tabu konsekwensinya lingkungan hutan suatu desa kaban tengah tanjung meriah kecamatan salak-dairi etika bisnis perilaku etis manajer pengaruhnya tanggung jawab perusahaan lingkungan sosial industri kecil makanan jawa timur klaim asuransi jiwa permasalahan permasalah hukum timbul serta penyelesaiannya praktik ajb bumiputera 1912 cabang bendungan hilir pengaruh earning per share tingkat kesehatan perusahaan harga saham perusahaan lumber paper chemical alliad products telah go public bursa efek jakarta 512 pengaruh right issue kinerja keuangan perusahaan go publik bursa efek jakarta 513 analisis pengaruh earning per share (eps) dividend per share (dps)dan return on quity (roe) harga saham perusahaan kelompok lq45 bursa efek indonesia (bei) 513 analisis pengaruh pemecahan saham (stock split) abnormal return tahun 2000-2007 514 pengaruh inflasi tingkat suku bunga sertifikat bank indonesia indeks harga saham gabungan pasar modal bursa efek indonesia 514 pengaruh kinerja keuangan perusahaan tingkat optimal range keputusan pemecahan saham (studi empiris bursa efek indonesia) 515 pengaruh capital adequacy ratio (car)loan to deposit ratio (ldr) return on equity (roe) harga saham sektor perbankan terdaftar bursa efek indonesia 515 pengaruh hari perdagangan reaksi pasar perusahaan manufaktur bej 516 analisis faktor-faktor berpengaruh ketepatan waktu pelaporan keuangan perusahaan manufaktur terdaftar bursa efek indonesia 516 pengaruh current ratio debt to equity ratio return on equity harga saham preusahaan tekstil garmen go publik bursa efek jakarta 517 analisis faktor-faktor mempengaruhi harga saham (studi empiris perusahaan textile mill product manufaktures periode 2005-2007) 517 pengaruh perputarn modal kerja struktur modal umur perusahaan ukuran perusahaan profit abilitas perusahaan automotive and allied products bursa efek jakarta 518 analisis pengaruh mekanisme good corporate governance reputasi auditor eksternal kepemilikan saham oleh publik kualitas laba perusahaan manufaktur terdaftar bursa efek jakarta 518 analisis variabel mempengaruhi harga saham perusahaan manufaktur tercatat bursa efek indonesia 519 analisis pengaruh penerapan laporan imformasi akuntansi pertanggungjawaban sosial market performance perusahaan manufaktur bursa efek jakarta 519 pengaruh perubahan modal kerja profitabilitas perusahaan manufaktur bursa efek indonesia (studi empiris perusahaan manufaktur tahun 2003-2005) 52 hasil penelitian faktor-faktor mempengaruhi perkembangan bursa efek indonesia 1986/1987 52 pengaruh kondisis moneter value effect small firm effect bursa efek jakarta 520 analisa pengaruh biaya keagenan resiko perusahaan kesempatan investasi kebijakan dividen perusahaan manufaktur terdaftar bursa efek jakarta 520 analisis faktor-faktor mempengaruhi struktur modal perusahaan textile mill products apparel and other textile products listing bursa efek jakarta 521 analisis pengaruh informasi laba akuntansi arus kas operasi return saham (studi empiris perusahaan go public bursa efek indonesia) 521 pengaruh laba bersih arus kas operasi likuidasi perusahaan dividen kas perusahaan go public bursa efek jakarta 522 analisis earning per share return on invesment mempengaruhi pendapatan deviden perusahaan terdaftar bursa efek jakarta periode 2005-2007 522 penaruh return on equity dividen payout ratio standar deviasi return price earning ratio (per) perusahaan terdaftar bursa efek jakarta 523 analisis rasionalitas investor pemilihan saham penentuan portofolio optimal menggunakan model indeks tunggal 523 pengaruh tingkat suku bangsa sbi nilai kurs dolar as tingkat inflasi indeks harga saham fabungan bursa efek jakarta 524 analisis efisiensi penggunaan modal kerja perusahaan electronics equipment terdaftar bei 524 analisis faktor-faktor mempengaruhi pengungkapan tanggung jawab sosial studi empiris perusahaan terdaftar bursa efek indonesia 525 analisis kinerja keuangan pt gudang garam tbk terdaftar bursa efek indonesia tahun 2002-2007 525 analisis pengaruh rasio aktivitas leverage keuangan net profit margin rentabilitas modal sendiri perusahaan automotive and allied bursa efek jakarta tahun 2001-2005 526 analisis perbandingan return abnormal return trading volume activity (tva) sebelum sesudah hari raya idul fitri (studi perusahaan makanan minuman listing bej) rizky perdana a 526 pengaruh tingkat keuntungan tingkat pertumbuhan perusahaan kebijakan dividen perusahaan manufaktur terdaftar bursa efek indonesia (bei) 527 analisis kenerja keuangan perusahaan wholesale retail trade bursa efek indonesia sebelum sesudah kenaikan bbm 527 pengaruh rasio profitabilitas rasio investor trading volume activity perusahaan lq 45 bursa efek indonesia wakhid kusumahadi 528 analisis faktor-faktor mempengaruhi beta saham sektor barang-barang konsumsi go public bursa efek jakarta 528 pengaruh kepemilikan institusional profitabilitas struktur modal perusahaan pertambangan go public bursa efek indonesia 529 analisis kebangkrutan perusahaan menggunakan metode z- score altman perusahaan agriculture terdaftar bursa efek indonesia 529 analisis pengaruh variable makro return pasar karakteristik industri return saham perbankan bursa efek jakarta 53 analisa rasio-rasio keuangan emiten kelompok industri tercatat bursa efek jakarta laporan penelitian 53 analisis harga saham pasca pengumuman stock split bursa efek jakarta antara tahun 2002-2006 530 analisis hubungan kinerja risiko perusahaan perbankan bursa efek jakarta 530 pengaruh kurs dollar inflasi return saham perusahaan automotive and allied product terdaftar bursa efek jakarta (bej) 531 analisis pengaruh leverage harga saham perusahaan perbankan terdaftar bursa efek jakarta 531 pengujian validitas capm berorientasi konsumsi teori gabungan capm-apt bursa efek jakarta 532 kajian perilaku harga saham pasar perdana pengamatan bursa efek jakarta selama tahun 1994-1996 532 pengaruh rasio fundamental harga saham perusahaan kelompok industri barang konsumsi terdaftar bursa efek indonesia 533 analisa efisiensi bursa efek jakarta ditinjau dari informasi tahunan perusahaan 533 pengaruh rasio keuangan harga saham perusahaan makanan minuman listing bursa efek indonesia tahun 2005-2007 534 pengaruh rasio keuangan dividen tunai perusahaan terdaftar bursa efek indonesia 534 pengaruh tingkat inflasi suku bunga earning per share (eps) harga saham pt telekomunikasi indonesia tbk bursa efek jakarta periode 2003-2005 535 kemampuan informasi laba arus kas operasi prediksi informasi arus kas operasi masa akan datang (studi perusahaan manufaktur terdaftar bursa efek indonesia periode tahun 2003 - 2006) 535 reaksi harga saham atas pengumuman laba tahunan perusahaan real estate property bursa efek indonesia (bei) 2006-2007 536 pengaruh pengumuman laba tahunan abnormal return bank lembaga keuangan bursa efek jakarta (bej) tahun 2006 536 pengaruh rasio keuangan praktik perataan laba perusahaan manufaktur terdaftar bursa efek indonesia 537 analisis pengaruh rasio likuiditas leverage aktivitas profitabilitas return saham perusahaan industri barang konsumsi go puplik bursa efek indonesia (bei) 537 kemampuan perubahan rasio keuangan memprediksi perubahan laba perusahaan manufaktur terdaftar bursa efek indonesia 538 faktor-faktor berpengaruh praktek pengungkapan sosial lingkungan perusahaan manufaktur go publik 538 pengaruh penerapan praktek good corporate governce manajemen laba perusahaan agricul ture terdaftar bursa efek indonesia 539 analisis pengaruh struktur pinansial rentabilitas modal sendiri perusahaan manufaktur bursa efek indonesia 539 pengaruh kebijakan dividen harga saham (penelitian empiris perusahaan-perusahaan terdaftar bursa efek jakarta) 54 analisis korelasi antara laba harga saham perusahaan-perusahaan terdaftar bursa efek surabaya 54 menyelidiki profit dari strategi melawan pasar (contrarian) overreaction hypothesis saham-saham lq45 bursa efek jakarta 540 analisis penilaian harga pasar saham pendekatan per model ekonometrika perusahaan go public bursa efek jakarta 540 pengaruh employee stock option plans (esops) kinerja keuangan perusahaan go public bursa efek indonesia 541 pengaruh kenaikan harga minyak dunia indeks harga saham gabungan (ihsg) bursa efek indonesia (bei) 541 studi pengujian efisiensi pasar modal relevansi kebijaksanaan dividend bursa efek jakarta 542 analisa pengaruh biaya agensi dividen perusahaan bursa efek jakarta 542 analisis pengaruh rasio aktivitas leverage profitabilitas perusahaan apparel and other textile product bursa efek indonesia 543 hubungan antara imbal hasil ipo faktor-faktor mempengaruhi kinerja ipokasus bursa efek jakarta 543 pengaruh faktor-faktor fundamental likuiditas saham perusahaan manufaktur listing bursa efek indonesia (bei) 544 penentuan portfolio optimal menggunakan model single index model constant correlationsuatu analisa saham-saham bursa efek jakarta 544 pengaruh struktur aktiva profitabilitas leverage operasi struktur pendanaan (suatu studi empiris perusahan manufaktur listing bursa efek jakarta) 545 pengaruh good corporate governance nilai perusahaan perusahaan lq -45 bursa efek indonesia 545 pengaruh rekayasa akrual meminimalkan pajak industri sektor perbankan bursa efek jakarta periode 2001-2005 546 analisis pengaruh resiko sistematik imbal hasil saham bursa efek jakarta tahun 2001-2002 menggunakan model ekuilibrium capm 546 pengaruh mekanisme corporate governance manajemen laba (studi empiris perusahaan manufaktur terdaftar bursa efek indonesia) 547 pengaruh factor fundamental keuanagan harga saham perusahaan perbankan listing bursa efek indonesia (2003-2007) 547 pengaruh struktur kepemilikan tingkat pertumbuhan penjualan ukuran perusahaan tingkat leverage profitabilitaskasus bursa efek indonesia tahun 2005-2006 548 faktor-faktor mempengaruhi koefisien respon laba koefisien respon nilai buku ekuitas perusahaan manufaktur bursa efek jakarta 548 pengaruh earning per share (eps) price earning ratio (per) return saham perusahaan automotive listing bursa efek indonesia 549 pengaruh arus kas operasi profitabilitas harga saham perusahaan perdagangan jasa terdaftar bursa efek indonesia 549 penggunaan konsep opsi penilaian saham perusahaan 55 analisis hubungan antara indikator-indikator ekonomi nilai transaksi portofolio saham bursa efek jakarta 55 reaksi pasar ketepatan waktu pelaporan keuangan bursa efek jakarta laporan penelitian 550 pengaruh asimetri informasi leverage kualitas laba (studi empiris perusahaan manufaktur terdaftar bursa efek indonesia tahun 2006) 550 peranan makro ekonomi mempengaruhi pergerakan saham perbankanpenelitian empiris bej periode tahun 2000-oktober 2006 551 investigasi anomali ipo bursa efek jakarta 551 pengaruh struktur kepemilikan saham ratio leverage nilai pereusahaan perusahaan manufaktur bursa efek indonesia 552 asosiasi laba tahunan perusahaan emiten harga saham bursa efek jakarta ditinjau dari ukuran perusaahan debt-equity ratio perusahaan 552 faktor-faktor mempengaruhi ketetapan waktu pelaporan keuangan perusahaan perbankan go publik terdaftar bursa efek indonesia 553 pengaruh penerapan good corporate governance kinerja perusahaan industri barang konsumsi (studi emperis perusahaan listing bursa efek indonesia tahun 2004-2007) 553 pengaruh variabel-variabel ekonomi makro return ihsg bulan januari return saham perbankan asuransi bulan januari melihat fenomena january effectempiris bej 1989-2006 554 analisis hubungan antara imbal hasil saham variabel-variabel mempengaruhinya berdasarkan penelitian empiris perusahaan-perusahaan terdaftar bursa efek jakarta (1997-2001) 554 analisis rasio keuangan perubahan laba perusahaan real estate and property terdaftar bursa efek indonesia 555 hubungan varian return saham likuiditas perdagangan 555 pengaruh struktur kepemilikan saham struktur modal nilai perusahaan perusahaan automotive and allied product bursa efek indonesia 556 komposisi kepemilikan pemegang saham likuiditas abnormal return sekitar pengumuman stock split perusahaaan publik bursa efek jakarta 556 pengaruh asimetri informasi ukuran perusahaan kepemilikan manajerial manajemen laba (paba perusahaan manufaktur terdaftar bursa efek indonesia) 557 formulasi model penentuan daerah kritis harga saham bursa efek jakarta 557 pengaruh faktor fundamental harga sazham perusahaan industri automotive allied bursa efek indonesia 558 analisis pengaruh leverage keuangan risiko saham return saham bursa efek jakarta 558 pengaruh total assets turnover net trofit margin profitabilitas perusahaan tobacco manufacturers listing bursa efek indonesia 559 analisis pengaruh return on assets debt equity ratio dividend payout ratio value of stock kasus perusahaan publik bursa efek jakarta 559 implikasi kebijaksanaan swastanisasi (privatisasi) bursa efek perkembangan pasar modal indonesiakasus bursa efek jakarta 56 analisis beberapa faktor fundamental mempengaruhi price earning ratio industri properti bursa efek jakarta penelitian periode 2002 sd 2004 56 reaksi pasar ketepatan waktu pelaporan keuangan bursa efek jakarta laporan penelitian 560 analisis price to book value saham pendekatan dupont identity perusahaan go public bursa efek jakarta 560 pengaruh eva roe eps inflasi bunga kurs dolar as tingkat pengembalian saham perusahaan kelompok aneka industri bursa efek jakarta tahun 2001 - 2005 561 pengaruh kandungan informasi arus kas return saham tahun 2003-2005 (studi perusahaan manufaktur bej) 561 pengaruh langsung tidak langsung faktor ekstern kesempatan investasi pertumbuhan assets keputusan pendanaan perusahaan terdaftar bursa efek jakarta 562 analisis faktor-faktor mempengaruhi minat pemanfaatan sistem informasi penggunaan sistem informasi empiris perusahaan manufaktur bursa efek jakarta 562 pengaruh penerapan corporate governance struktur kepemilikan ukuran perusahaan manajemen laba (earnings management) 563 analisis faktor - faktor fundamental mempengaruhi beta saham perusahaan manufaktur bursa efek jakarta periode tahun 2003 - 2005 563 pentingnya penguasaan teori portofolio bagi investor 564 analisis faktor-faktor mempengaruhi praktik perataan laba (income smooting) perusahaan manufaktur keuangan terdaftar bei 565 faktor-faktor mempengaruhi waktu penyampaian laporan keuangan tahunan (studi empiris perusahaan manufaktur terdaftar bej) 566 analisis investasi penentuan portofolio optimal bursa efek indonesia (studi empiris menggunakan model indeks tunggal saham-saham indeks lq-45) 567 analisis rasio keuangan menilai kinerja keuangan perbankan (studi empiris bank go public bursa efek indonesia tahun 2004-2006) 568 manfaat rasio keuangan memprediksi perubahan laba perusahaan manufaktur terdaftar bursa efek indonesia 569 analisis pengaruh inflasi suku bunga sbi pdb jub kurs dollar amerika suku bunga sibor indeks saham lq 45 bursa efek jakarta 2002 1 2007 4 57 e-commerce perdagangan efek bursa efek surabaya laporan penelitian 57 pengaruh beta financial leverage operating leverage type of business size rasio me/be expected return sahampengamatan bursa efek jakarta periode 1994-1995 570 analisis rasio keuangan menilai kinerja perusahaan pertambangan jasa pertambangan terdaftar bursa efek indonesia 571 pengaruh rasio-rasio keuangan praktik perataan laba (studi empiris perusahaan manufaktur bursa efek indonesia) 572 perbandingan underpricing penawaran saham perdana perusahaan keuangan non-keuangan bursa efek indonesia 573 analisis faktor-faktor mempengaruhi praktik perataan laba (income smoothing) perusahaan manufaktur keuangan terdaftar bei 574 analisis kemampuan laba akuntansi arus kas operasi memprediksi arus kas operasi masa depan (studi empiris perusahaan manufaktur go public bursa efek jakarta tahun 2002-2004) 575 analisis perkembangan tingkat kesehatan perusahaan menggunakan rasio keuangan industri electronic office equipment terdaftar bursa efek jakarta 576 pengaruh pengumuman dividen tunai ditinjau dari kenaikan penurunan dividen variabilitas tingkat keuntungan saham bursa efek jakarta (studi empiris perusahaan go public bej) 577 dampak pemecahan saham return saham (studi empiris perusahaan go-publik bursa efek jakarta) periode tahun 2001 - 2005 578 analisis rasio keuangan memprediksi kondisi financial distress perusahaan manufaktur terdaftar bursa efek indonesia 579 analisis rasio keuangan menilai kinerja keuangan perbankan (studi empiris bank go public bursa efek indonesia tahun 2003-2005) 58 analisis pengaruh faktor fundamental abnormal return perusahaan terdaftar bursa efek jakarta laporan penelitian 58 pengaruh variabel-variabel keuangan harga pasar saham setelah initial public offering (ipo) bursa efek jakarta periodesasi 2000-2004 580 analisis pengaruh profitabilitas investasi likuiditas leverage deviden payout ratio (studi empiris perusahaan manufaktur bursa efek indonesia) 581 pengaruh roe roa eps der proyeksi per harga pasar saham setelah penawaran perdana (initial public offering/ipo) bursa efek indonesia periode 2002 - 2006 582 pengaruh pengumuman dividen tunai ditinjau dari kenaikan penurunan dividen variabilitas tingkat keuntungan likuiditas saham bursa efek jakarta 583 analisis pengaruh jenis usaha ukuran perusahaan profitabilitas leverage tindakan perataan laba (studi empiris bursa efek indonesia) 584 analisis faktor faktor mempengaruhi struktur modal perusahaan perusahaan go publik bursa efek indonesia 585 korelasi emisi gas buang kendaraan bermotor kualitas udara ruang parkir bawah tanah gedung bursa efek jakarta dampak kesehatan pekerja 586 hubungan antara price earnings ratio (per) return saham beberapa variable fundamental perusahaan public bursa efek jakarta 587 pajak penghasilan final atas penghasilan dari transaksi penjualan saham bursa efek jakarta ditinjau dari asas keadilan asas kesederhanaan 588 respon tingkat pengembalian saham sektor perbankan fluktuasi variabel-variabel makroekonomi indonesia periode januari 2000 desember 2008 analisa vector autoregression (var) 589 pengujian komponen mikrostruktur pasar tingkat pengembalian abnormal split ex-date periode 1999-2006 sebelum event study 59 evaluasi strategi keuangan implikasi kesulitan keuangan perusahaan publik terdaftar bursa efek jakarta 59 pengaruh beta saham volume perdagangan saham perusahaan manufaktur go publik bursa efek jakarta tahun 2007 590 pelaksanaan corporate social responsibility perusahaan-perusahaan high-profile low-profile listed bei tahun 2004 591 strategi penerapan sistem remote trading bursa efek indonesia 592 pengaruh liquiditas pengeluaran modal pembiayaan eksternal sektor industri manufaktur bursa efek jakarta sebelum sesudah krisis ekonomi 593 hubungan synchronous cross sectional tingkat penghasilan risiko ukuran investasi pasar modal 594 bentuk perlindungan upaya bursa melindungi investor kepailitan perusahaan publik 595 pola intra hari return volatilitas return volume transaksi saham bursa efek jakarta 596 pengaruh pengumuman dividen tunai abnormal return hubungannya eps mbr return market 597 analisis pengaruh rasio keuangan harga sahampada saham-saham lq45 bursa efek jakarta 598 studi mengenai dampak pengumuman laporan keuangan triwulan volume saham lq-45 (periode februari 2000 sampai desember 2005) 599 analisa pengaruh pengumuman management departure kesehjateraan pemegang saham (shareholder wealth) bursa efek jakarta 6 analisis perbedaan tingkat pengembalian rata-rata saham sebelum setelah hari-hari libur nasional bursa efek jakarta 6 tinjauan tentang mekanisme pasar modal (bursa efek) suatu pendekatan secara kriminologis 60 kandungan informasi komponen-komponen laba perusahaan perbankan terdaftar bursa efek jakarta 60 persepsi wajib pajak peraturan pemerintah (pp) nomor 14 tahun 1997 dampaknya atas transaksi penjualan saham pendiri bursa efek jakarta (bej) 600 analisis kinerja reksa dana masa booming crash recoverykasus reksa dana pendapatan tetap reksa dana saham periode januari 2004-mei 2006 601 hubungan penerapan corporate governance kinerja perusahaan publik indonesia price to book value price to sales ratio 602 analisa pengaruh economic value added (eva) net operating profit after tax (nopat) cash flow operation (cfo) return abnormal return 603 pengukuran produktivitas menggunakan model value added (asian productivity organization) sebagai dasar evaluasi kinerja perusahaan perbankan kasus pt bank syariah muamalat indonesia tbk 604 analisa hubungan dividen keuntungan perusahaan emiten bursa efek jakarta 605 tingkat volatilitas harga saham setelah penerbitan right issue dibuktikan model garchempiris bursa efek jakarta periode 1999 - 2003 606 analisis pengaruh nilai tukar net income return saham perusahaan manufaktur terdaftar bursa efek indonesia periode 2003-2006 607 analisis transmisi shock volatilitas antar indeks harga saham sektoral indonesia 608 visualisasi perhitungan kontrak opsi saham formula black-scholes 609 analisis penerapan strategi 4 in 1dalam rangka menghadapi kompetisi bisnis telekomunikasi 61 pengaruh indeks harga saham negara-negara asia indeks harga saham gabungan bursa efek jakarta 61 studi analisis pengaruh dividen leverage harga saham bursa efek jakarta 610 prospektus sebagai salah satu sarana komunikasi pasar modal tentang efektivitas prospektus pt bumi modern pt bni 46 611 rancangan program internalisasi nilai-nilai perusahaan pasca akuisisi pt a 612 analisa hubungan pengungkapan corporate governance pengungkapan corporate social responsibility 613 analisis efisiensi pasar bursa efek jakarta tahun 1999-2004 614 efektivitas promosi dua perusahaan (indosat telkomsel) industri telekomunikasi seluler 615 hubungan pengungkapan sukarela perusahaan return saham periode seputar seasoned equity offering perusahaan publik listing bursa efek jakrta 616 strategi kontrarian pasar saham indonesia suatu tinjauan over-reaction hypothesis bursa efek jakarta 617 telaah optimasi struktur modal guna memaksimumkan rentabilitas modal sendiri serta faktor-faktor mempengaruhinyapada perusahaan-perusahaan go public 618 reaksi return volume perdagangan saham publikasi laporan keuangan interimkasus beberapa perusahaan listing pt bej 619 analisis efisiensi perbankan sebelum sesudah menjadi bank listed menggunakan analisis non parametrik 62 overreactions underreactions serta price earnings ratio anomali saham bursa efek jakarta laporan penelitian 62 pengaruh variabel makro kinerja saham propertipenelitian bursa efek jakarta periode 1998-2003 620 pengaruh tahapan siklus hidup perusahaan relevansi nilai informasi laba arus kas 621 hubungan rasio keuangan ukuran perusahaan arus kas laporan keuangan interim tahunan abnormal return saham empiris perusahaan manufaktur terdaftar bursa efek indonesia tahun 2002-2006 622 metode boosting fungsi pengklasifikasi dasar kernel deteksi obyek manusia 623 analisis pengaruh economic value added return on asset return on equity earning per share harga saham market value added (penelitian empiris bursa efek jakarta tahun 2000-2002) 624 aspek hukum bisnis penerbitan obligasi negara ritel (ori) 625 resiliensi saham perbankan bursa efek jakarta (bej) seputar peristiwa teror bom indonesia 626 benarkah arus kas operasi memiliki earnings persistance lebih tinggi dibanding akrual apakah return saham mencerminkan earnings arus kas operasi akrual?kajian empiris bursa efek jakarta 2000-2004 627 analisa korelasi risiko kredit risiko pasar return saham bank-bank indonesia 628 perbandingan pengaruh indikator makroekonomi global indonesia indeks harga saham gabungan (ihsg)dan jakarta islamic index (jii)menggunakan model vektor autoregressive (var) impulse response functions 629 pengaruh rasio-rasio keuangan utama perusahaan harga saham-saham perusahaan terdaftar jakarta islamic index tahun 2004 63 pengaruh pemberitaan laba harga saham volume transaksi bursa efek jakarta (studi empiris 94 perusahaan tahun 1994 hingga 1996) 63 pengaruh rasio keuangan rating issuer pt bursa efek surabaya 630 analisis keikutsertaan perusahaan kelompok jakarta islamic index berdasarkan ketentuan danareksa investment management 631 pengaruh ex-dividend day perilaku harga saham bursa efek jakarta 632 pengaruh struktur kepemilikan saham kebijakan utang perusahaan 633 pengaruh kepemilikan saham struktur modal perusahaan suatu studi empiris pasar modal indonesia 634 faktor-faktor mempengaruhi price earning ratio saham sektor jakarta islamic index 635 analisis pengaruh return on assets dividend payout rasio debt to equity ratio economic value added price book value perusahaan manufaktur bursa efek jakarta 636 analisis faktor faktor mempengaruhi pengelolaan modal kerja perusahaan indonesia (perusahaan terbuka non keuangan kelompok lq 45 periode 2002 2007) 637 eksistensi penitipan kolektif bank kustodian sebagai lembaga penunjang pasar modal pasca pemberlakuan scriptless trading 638 pengaruh perubahan tingkat inflasi nilai tukar uang tingkat suku bunga bebas risiko indeks syariah kinerja reksa dana syariah 639 kebijakan pajak penghasilan final undang-undang pajak penghasilan ditinjau dari prinsip keadilan netralitas pemungutan pajak 64 analisis the monday effect bursa efek jakarta laporan penelitian 64 pengaruh peringkat kredit struktur modal perusahaan-perusahaan non-keuangan indonesia periode 2005-2008 640 determinan debt to equity ratio perusahaan industri makanan minuman bursa efek jakarta 641 pengaruh dividend payout return on equity earning growth kurs rupiah price earning ratio kelompok jii masa kenaikan harga minyakempiris bursa efek jakarta 642 analisis hubungan antra komite audit komisaris independent praktek manajemen labaempiris perusahaan bej 643 pengaruh tingkat disclosure costs of debtempiris atas obligasi tercatat bursa efek surabaya 644 dampak pengumuman right issue shareholder wealth bursa efek jakarta 645 analisis visibilitas momentum strategy pengaruh systematic risk terhadapnya bursa efek jakarta 646 analisis faktor-faktor mempengaruhi likuiditas saham sub-sektor tekstil garmen bursa efek jakarta periode januari 2004 maret 2006 646 analisis volatilitas saham menggunakan model hisvol arch garch saham lq45 tahun 2004 647 analisa kuantitatif kinerja badan usaha milik negara sebelum sesudah penawaran umum perdana bursa efek jakarta 647 pengujian model tiga faktor fama french model dua faktor fama french model capm berdasarkan portfolio industri emiten listing bej 648 analisa pengaruh pengumuman stock split likuiditas saham dilihat dari bid-ask spread volume perdagangan bursa efek jakarta tahun 2000-2002 648 hubungan eva nilai perusahaan pemakmuran pemegang saham uji empiris perusahaan-perusahaan terdaftar bursa efek jakarta periode 1997-2001 649 analisis pengaruh economic value added return on asset return on equity earning per share harga saham market value added penelitian empiris bursa efek jakarta tahun 2000-2002 649 pengaruh pengumuman merger akuisisi return saham perusahaan sektor industri sama periode 1998-2003 bursa efek jakarta 65 pengaruh faktor finansial perusahaan praktik perataan laba (income smoothing) perusahaan manufaktur terdaftar bei (periode tahun 2005 - 2007) 65 peranan profesi akuntan meningkatkan efisiensi bursa efek indonesia 650 analisa relative strength index menentukan sinyal membeli menjual saham industri rokok bursa efek jakarta (juni 1999 - juni 2002) 650 relevansi rasio keuangan harga saham 651 eksistensi peran komite audit perusahaan publik indonesia rangka implementasi good corporate governance 651 faktor-faktor mempengaruhi kebutuhan dana eksternal perusahaan go public bursa efek jakarta berdasarkan kelompok industri periode 2000-2003 652 analisis hubungan jenis kap (big four non big four) pengngkapan sukarela laporan tahunan perusahaan manufaktur terdaftar bursa efek jakarta tahun 2003 652 pengaruh financial leverage earnings per share price earnings ratio harga saham blue chip bursa efek surabaya 653 analisa efek akhir minggu bursa efek jakarta periode 1 januari 1998-31 desember 2000 653 kandungan informasi laba arus kas koperasi akrual laba akan datang hubungannya imbal hasil saham 654 hubungan antara audit firm tenure praktek earnings management perusahaan publik tercatat bursa efek jakarta 654 pengaruh simpanan pihak ketiga kredit diberikan pihak ketiga (survey bank-bank umum terdaftar bursa efek jakarta) 655 analisis harga saham du pont system 655 penggunaan informasi keuangan memprediksi keuntungan investasi bagi investor pasar modal bursa efek surabaya laporan penelitian 656 analisis imbal hasil harian setiap minggu periode perdagangan non perdagangan (studi empiris bursa efek indonesia tahun 2000-2007) 656 perbandingan keakuratan kapital asset pricing model (capm) arbitrage pricing theori (apt) memprediksi tingkat pendapatan saham industri manufaktur sebelum semasa krisis ekonomi bursa efek jakarta laporan penelitian 657 analisis pengaruh implementasi good corporate governance return volatilitas saham 657 perbandingan keakuratan capital asset pricing model (camp) arbitrage pricing theory (apt) memprediksi tingkat pendapatan saham industri perbankan lembaga keuangan selain bank sebelum semasa krisis ekonomi bursa efek jakarta laporan penelitian 658 analisis faktor-faktor mempengaruhi volatilitas imbal hasil saham sektor infrastruktur utilitas transportasi bursa efek jakarta (periode januari 1998 - desember 2005) 658 pengaruh internal control auditee size auditee complexity resiko audit penentuan besarnya audit fee diterima kantor akuntan publik survei kantor akuntan publik mengaudit emiten manufaktur bursa efek jakarta 659 pengaruh pangsa pasar rasio leverage rasio intensitas modal profitabilitas perusahaan real estate property terdaftar bursa efek jakarta 659 pengaruh pengumuman akuisisi tingkat keuntungan liquiditas saham bursa efek jakarta 66 perkembangan bursa efek kaitannya pasar modal 66 respon pasar pengumuman laba tercermin abnormal return terjadi bursa efek jakartaempiris dari januari 2004 hingga juni 2006 660 hubungan income smoothing reaksi pasar atas event pengumuman laba perusahaan terdaftar bursa efek jakarta 660 tinjauan faktor-faktor mempengaruhi jepuasan pemakaian e-filing direktorat jendral pajak (perusahaan -perusahaan terdaftar bursa eek jakarta) 661 analisis leverage operasi faktor faktor berhubungan struktur modalkasus perusahaan-perusahaan go publik bej berorientasi ekspor masa sebelum selama krisis ekonomi 661 pengaruh rasio-rasio keuangan tingkat inflasi harga saham perusahaan industri go public pt bursa efek jakarta 662 analisis kinerja perusahaan kinerja saham perusahaan sebelum sesudah memperoleh setifikasi iso 9001 2000 perusahaan manufaktur bursa efek indonesia 662 analisis rasio keuangan mempengaruhi return saham lq45 penelitian empiris bej periode 2003-2005 663 hubungan antara manajemen laba tingkat pengungkapan laporan keuangan 663 pengaruh insider ownership collateralizable assets growth in net assets likuiditas kebijakan dividen perusahaan manufaktur listing bursa efek indonesia periode 2002-2006 664 pengaruh pengumuman pembentukan indeks ftse/asean return volume transaksi bursa efek jakarta 664 pengujian stabilitas struktural pengaruh growth potensial earnings variabilitytax shields firm size profitability leverage ratio perusahaan tekstil garmen bursa efek jakarta sebelum selama krisis ekonomi 665 analisa beberapa faktor fundamental makroekonomi mempengaruhi risiko sistematis (beta) 665 pengaruh persistensi laba laba negatif koefisien respon laba koefisien respon nilai buku ekuitas perusahaan manufaktur bursa efek jakarta 666 analisa kebijakan dividen kebijakan struktur permodalan arus kas mendatang 666 pengaruh variabel keuangan return awal return 15 hari setelah ipo serta moderasi besaran perusahaan hubungan antara variabel keuangan return awal return 15 hari setelah ipo bursa efek jakarta 667 analisis pengaruh perubahan tarif pajak penghasilan badan kebijakan dividen struktur modal perusahaan terdaftar bursa efek indonesia tahun 1998-2005 667 pengaruh variabel keuangan return awal return 15 hari setelah ipo serta moderasi besaran perusahaan hubungan antara variabel keuangan return awal return 15 hari setelah ipo bursa efek jakarta 668 analisis pengaruh penerbitan obligasi abnormal return saham bursa efek jakartaperiode 2000-2006 668 komitmen profesi komitmen organisasi sebagai variabel intervening hubungan antara etika kerja islami sikap perubahan organisasi empiris auditor internal perusahaan manufaktur terdaftar bursa efek jakarta 669 analisis kinerja portofolio saham syariah bursa efek jakarta tahun 2001-02 669 perubahan lingkungan strategi profesi akuntan publik menghadapi scripless trading pasar modal kaitannya penciptaan good governance' 67 analisis pengaruh faktor fundamental mikro kondisi ekonomi return saham perusahaan manufaktur listed bursa efek jakarta metode intervaling periode 2003-2006 67 pengembangan bursa efek indonesia kerangka pasar modal 670 pengaruh asimetri informasi disclosure cost of capital (studi perusahaan listing bei) ika fitriasih 670 pengaruh return on assets (roa) return on equity (roe) return on investment (roi) debt to equity ratio (der) book value (bv) per share harga saham properti bej 671 aspek juridis transaksi derivatif pasar modal 671 pengaruh struktur kepemilikan publik praktik pengelolaan perusahaan jenis industri ukuran perusahaan profitailitas risiko keuangan tindakan perataan labaempiris industri listing bursa efek jakarta 672 hubungan strategi outsourcing information technology keberhasilan outsourcing information technology (studi empiris perusahaan-perusahaan terdaftar bej) 672 perbandingan akrual pajak tangguhan pengujian aliran kas masa datang return sahampadaperusahaan manufaktur terdaftar bursa efek jakarta periode 200-2004 673 analisis comparative kinerja bank syariah mandiri bank mandiri konvensional menggunakan analisis z- score bursa efek indonesia tahun 2004 2006 673 pengaruh harga minyak dunia tingkat suku bunga sertifikat bank indonesia kurs rp/usd indeks harga saham gabungan bursa efek indonesia 674 analisis pengaruh tingkat suku bunga sbi kurs tengah bi tingkat inflasi indeks saham dow jones new york stock exchange memprediksi indeks harga saham gabungan bursa efek jakarta 674 analisis strategi investasi lump-sum dollar-cost averaging saham periode tahun 2001-2005 bursa efek jakartakasus saham pt indosat tbk pt telekomunikasi indonesia tbk 675 analisis faktor-faktor mempengaruhi credit spread obligasi korporasi pasar obligasi indonesia 675 pengujian stabilitas struktural pengaruh growth potential earnings variability tax shields firm size profitability leverage ratio perusahaan tekstil garmen bursa efek jakarta sebelum sesudah krisis ekonomi 676 faktor-faktor mempengaruhi price earning ratio bursa efek jakarta pendekatan constant dividend growth model 676 pengaruh tingkat kecanggihan teknik-teknik capital budgeting diterapkan prestasi ekonomi perusahaan-perusahaan go-public terdaftar bursa efek surabaya 677 analisis pengaruh dari return on assets return on equity earning per share profit margin assets turn over rasio leverage debt to equity ratio return sahamstudy saham-saham termasuk lq-45 bursa efelk jakarta tahun 2001 677 efisiensi emisi saham baru bursa efek jakarta (1989-1994) 678 analisis hubungan pengaruh economic value added imbal hasil saham-saham perbankan bursa efek jakarta periode 1999-2003 678 rasionalitas investor pemilihan saham penentuan portfolio model indeks tunggal bej 679 analisa arus kas tingkat pengembangan saham bursa efek jakarta 679 pengaruh hubungan kesempatan pertumbuhan variabel makro kinerja saham-saham perusahaan ritel bursa efek jakarta periode 1999-2003 68 analisis pengaruh reputasi auditor proporsi dewan komisaris independen leverage kepemilikan manajerial proporsi komite audit independen manajemen laba (studi perusahaan manufaktur bursa efek indonesia periode 2004 - 2006) 68 membangun jaringan intranet bursa efek surabaya 680 analisis sumber dana perusahaan pengaruhnya rentabilitas modal sendiripada perusahaan jasa perbankan industri farmasi rokok bursa efek surabaya 680 restrukturisasi finansial perusahaan publik analisis perubahan debt-to-equity ratio perusahaan publik bursa efek jakarta 681 analisis kinerja keuangan industri perbankan indonesia (studi empiris industri perbankan terdaftar bursa efek indonesia) 681 analisis pengaruh investasi liquiditas profitabilitas pertumbuhan perusahaan ukuran perusahaan kebijakan deviden payout ratio (studi empiris perusahaan manufaktur terdaftar bei) 682 analisis kinerja keuangan rasio camel sebagai prediktor kesehatan bank (studi empiris perbankan go public terdaftar bursa efek jakarta tahun 2004-2005) 682 analisis kinerja perusahaan setelah melakukan rights issue bursa efek jakarta/ muhammad yusuf 683 analisis anomali calendar effects tiga bursa efek asia periode 2000-2007 683 rasio keuangan memprediksi pertumbuhan laba (studi empiris perusahaan manufaktur terdaftar bursa efek indonesia) 684 penentuan saham paling mengguntungkan menggunakan pendekatan capital asset pricing model (capm) 10 biggest market capitalization (bej) 684 reaksi investor pengumuman penerbitan obligasi bursa efek jakarta 685 analisis kinerja keuangan perusahaan melakukan merger akuisisi 685 analisis pergerakan harga saham industri keuangan terdaftar bursa efek indonesia periode januari 1999-desember 2007 686 analisis kemampuan beta sebagai indikator risiko proksi return indeks saham sektoral bursa efek jakarta tahun 2004-2007 686 pengaruh kinerja keuangan harga saham 687 analisis kinerja perusahaan merger akuisisi diproksikan rasio keuangan bursa efek jakarta tahun 2000-2002 687 pengaruh kepemilikan manajerial pilihan jangka waktu hutang studi bursa efek indonesia 688 analisis pemilihan alternatif pendanaan konsep sustainable growth rate 688 probability default model perusahaan listed bursa efek indonesia(bei) tahun 2001-2007 689 informasi fundamentalimplikasi prediksi laba pertimbangan moneter bank sentral selama periode 1998-2001 bursa efek jakarta 689 pengujian the day of the week effect january effect pre-holiday effect bursa efek jakarta 69 pengaruh rasio keuangan laba perusahaan manufaktur terdaftar bei 69 persyaratan pencatatan perusahaan pertambangan bursa efek surabaya ditinjau dari perspektif geologi pertambangan 690 pengaruh pengumuman corporate governance perception index (cgpi) volume return saham perusahaan terdaftar bursa efek jakarta 690 tanggung jawab hukum hembaga profesi penunjang pasar modal melindungi investor 691 gambaran pengetahuan karyawan pusat komputer elektronik mangga dua mengenai emergency response plan tahun 2008 691 pengaruh stock split likuiditas saham bursa efek jakarta 692 analisis pengaruh rasio-rasio keuangan return saham perusahaan sektor keuangan bursa efek indonesia 692 relevansi penentuan price earning ratio keputusan investasi bursa efek jakarta 693 analisis manfaat rasio keuangan memprediksi pertumbuhan laba perusahaan manufaktur terdaftar bursa efek jakarta 693 pengaruh perbedaan kebijakan makro aspek-aspek fundamental price earning ratio (per) (analisis perusahaan manufaktur bursa efek jakarta) 694 analisis dampak pengumuman right issue harga saham bursa efek indonesia 694 pengujian teori pecking order teori static tradeoff struktur modal emiten bursa efek jakarta 695 pengumuman dividen serta dampaknya stock return future earning perusahaan lq 45 bursa efek jakarta 695 perilaku harga saham perusahaan agribisnis bursa efek jakarta 696 analisis pengaruh risiko sistematis book to market value return saham bursa efek jakarta (2004-2006) 696 kajian spread tick size saham teraktif bursa efek jakarta 697 pengaruh pengumuman harga bbm industri (non subsidi) indeks harga saham bursa efek indonesia 697 return awal return jangka panjang saham ipo serta kinerja operasi perusahaan pasca ipo (studi empiris perusahaan melakukan penawaran umum perdana tahun 2000-2004 bursa efek jakarta) 698 pengaruh harga minyak dunia volume transaksi indeks harga saham gabungan (ihsg) bursa efek indonesia 698 pengukuran kecukupan dana jaminan transaksi bursa pasar modal indonesia metode stress testing 699 analisis penilaian harga saham pendekatan price book value perusahaan go public bursa efek jakarta 699 pengaruh asymmetric information kebijakan dividen studi bursa efek indonesia 7 pengaruh likuiditas saham volume perdagangan perusahaan go public terdaftar bursa efek jakarta (studi empiris perusahaan go public bej tahun 2005) 7 upaya meningkatkan kemampuan penyidik menangani kejahatan pasar modal bursa efek jakarta 70 analisis perbedaan volume perdagangan saham-saham optimal jakarta islamic index (jii) bursa efek indonesia (bei) 70 audit delay industri real estate properti terdaftar bursa efek jakarta faktor mempengaruhi 700 pengaruh working capital profitabilitas perusahaan sektor industri real estate property terdaftar bursa efek jakarta 700 studi empiris atas kualitas pengungkapan (disclosure) laporan tahunan pengaruhnya dispersi harga saham perusahaan tercatat bursa efek jakarta 701 analisa abnormal return sekitar tanggal pengumuman merger akuisisipengujian empiris bursa efek jakarta 701 reaksi intra industri pengumuman stock split determinan transfer informasi bursa efek jakarta 702 analisis faktor-faktor mempengaruhi tingkat underpricing penawaran umum perdana bursa efek jakarta 702 aplikasi model black-scholes memprediksi nilai kontrak opsi saham bursa efek jakarta 703 analisis kinerja portofolio saham berdasarkan price-earning growth ratio studi bursa efek indonesia 703 analisis penggabungan usaha akuisisi dari sudut perpajakan (pt bank cic internasional tbk pt jakarta setiabudi internasional tbk) 704 analisis kinerja reksadana pendapatan tetap bursa efek indonesia periode sebelum sesudah subprime mortgage crisis 704 pengaruh pengumuman dividen return saham pendekatan estimasi market model bursa efek jakarta 705 analisis kinerja reksa dana saham sebagai alternative investasi jangka panjangkasus reksa dana saham periode 2003-2005 705 pengaruh pengumuman upgrade downgrade peringkat obligasi return saham bursa efek indonesia 706 analisis faktor size value industri menjelaskan variasi return saham bursa efek jakarta 706 perbandingan antara kinerja keuangan berdasarkan laporan basis akrual laporan arus kas serta hubungannya imbal hasil sahamkomparatif sebelum masa krisis ekonomi 707 analisa perbandingan beberapa kinerja akuntansi hubungannya perubahan cumulative abnormal return 707 panic selling bursa efek indonesia 708 faktor-faktor mempengaruhi perumahan harga saham perusahaan katagori top gainer top looser pt bursa efek jakarta 708 sensitivitas harga saham tingkat suku bunga bursa efek indonesai 709 pengaruh roa npl car nim eva industri perbankan bursa efek jakarta antara tahun 2001-2006 709 reaksi bursa saham indonesia peristiwa pemilu 1999 (event study peristiwa pemilu 7 juni 1999) 71 analisis fenomena efek januari bursa efek jakarta periode 1997-2001 71 pengaruh sensitivitas kekayaan eksekutif manajemen laba corporate governance sebagai variabel moderating perusahaan terdaftar bursa efek indonesia (bei) tahun 2005 2007 710 pengaruh tindakan merger akuisisi abnormal return saham perusahaan pengakuisisievent study bej periode tahun 2001-2005 710 pengaruh variabel makroekonomi return pasar saham kasus bursa efek indonesia 711 pengaruh variable ekonomi makro return pasar tingkat kesehatan bank kinerja saham perbankan (penelitian empiris bej periode 1998-2004) 711 strategic default credit spreads studi empiris perusahaan non keuangan bursa efek indonesia 712 analisis pengaruh likuiditas saham tingkat leverage risiko sistematik return saham (survey perusahaan consumer goods terdaftar bej) 712 pengaruh pengumuman dividen harga saham sebelum sesudah ex-dividend date bursa efek indonesia 713 day of the week effect daily market return bej periode 1983-2004 713 resiko sistematis (beta) saham kondisi pasar bullish atau bearish bursa efek indonesia 714 analisis hubungan suku bunga sbi pertumbuhan kredit perkembangan pasar modal 714 strategi kebijakan leverage perubahan peringkat obligasi bursa efek jakarta 715 aspek hukum peranan kawasan berikat disuatu kawasan industri memacu perekonomian indonesia menyongsong era afta dikaitkan pencanangan tahun investasi 2003kasus kawasan industri mm 2100 cibitung bekasi 715 weekend effect bursa efek indonesia tahun 2002-2006 716 analisis dampak internal return estimasi resiko sistematis studi empiris bursa efek jakarta 2004-2006 716 penerapan arbitrage pricing theory bursa efek jakarta 717 aplikasi strategi short-run momentum long-run reversal (contrarian) kondisi pasar up down (telaah model behavioral) 717 prediksi kondisi financial distress perusahaan manufaktur terdaftar bursa efek jakarta (bej) menggunakan analisis diskriminan 718 analisis pengaruh tingkat keepmilikan investor asing return saham volume perdagangan saham bursa efek indonesia 718 pengelolaan dana reksa dana (investment trust) indonesiasuatu analisa pendekatan capital asset pricing model 719 analisis faktor-faktor penentu penerapan esop perusahaan terdaftar bursa efek jakarta 719 analisis rasio keuangan memprediksi pertumbuhan laba perusahaan manufaktur go public bei 2005-2007 72 analisis model volatilitas return saham (saham lq 45 bursa efek jakarta) 72 analisis tentang struktur modal perusahaan-perusahaan bursa efek jakarta 720 analisis rasio keuangan sebagai penilai kinerja pabrik semen (pt semen gresik tbk pt indocement tunggal prakasa tbk) 720 effect of ownership structure to firms debt policy empirical evidence from bursa efek jakarta 721 pengaruh informasi akuntansi harga saham (studi empiris perusahaan manufaktur terdaftar bej) 721 pengaruh pengumuman right issue kinerja harga saham likuiditas saham bursa efek indonesia periode 2006-2007 722 analisis hubungan kebijakan dividen investasi pendanaan studi empiris bursa efek jakarta 722 kemampuan informasi keuangan memprediksi laba arus kas masa akan datang 723 pengaruh perataan laba reaksi pasar resiko investasi perusahaan terdaftar bei 723 perlindungan hukum investor pengguna sistem s-smart perdagangan saham bursa efek surabaya/ lolita permanasari 724 analisa gejala weekend effect return saham lq 45 bursa efek indonesia periode 2004-2007 724 pengaruh struktur modal profitabilitas perusahaan kelengkapan pengungkapan (disclosure) laporan keuangan (studi empiris perusahaan terdaftar bei) 725 analisis hubungan kausalitas bursa global bursa efek indonesia uji granger causality var (vechtorauthoreggession) periode januari 2004 - mei 2009 725 pengaruh eps (earning per share) roi (rate of return on investment) roe (rate of return on equity) npm (net profit margin) harga saham bei selama tahun 2007 pengaruh rasio profitabilitas harga saham perusahaan manufaktur bei tahun 2002-2006 726 penggunaan chaos theory menganalisis perilaku indeks harga saham gabungan bursa efek jakarta 727 analisis faktor-faktor mempengaruhi devidend payout ratio perusahaan manufaktur bursa efek indonesia 2005 - 2007 727 analisis pengaruh likuiditas profitabilias pertumbuhan perusahaan kebijakan dividend payout ratio (studi empiris perusahaan manufaktur terdapat bej tahun 2001 2006) 728 dampak pengumuman laporan keuangan variabilitas tingkat keuntungan saham memperhatikan laba akuntansi 728 pengaruh indeks harga saham gabungan (ihsg) bursa efek jakarta (bej) nilai 729 analisis kinerja keuangan perusahaan rokok terdaftar bursa efek indonesia tahun 2007 729 pengaruh price earning ratio volume penjualan suku bunga sbi return saham (study empiris perusahaan manufaktur bei tahun 2004-2007) 73 firms' characteristics affecting the level of voluntary dislosure of indonesian companies listed on the jakarta stock exchange 73 pengaruh publikasi laporan keuangan tahunan harga saham bursa efek jakarta 730 analisa price earning ratio (per) menurut model intrintik model rasio harga pasar pasa pt semen gresik (persero) tbk bursa efek jakarta dari januari 1993 s/d desember 1998 730 analisis indikasi earnings management perusahaan manufaktur laba perusahaan manufaktur rugi indonesia (ditinjau dari laporan keuangan tahunan periode tahun 2002-2004) 731 dampak go public bagi peningkatan kinerja keuangan perusahaan (bursa efek jakarta) 731 pengaruh asimetri informasi ukuran perusahaan praktik manajemen laba (studi perusahaan manufaktur bei 732 analisis pilihan perusahaan akuntansi konservatif 732 pengaruh faktor-faktor internal perusahaan harga saham (suatu studi atas dividen laba bersih per saham price earning ratio emiten-emiten terdaftar bursa efek jakarta tahun 2000) 733 analisis hubungan pergerakan nilai tukar perubahan harga saham sebagai pendekatan pengukuran economic exposure kelompok perusahaan industri consumer goods bursa efek jakarta 1998-2000 733 penggunaan informasi laba arus kas memprediksi laba masa akan datang 734 fenomena excess return penawaran umum saham baru (bursa efek jakarta periode 1998-2000) 734 pengaruh kepemilikan manajerial kepemilikan institusional kebijakan hutang perusahaan perusahaan manufaktur bej periode 2004-2006 735 pengaruh motivasi hubungan antara partisipasi penyusunan anggaran kinerja manajerial (survai perusahaan manufaktur sukoharjo) 735 penilaian harga wajar saham badan usaha milik negara (bumn) manufaktur bursa efek jakarta periode 1998-2002 736 korelasi likuiditas perusahaan laba akrual arus kas operasi perusahaan perdagangan besar barang produksi terdaftar bursa efek jakarta 736 pengaruh insider ownership dividend payout ratio return on investment debt ratio 737 analisa fluktuasi indeks harga saham bursa efek jakarta selama periode 1994-1997 737 perbedaan discretionary accruals antara perusahaan manufaktur laba perusahaan manufaktur rugi 738 analisis kinerja keuangan menggunakan metode economic value added market value added industri teknologi informasi perusahaan terdaftar bursa efek jakarta 738 kemampuan informasi laba arus kas memprediksi earnings masa akan datang (studi empiris perusahaan manufaktur terdaftar bei) 739 analisis pengaruh kapitalisasi pasar tingkat inflasi tingkat suku bunga sbi return saham (studi perusahaan bergerak bidang finansial bei) 739 pengaruh pengumuman merjer akuisisi return saham perusahaan pengakuisisi bursa efek jakarta tahun 2000-2002 74 pengaruh intellectual capital kinerja keuangan pertumbuhan nilai pasar perusahaan tercatat bursa efek indonesia 74 pengaruh kinerja keuangan perubahan harga saham perusahaan perbankan bursa efek jakarta 740 pengaruh nilai tukar rupiah suku bunga inflasi indeks harga saham sektor (ihss) keuangan bursa efek jakarta selama periode 2000-2005 740 pengaruh pengumuman merger akuisisi kinerja perusahaan publik bei tahun 2001 - 2006 741 analisis pengaruh kinerja setelah merger akuisisi perusahaan terdapat bursa efek jakarta 741 perbedaan pengaturan laba antara perusahaan laba perusahaan rugi (studi empiris perusahaan manufaktur terdaftar bei) 742 analisis pengaruh struktur modal peningkatan laba kebijakan dividen serta pengaruh kebijakan dividen tersebut harga pasar saham bursa efek jakarta pt telekomunikasi indonesia tbk periode 2001-2005 742 pengaruh eva rasio profitabilitas perubahan harga saham perusahaan manufaktur terdaftar bei tahun 2007 743 asas praduga tak bersalah pemberitaan media cetak analisa kasus pemberitaan peledakan bom bursa efek jakarta 743 pengaruh rasio profitabilitas likuiditas leverage dividend payout ratio (studi empiris perusahaan manufaktur bej) 744 keterkaitan biaya upah langsung biaya produksi tidak langsung (studi empiris perusahaan go public bursa efek jakarta) 744 pengaruh publikasi pemecahan saham (stock split) return saham 745 pengaruh good corporate governance kinerja perusahaan (pada perusahaan go publik terdaftar bei) 745 pengaruh nilai tukar rupiah dolar amerika suku bunga sbi indeks harga saham gabungan (ihsg) bursa efek jakarta 746 analisa pengaruh kebijakan manajemen struktur permodalan riset perusahaan terbuka bej 746 pengaruh kinerja keuangan perusahaan tingkat kemahalan harga saham keputusan pemecahan saham 747 analisis pengaruh return on investment operating cash flow economic value added return saham (studi perusahaan terdaftar bursa efek jakarta tahun 2001 2002) 747 penggunaan informasi laba arus kas memprediksi laba masa akan datang 748 analisis pengumuman dividen pengujian efesiensi pasar modal secara informasi bei 748 tinjauan analisis atas nilai layak saham pt kimia farma (persero) tbk 749 pengaruh fluktuasi nilai tukar rupiah fluktuasi return saham perusahaan telekomunikasi indonesia go public bursa efek jakarta periode tahun 1999-2003 749 pengaruh pengumuman dividen perubahan harga saham volume perdagangan saham perusahaan manufaktur bei tahun 2007 75 analisis model volatilitas return sahamkasus saham lq 45 bursa efek jakarta 75 pengaruh hari libur nasional return saham harian bursa efek jakarta 750 analisis faktor-faktor mempengaruhi dividend payout ratio perusahaan go public listed bursa efek jakarta 750 analisis kebijakan dividen pengaruhnya harga saham perusahaan manufaktur indonesia masuk bursa efek jakarta 751 analisis beberapa variabel mempengaruhi tingkat pengembalian investasi saham indonesia periode februari 1995-mei 1997 751 analisis pengaruh financial leverage return on equity earning per share perusahaan saham teraktif bursa efek jakarta 752 analisis pengaruh return on equity dividend payout ratio earnings growth rate price to book value ratio bursa efek jakarta tahun 2001 752 peranan bapepam menangani tindak pidana manipulasi pasar pasar modal indonesia 753 analisis keterkaitan secara simultan antara kebijakan dividen kebijakan hutang perusahaan terdaftar bursa efek jakarta periode tahun 2000 - 2002 753 kondisi anomali emisi saham perdana (ipo) pasar modal indonesia serta faktor-faktor mempengaruhi (pendekatan wipo model) 754 analisis pengaruh rasio profitabilitas harga saham perusahaan industri telekomunikasi bursa efek jakarta 754 korelasi antara variable ekonomi makro jakarta islamic index harga saham gabungan bursa efek jakarta (periode 2002-2005) 755 analisis risiko investasi portofolio saham melalui diversifikasi jangka waktu kepemilikan jenis saham periode tahun 2000?2003 bursa efek jakarta 755 studi empiris struktur modal perusahaan go public indonesia 756 analisis perbedaan kondisi keuangan sebelum sesudah go public kasus perusahaan industri manufaktur terdaftar bursa efek jakarta tahun 1994 sampai tahun 2002 756 pengaruh penerapan good corporate governance kinerja pasar perusahaan-perusahaan indonesia penelitian empiris bursa efek jakarta periode 2000-2004 757 analisis penentuan portfolio optimal investasi saham-saham bursa efek jakarta (kategori industri barang konsumsi) th 2001-2003? 757 faktor-faktor mempengaruhi kaitan antara pengumuman laba perkembangan harga saham perusahaan go public bursa efek jakarta 758 pembentukan efficient frontier pt bursa efek jakarta periode 2002 2004 758 pembentukan portfolio optimal atas saham-saham diminati oleh reksa dana bursa efek jakarta 759 analisis pengaruh devidend payout ratio earning per share systematic risk harga saham terdaftar bursa efek jakarta selama tahun 2002 759 dampak perubahan suku bunga sbi suku bunga fed fund laju inflasi nilai tukar rupiah transaksi investor asing domestik bursa efek jakarta 76 corporate governance profitabilitas; pengaruhnya pengungkapan tanggung jawab sosial perusahaan (studi empiris perusahaan tercatat bursa efek indonesia) 76 pengaruh kinerja keuangan return saham perusahaan manufaktur bursa efek (bej) 760 injauan analisa atas harga layak saham pt tempo scan pacific tbk periode 2000 2002 suatu 760 pengaruh faktor-faktor makroekonomi tingkat pengembalian pasar imbal hasil reksa danadengan mengunakan vector autoregression 761 dampak pengumuman right issue abnormal return saham lq45 bursa efek jakarta (bej) periode tahun 2001 2005 761 estimasi nilai call option berdasarkan formula black scholes saham-saham optimum bursa efek jakarta 762 analisis pengaruh kualitas underwriter kualitas emiten underpriced ipo saham biasa perusahaan go public bej periode 2000-2005 762 pengaruh struktur kepemilikan ukuran perusahaan praktek corporate governance pengelolaan laba (earnings management) kekeliruan penilaian pasar 763 analisis pengaruh kualitas underwriter kualitas emiten underpriced ipo saham biasa perusahaan go public bej periode 2000-2005 763 tinjauan studi estimasi beta saham perusahaan-perusahaan go-publik bursa efek jakarta 764 analisis pengaruh struktur kepemilikan perusahaan agency cost perusahaan-perusahaan go-public bursa efek jakarta tahun 2004 764 peramalan volatilitas imbal hasil saham sektor tekstil garmen bursa efek jakarta menggunakan model arch/garch periode januari 1998-desember 2005 765 analisis faktor-faktor mempengaruhi price earning ratio perusahaan-perusahmn terdaftar bursa efek jakarta 765 tingkat perolehan sekuritas pasar modal indonesia 766 analisis investasi portofolio bursa efek jakarta periode tahun 1997-1999 (emiten lq-45) 766 tinjauan yuridis margin trading sebagai salah satu bentuk transaksi perdagangan efek pasar modal indonesia 767 pengaruh faktor agency cost faktor biaya transaksi rasio pembayaran deviden perusahaan (study empiris perusahaan manufaktur bej) 767 pengaruh risiko tingkat pengembalian menggunakan metode capm studi empiris bej 768 kemampuan informasi akuntansi memprediksi laba arus kas masa akan datang 768 pengaruh earning per share (eps) return on equity (roe) suku bunga sbi harga saham pt timah indonesia periode 2000-2004 769 analisis rasio camel menilai kesehatan perbankan (bank go public terdaftar bej) 769 pengaruh stock split earnings (penelitian perusahaan property real estate tercatat bursa efek indonesia) 77 analisis pengaruh beberapa faktor eksternal perusahaan imbal hasil saham bursa efek jakarta 77 demutualisasi bursa efek indonesia 770 analisis pengaruh return on investment (roi) current ratio (cr) debt equity ratio (der) earnings per share (eps) devidend payout ratio (dpr) perusahaan go public bursa efek jakarta 770 analisis perbedaan kinerja rasio keuangan perbankan perasuransian (studi empiris bei 2004-2005) 771 pengaruh komitmen kepuasan kerja auditor motivasi sebagai variabel intervening (survey auditor kap wilayah jawa tengah) 771 perbandingan kapitalisasi pasar portofolio saham winner losser saat terjadi anomali winner-losser 30 saham perusahaan papan utama (main board) 30 saham perusahaan papan pengembangan (development board) bursa efek jakarta 772 pengaruh kandungan informasi komponen laporan arus kas (arus kas investasi arus pendanaan) laba kotorsize perusahaan price earning ratio expected return saham (studi empiris perusahaan industri barang konsumsi bursa efek jakarta) 772 perbedaan reaksi pasar antara perusahaan perata laba bukan perata laba perusahaan terdaftar bei 773 pengaruh capital adequacy ratio (car) loan to deposit ratio (ldr) non performing loan (npl) net interest margin (nim) profitabilitas bank umum terdaftar bursa efek jakarta 773 pengaruh economic value added market value added rasio profitabilitas perusahaan harga saham perusahaan manufaktur terdaftar bei (2003-2005) 774 analisis faktor-faktor mempengaruhi deviden payout ratio perusahaan manufaktur terdaftar bei 2004-2005 774 pengaruh faktor inflasi tingkat suku bunga sertifikat bank indonesia (sbi) nilai tukar rupiah harga saham perusahaan consumer goods induntry go public bursa efek indonesia 775 analisis rasio keuangan memprediksi kesehatan perbankan (perbankan go publik terdaftar bei) 775 pengaruh curren ratio (cr) debt to equity ratio (der) rentabilitas ekonomi (re) returt on equity (roe) dividend per share (dps) perusahaan manufaktur terdapat bursa efek indonesia 776 analisis hubungan informasi laba akuntansi nilai buku total arus kas ukuran modal harga saham studi relevansi nilai perusahaan manufaktur terdaftar bursa efek jakarta indonesia 776 analisis pengaturan laba (earnings management) menghindari kerugian perusahaan go public indonesiadeteksi berdasarkan beban pajak tangguhan 777 dampak pengumuman perubahan dividen volume perdagangan saham variabilitas tingkat keuntungan saham (studi empiris perusahaan go publik terdaftar bei) 777 pengaruh perubahan tingkat bunga deposito kurs valuta asing dividend capital gain (loss) perusahaan listing bursa efek jakarta 778 analisis pengaruh return on investment (roi) current ratio (cr) debt to equity ratio (der) earnings per share (eps) devidend payout ratio (dpr) perusahaan go public bursa efek jakarta 778 analisis perubahan rasio keuangan memprediksi laba mempertimbangkan size effect (perusahaan manufaktur go publik bej) 779 analisis pengaruh faktor-faktor keuangan non keuangan pengungkapan sukarela laporan keuangan tahunan perusahaan manufaktur terdaftar bei 779 perbandingan kapitalisasi pasar portofolio saham winner losser saat terjadi anomali winner-losser perusahaan property real estate bursa efek indonesia 78 analisis faktor-faktor mempengaruhi struktur modal perusahaan publik bursa efek jakarta 78 pengaruh variabel ekonomi makro tingkat pengembalian pasar bursa efek jakarta 780 analisis pengaruh current ratio leverage ratio inventory turn over dividend payout ratio perusahaan manufaktur bursa efek indonesia 780 pengaruh informasi laporan arus kas return saham studi perusahaan manufaktur bei) 781 analisis pengaruh beberapa faktor fundamental return saham 781 kinerja return saham bumn non bumn penawaran perdana bursa efek indonesia (bei) (tahun 2003-2006) 782 analis pengaruh variabel-variabel fundamental mempengaruhi harga saham perusahaan manufaktur bei tahun 2003-2007 782 analisis hubungan tingkat kesehatan perusahaan potensi kebangkrutan perusahaan bergerak bidang perdagangan jasa terdaftar bursa efek indonesia 783 pengaruh economic value added (eva) profitabilitas perusahaan return pemegang saham perusahaan manufaktur bei 783 pengaruh nilai tukar rupiah volume perdagangan tingkat suku bunga tingkat inflasi harga saham seluruh perusahaan terdaftar bursa efek indonesia 784 pengaruh likuiditas profitabilitas ukuran perusahaan potensi pertumbuhan perusahaan arus kas dividend payuot ratio perusahaan manufaktur bursa efek indonesia 784 pengaruh rasio profitabilitas return saham perusahaan manufaktur (studi empiris perusahaan manufaktur bei tahun 2004-2007) 785 analisis pengaruh klasifikasi perdagangan dua papan discretionary accruals perusahaan perbankan 785 pengaruh kebijakan dividen nilai perusahaan perusahaan kelompok lq45 bursa efek indonesia 786 analisis indikasi earnings management laporan keuangan tahunan perusahaan publik indonesia periode 2002 2006 (studi empiris perusahaan manufaktur terdaftar bei) 786 pengaruh tingkat perputaran modal kerja struktur moda; umur perusahaan skala perusahaan profitabilitas perusahaan industri property and real estate bursa efek indonesia 787 analisis komparasi metode camel memprediksi kesehatan z-score memprediksi kebangkrutan perbankan go public 787 pengaruh mekanisme corporate governance kualitas laba (studi empiris perusahaan manufaktur terdaftar bursa efek indonesia) 788 analisis hubungan return saham earning cash flow jangka panjang bursa efek jakarta 788 pengaruh harga saham tingakat bunga deposito capital gain/loss volume transaksi saham blue chips bursa efek indonesia 789 analisis moderasi set kesempatan investasi (ios) hubungan antara dividen aliran kas bebas struktur kepemilikan tingkat leverage perusahaan suatu empiris perusahaan listing bursa efek indonesia 789 faktor-faktor mempengaruhi resiko sistematis kasus perusahaan go publik bursa efek jakarta 79 analisis harga saham perdana efisisensi pasar modal bursa efek jakarta 79 pengaruh price earning ratio risiko return saham perusahaan manufaktur terdapat bursa efek jakarta 790 analisis pengaruh tingkat perputaran modal kerja struktur modal umur perusahaan profitabilitas perusahaan food and beveragesapparel and other textile products automotive and allied products wholesale and retail trade bursa efek jakarta 790 analisis perbedaan kinerja keuangan perusahaan sebelum sesudah go-public serta pengaruhnya tingkat hasil saham pasar modal indonesia thailand jepang 791 pengaruh mekanisme good corporate governance ukuran perusahaan (firm size) umur perusahaan pratik manajemen laba perusahaan manufaktur terdaftar bursa efek indonesia 791 penggunaan obligasi sebagai wahana investasi pendanaan pasar modal 792 analisa harga saham pt medco energi internasional metode fcff ps radio 792 pengaruh current ratio debt to equity ratio return on quity ratio harga saham perusahaan manufaktur go public bursa efek indonesia 793 hubungan asiosiasi proksi investment opportunity set (ios) kebijakan dividen kebijakan hutang profitabilitas pendekatan common factor analysis studi bursa efek jakarta periode 2003-2006 793 strategi pembentukan portfolio minimum markowitz menggunakan nilai eva/mva sebagai kriteria pemilihan saham 794 analisis pengaruh roi eva mva kasus perusahaann industri jasa telekomunikasi tranportasi 794 pengaruh konsentrasi kepemilikan ukuran perusahaan leverage mekanisme corporate governance manajemen laba perusahaan konstruksi real estate property terdaftar bursa efek indonesia 795 optimasi risk-return portofolio obligasi pemerintah menggunakan metode efficient frontier value-risk 795 pengaruh asimetri informasi ukuran perusahaan (firm size) praktik manajemen laba perusahaan manufaktur terdaftar bursa efek indonesia 796 kandungan informasi angka akuntansi estimasi beta saham bursa efek jakarta 796 pengaruh karakteristik perusahaan kinerja keuangan tindakan perataan laba dilakukan oleh perusahaan-perusahaan terdaftar bei (studi empiris perusahaan public listing bursa efek indonesia 797 analisa hubungan pengelolaan laba melalui akrual harga saham perdana perusahaan dampaknya kinerja perusahaan setelah penawaran umum perdana 797 analisis pengaruh mekanisme corporate governance kinerja perusahaan ketepatan waktu pelaporan keuangan perusahaan manufaktur terdaftar bursa efek indonesia 798 analisis kinerja keuanagan metode market value added (mva) economic value added (eva) perusahaan makanan minuman listing bursa efek jakarta 798 analisis pertumbuhan sambungan telepon indonesia pendekatan sistem neraca sosial ekonomi 799 analisis pengaruh struktur modal struktur aktiva ukuran perusahaan nilar perusahaan industri tekstil produk tekstil lainnya terdaftar bursa efek indonesia (bei) 799 how bits and bytes work 8 analisa pengaruh total hutang jangka pendek hutang jangka panjang investasi terhadap laba perusahaan (studi empiris perusahaan manufaktur go public indonesia 2003 2005) 8 bursa efek 80 analisis yuridis mengenai transaksi jual beli saham hak membeli kembali (repo) menggunakan saham diperdagangkan bursa efek indonesia 80 pengujian anomali january effect overreaction hypothesis bursa efek jakarta 800 analisis kebijakan hutang kepemilikan manajerial free cash flow menentukan kebijakan dividen perusahaan nonmanufaktur terdaftar bursa efek indonesia 801 analisis pengaruh keputusan pendanaan keputusan investasi perusahaan manufaktur terdaftar bursa efek indonesia 802 pengaruh asset growth debt to equity ratio (der) price earning ratio (per) operating leverage beta saham perusahaan real estate property bursa efek indonesia (bei) 803 analisis pengaruh struktur modal kebijakan dividen perusahaan manufaktur terdaftar bursa efek indonesia (bei) 804 pengaruh size perusahaan profitabilitas solvabilitas proporsi kepemilikan saham oleh publik basis perusahaan luas voluntary disclosure perusahaan manufaktur terdaftar bursa efek jakarta 805 pengaruh faktor fundamentalterhadap harga saham perusahaan jasa go publik bursa efek indonesia 806 pengaruh struktur modal beban bunga return on asset skala perusahaan umur perusahaan rentabilitas modal sendiri perusahaan automotive and allied prodoct bursa efek indonesia (2003-2007) 807 pengaruh earning per share (eps) return on assets (roa) return on equity (roe) return saham perusahaan real estate property terdaftar bursa efek indonesia (bei) 808 pengaruh rasio profitabilitas price earning ratio harga saham pt gudang garam tbk bursa efek jakarta (periode 1990-2003) hubungan pengumuman dividen meningkat reaksi pasar modalpengujian efisiensi pasar bentuk setengah kuat secara keputusan kasus perusahaan manufactur go public bursa efek jakarta analisis faktor-faktor mengendalikan nilai perusahaan 81 reaksi investor atas kemenangan sby mjk harga saham bursa efek jakarta 810 pengaruh variabel fundamental price to book value (pbv) sebagai dasar penilaian kewajaran harga saham kasus perusahaan keuangan (bank non bank) bursa efek jakarta perbedaan kinerja keuangan tingkat kemahalan harga saham peningkatan laba antara perusahaan melakukan stock split perusahaan tidak melakukan stock split kasus perusahaan manufactur listing bursa efek jakarta p 812 analisis rasio keuangan eeconomic value added (eva) mengukur kinerja keuangan perusahaan farmasi listing bursa efek jakarta analisis perbedaan trading volume activity abnormal return saham sebelum sesudah akuisisi perusahaan go public bursa efek jakarta periode 1 januari 2000 - 31 desember 2004 pengaruh rasio likuiditas return on investment financial leverage return on equity perusahaan makanan minuman go public bursa efek jakarta tahun 2002-2004 pengaruh pengumuman dividen abnormal return cumulative abnormal return (car) trading volume activity (tva) saham perusahaan manufaktur listing bursa efek pengaruh kinerja keuangan perbankan return saham bursa efek jakarta kasus perusahaan perbankan lsiting bej periode tahun 2003-2005 analisis rasio keuangan economic value added (eva) sebagai alat menilai kinerja keuangan perusahaan (studi pt kalbe farma tbk bursa efek jakarta) pengaruh earning per share (eps) return on sale (ros) basic earning power (bep) economic value added (eva) harga saham perusahaan manufaktur listing bei (bursa efek indonesia) periode 2004-2006 pengaruh earning per share (eps) debt to equity ratio (der) return on investment (roi) return on equity (roe) divident payout ratio (dpr) harga saham industri farmasi listing bursa efek indonesia analisa latar belakang pengaruh persepsi penerapan employee stock option plan (esop)empiris indonesia 82 analisis hubungan financial distress rasio bv/mv pendapatan saham perusahaan bursa efek jakarta 820 pengaruh rasio profitabilitas leverage harga saham perusahaan rokok terdaftar bursa efek indonesia tahun 2005-2007 821 pengaruh economic value added residual income earnings arus kas operasi return diterima oleh pemegang saham perusahaan manufaktur terdaftar bursa efek jakarta 822 studi empiris dua faktor mempengaruhi return saham industri food beverages bursa efek jakarta 823 pengaruh pengumuman dividen perubahan harga saham sebelum sesudah ex-dividend date bursa efek jakarta (bej) 824 studi komparasi kinerja keuangan perusahaan bank asuransi terdaftar bursa efek jakarta tahun 2003 825 pengaruh perputaran modal kerja perubahan harga saham pt hm sampoerna tbk bandung 826 studi tentang pengaruh hari perdagangan return saham bej 827 pengaruh gejolak kurs rupiah prospek bisnis 1998 828 pengaruh kinerja keuangan harga saham subsektor industri kayu pengolahannya pt bursa efek jakarta 829 analysis of accrual cash flow net income dividend and price to book value toward companies abnormal return in manufacturing sector of bursa efek jakarta (2003-2005) 83 efektivitas penerapan price limit bursa efek jakarta 83 pengaruh reverse split likuiditas saham bursa efek jakarta periode januari 2001-juli 2006 830 hubungan antara kinerja lingkungan pengungkapan lingkungan kinerja ekonomi (studi empiris perusahaan pertambangan terdaftar bursa efek indonesia periode 2004 2006 831 jual beli saham pasar modal tingkat efisensi lemah setengah kuat pandangan fiqh islamkasus bursa efek jakarta 832 analisa responsivitas ketaatan emiten aturan board governancekasus perusahaan-perusahaan bursa efek jakarta 833 dampak tingkat pengungkapan informasi perusahaan volume perdagangan return sahampenelitian empiris perusahaan-perusahaan tercatat bursa efek jakarta 834 analisis dampak penerbitan obligasi kinerja harga saham menggunakan pendekatan konsep metodologi event studyempiris perusahaan go public indonesia periode 1997-2003 835 determinasi capital structure perusahaan manufaktur bursa efek jakarta periode 2000 - 2004 836 determinan intraday bid-ask spread saham bursa efek jakarta 837 alternatif kebijakan pengenaan pph final atas transaksi penjualan saham bursa efek 838 analisis hubungan antara volatilitas imbal hasil saham volume transaksi intrahari 14 saham teraktif bursa efek indonesia 839 stock split fraksi perdagangan likuiditas saham bursa efek jakarta 84 analisis determinan audit delay kajian empiris bursa efek jakarta 84 analisis durasi saham bursa efek jakarta (bej) 840 reaksi pasar modal ex-dividend date termotivasi pembagian dividen bursa efek jakarta (perusahaan manufaktur terdaftar bursa efek jakarta) 841 pengaruh market size book to market equity perubahan fundamental sektor aneka industri industri barang konsumsi periode 1994-2004 bursa efek jakarta 842 perancangan sistem pakar proses pengambilan keputusan investasi bursa efek surabaya 85 analisis faktor-faktor mempengaruhi struktur modal perusahaan farmasi telah go publik bursa efek jakarta 85 hubungan antara profitabilitas leverage 50 perusahaan non keuangan terdaftar bursa efek jakarta periode 2002-2004pengujian atas teori modigliani-miller vs pecking order 854 analisis integrasi bej pasar modal dunia analisis dampak pelepasan batas kepemilikan asing atas saham bej return ihsg 855 perbandingan price earning rasio likuiditas saham perusahaan antara perusahaan melakukan pemecahan saham tidak melakukan pemecahan saham bursa efek jakarta tahun 1999-2003 856 pengaruh aliran kas internal kepemilikan manajer perusahaan rasio hutang jangka panjang pembelanjaan modal (studi perusahaan listing bursa efek jakarta 1999-2001) 857 analisa kinerja perusahaan makanan minuman terdaftar pt bursa efek jakarta sebelum (1994-1996) selama (1997-2000) krisis moneter alat ukur reva 858 pengaruh inflasi kurs dollar tingkat suku bunga harga saham perusahaan manufaktur terdaftar bursa efek indonesia 859 pengaruh inflasi kurs dollar tingkat suku bunga harga saham (perusahaan makanan minuman terdaftar bursa efek indonesia tahun 2005-2007) 86 analisis hubungan variabel makro ekonomi indeks harga saham sektoral bursa efek jakarta 86 persepsi dimensi income smoothing motivasi investor berinvestasi bursa efek jakarta 860 pengaruh rasio-rasio keuangan return saham industri makanan terdaftar bursa efek indonesia (2007) 861 pengaruh indeks harga saham sektor infrastruktur indeks harga saham gabungan bursa efek jakarta periode januari sd desember 2003 862 pengaruh rasio pembayaran dividen (dpr) 863 analisa the day of the week effect bursa efek jakarta (time scale januari 2004 - juni 2006/daily) 864 analisa pengaruh corporate news stories abnormal return saham bursa efek indonesia (periode januari 2005 - desember 2006) 865 pengaruh financial leverage underpricing saham perdana (ipo) bursa efek indonesia periode 2002-2008 (penelitian perusahaan yangbergerak bidang keuangan) 866 pengaruh return on equity (roe) perubahan harga saham pt bank negara indonesia (persero) tbk 867 analisis pengaruh earning per share book value per share debt to equity ratio dividend pay out ratio total debt ratio harga saham perusahaan pertanian 868 analisa kinerja keuangan metode economic value added (eva) pengaruhnya earning per share (eps) industri food and beverages terdaftar bursa efek jakarta 869 analisis faktor-faktor mempengaruhi struktur modal perusahaan perbankan terdaftar bursa efek indonesia periode tahun 2000 - 2007 87 analisis minat investor asing saham-saham bursa efek jakarta metode diskriminan 87 komparasi kinerja keuangan perusahaanbank asuransi manufaktur listed bursa efek jakarta 870 analisis pengaruh quick ratio total assets turnover ratio debt ratio return on assets ratio perubahan laba perusahaan industri makanan minuman bursa efek jakarta periode 2001-2006 871 analisis dupont formula (3) tiga perusahaan asuransi umum terbesar bursa efek indonesia periode 2003-2007 872 analisis pembentukan portofolio saham optimal berdasarkan model indeks tunggal bursa efek indonesia 873 pengaruh firm size growth umur perusahaan profitabilitas auditor change studi bursa efek jakarta (bej) 874 analisis pengaruh operating cash flow operating net income lagged dividend dividend changes empiris 31 perusahaan manufaktur terdaftar bursa efek jakarta 875 analisis kinerja keuangan return on equity (du pont system) pengaruhnya harga saham industri pertambangan go public bursa efek jakarta 876 analisis faktor-faktor mempengaruhi audit delay empiris bursa efek jakarta tahun 2003 877 analisis pengaruh ros tato asset leverage roe industri otomotif industri ritel bursa efek jakarta 878 analisis pengaruh kebijakan reverse stock split harga saham perusahaan bursa efek jakarta tahun 2004 the analysis of reverse stock split s effect on the company s stock price at jakarta stock exchange in 2004 879 analisis pengaruh financial leveragetingkat bunga pinjaman rentabilitas ekonomi rentabilitas modal sendiri (perusahaan industri manufaktur tercatat bej tahun 2005) 88 faktor-faktor mempengaruhi kebijakan pembayaran dividen perusahaan manufaktur go public bursa efek jakarta (bej) 88 pengaruh stock split likuiditas sahamsuatu kasus bursa efek jakarta 880 analisis pengaruh faktor-faktor kinerja keuangan earning per share perusahaan go public bursa efek jakarta 881 analisis pengaruh beban promosi serta beban pelatihan pengembangan karyawan kinerja keuangan perusahaan (studi empiris perusahaan-perusahaan terdaftar bursa efek indonesia tahun 2006 2007) 882 laba arus kas operasi memprediksi arus kas operasi masa mendatang (studi perusahaan manufaktur terdaftar bursa efek indonesia tahun 2002-2006) 883 analisis pengaruh day of the week effect serta firm size abnormal return atas pengumuman right issue perusahaan manufaktur bursa efek jakarta 884 pengaruih kinerja keuangan return saham perusahaan terdaftar bursa efek indonesia kepemilikan saham oleh asing sebagai moderating variable 885 perbandingan penerapan fuzzy logic regresi berganda penentuan nilai intrinsik saham properti real estat bursa efek indonesia 886 pengaruh market value leverage profitabilitas return saham perusahaan sektor industri barang konsumsi bursa efek indonesia 887 pengaruh krisis subprime mortgage amerika serikat saham lq 45 event study bursa efek indonesai tahun 2007 888 analisis pengaruh book to market beta size aktual return saham perusahaan non finansial bursa efek indonesia 889 competitive effect transfer intra-industri perbankan atas pengumuman kebangkrutan periode 1999-2005 faktor-faktor mempengaruhi abnormal return bursa efek indonesia 89 konversi convertible bonds pengaruh return saham bursa efek jakarta 89 pengaruh faktor keuangan harga saham bursa efek jakarta 890 pengaruh perubahan harga minyak mentah indeks harga saham analisis tingkat pasar tingkat sektor industri periode 2002-2007 bursa efek indonesia 891 analisis pengaruh corporate governance kualitas audit cost of debt financing studi empiris perusahaan manufaktur terdaftar bursa efek jakarta tahun 2002-2006 892 analisa faktor-faktor mempengaruhi nilai price earning ratio saham-saham bursa efek jakarta periode 2003-2005 893 analisis pengaruh transaction cost market value volatility holding period sahamempiris bursa efek jakarta periode 2001-2003/ rizqi yulianto 894 analisis pengaruh kinerja internal perusahaan nilai pasar (mva) industri manufaktur bursa efek jakarta/ rotua hotmauli 895 analisis pengaruh faktor-faktor berpengaruh praktik perataan laba dilakukan perusahaan manufaktur bursa efek indonesia 896 analisis reaksi perdagangan saham bursa efek indonesia peristiwa pengumuman kenaikan harga bahan bakar minyak per 23 mei 2008 897 pengaruh stock split future profitability likuiditas saham struktur kepemilikan perusahaan terdaftar bursa efek indonesia udhi pamungkas gautama 898 sita jaminan (conservatoir beslag) atas saham scripless trading bursa efek jakarta/ remy arriza balaga 899 pengaruh struktur kepemilikan kebijakan utang sebagai pengendalian konflik keagenan analisis perusahaan-perusahaan terdaftar bursa efek jakarta 9 integrasi bursa efek jakarta bursa efek si asean (setelah penghapusan batas pembelian bagi investor asing) 9 pengaruh merger akuisisi return saham volume perdagangan saham perusahaan manufaktur terdaftar bursa efek indonesia 90 kedudukan tanggung jawab pialang perdagangan saham bursa efek jakarta 90 respon pasar saham beberapa domestic issuessuatu penelitian empiris bursa efek indonesia 900 analisis pengaruh pengumuman right issues return saham volume perdagangan saham kinerja perusahaan sebelum setelah cum date studi empiris perusahaan terdaftar bursa efek indonesia periode 2001-2006 901 analisis reaksi investor right issue serta karakteristik perusahaan mempengaruhinya bursa efek jakarta periode tahun 2002-2007 902 pengaruh siklus hidup perusahaan koefisien respon lababukti empiris bursa efek jakarta/ margaretta jati palupi 903 peran manajer kebangkrutan perusahaan sebagai penyebab atau korban?suatu event study bursa efek surabaya periode amatan 1994-1005/ ita sadrini astutiningsih 904 faktor-faktor mempengaruhi kelengkapan pengungkapan wajib laporan keuangan industri manufaktur termasuk saham-saham lq 45 bursa efek indonesia 905 analisis faktor-faktor mempengaruhi struktur modal industri consumer goods bursa efek indonesia 906 komite audit manajemen laba return tidak normal perusahaan-perusahaan terdaftar bursa efek jakarta (bej)/ i putu sugiartha sanjaya 907 pengaruh usia perusahaan kapitalisasi pasar likuiditas financial leverage beta saham bursa efek jakarta periode 2005-2007 908 pengaruh frekuensi perdagangan rerata ukuran perdagangan bid-ask spread order imbalance volatilitas harga saham bursa efek indonesia 909 analisis pengaruh faktor fundamental faktor makro risiko sistematis kasus perusahaan-perusahaan lq 45 terdaftar bursa efek jakarta 91 analisa hukum transaksi short selling indonesia perlindungan hukum bagi pihak lawan transaksi transaksi short selling 91 inflasi return saham biasa 910 analisis pengaruh perubahan deviden per lembar saham rasio profitabilitas tingkat suku bunga bebas resiko pph dari transaksi perdagangan saham bursa efek jakarta 911 analisis pengaruh merger akuisisi kinerja perusahaanempiris perusahaan manufaktur terdaftar bursa efek jakarta/ agis data azizudin 912 perbandingan tingkat hasil risiko portofolio teknik diversifikasi random teknik diversifikasi berdasarkan industri indeks saham bursa efek jakarta tahun 2005 913 hubungan simultan antara faktor-faktor fundamental beta terkoreksi studi empiris perusahaan-perusahaan manufaktur tercatat bursa efek indonesia periode 2001-2005 914 corporate governance dampaknya proporsi kepemilikan outside inside investors serta perbandingan rata-rata return saham perusahaan publik bursa efek indonesia 915 analisis model prediksi peringkat obligasiempiris perusahaan non keuangan bursa efek jakarta/ novita andriani 916 pengaruh kinerja keuangan harga saham emiten bank bank-bank publik bursa efek jakarta 917 pengaruh kepemilikan saham institusional investor debt ratio perusahaan manufaktur bursa efek indonesia periode pengamatan tahun 2004-2007 918 hubungan antara perubahan ihsg nilai tukar rupiah sbi tingkat inflasi trading turnover bursa efek jakarta (bej)/ roza linda 919 dampak ukuran perusahaan (firm size) day-of-the week effect bursa efek jakarta periode waktu januari 2002-desember 2007 92 analisis faktor-faktor mempengaruhi kebijakan deviden perusahaan-perusahaan go public bursa efek jakarta 92 analisis tentang struktur modal perusahaan-perusahaan bursa efek jakarta 920 pengaruh financial leverage profitability nilai perusahaan industri telekomunikasi industri makanan minuman bursa efek jakarta (2002-2006) 921 earnings management meningkatkan kinerja perusahaan mengalami financial distressempiris perusahaan publik terdaftar bursa efek jakarta/ herry syam 922 analisis pengaruh deviden per lembar saham laba ditahan harga saham perusahaan go public bursa efek jakarta 923 pengaruh pergerakan rasio profitabilitas emiten perubahan harga saham (perusahaan perbankan terdaftar ek indonesia tahun 2005-2007) 924 analisis pengaruh current ratio (cr) debt equity ratio (der) return on equity (roe) devidend payout ratio perusahaan manufaktur go public bursa efek indonesia 925 pengaruh hari perdagangan return abnormal return risiko saham bursa efek jakarta david bahar mahbubi 926 analisis pengaruh gdp laju inflasi bunga sbi kurs us$ imbal hasil indeks harga saham gabungan (ihsg) bursa efek jakarta rentang waktu tahun 1997 sampai tahun 2001 927 analisis pengaruh perkembangan variabel makro ekonomi tingkat pengembalian saham bursa efek jakarta periode sebelum krisis moneter periode krisis moneter indonesia 928 pengaruh return on equity (roe) dividen tunai saham bonus likuiditas saham bursa efek jakarta 929 pelaksanaan ketentuan undang-undang pajak penghasilan atas transaksi penjualan saham bursa efek ditinjau dari asas-asas perpajakan kesederhanaan administrasi pajak 93 peranan pasar modal meningkatkan penerimaan pajak suatu tinjauan hubungan pertumbuhan pasar modal pajak penghasilan final atas transaksi penjualan saham bursa efek jakarta 93 perilaku dividen sektor elektronika equipment bursa efek jakarta 930 analisis kandungan informasi komponen-komponen arus kas operasi arus kas investasi arus kan pendanaan pengaruhnya return saham (saham-saham lq45 bursa efek jakarta) 931 analisis reaksi pasar modal initial public offering (ipo) industri manufaktur bursa efek jakarta (bej) 932 analisa faktor-faktor berpengaruh perataan laba (income smoothing) perusahan perusahaan go public 933 kepemilikan manajerial kebijakan hutang kinerja nilai perusahaan 934 pengaruh profitability investment opportunity set kebijakan dividen tunai likuiditas sebagai variabel penguat 935 pengaruh board diversity nilai perusahaan perspektif corporate governance 936 analisis desain proses pembentukan portofolio optimal perusahaan go public pt bursa efek jakarta 937 distribusi rasio keuangan industriempiris bursa efek jakarta 938 pengaruh publikasi publikasi laporan arus kas volume perdagangan saham perusahaan bursa efek jakarta 939 analisis rasio keuangan memprediksi kondisi financial distress perusahaan manufaktur terdaftar bursa efek indonesia 94 analisis dampak pengumuman dividen harga saham serta faktor-faktor mempengaruhinya 94 penilaian kondisi saham bursa efek jakarta 940 pengaruh pengumuman dividen perubahan harga saham perusahaan manufaktur bursa efek indonesia tahun 2005-2007 941 pengaruh kinerja keuangan return saham perusahaan manufaktur terdaftar bei (bursa efek indonesia) 942 pengaruh nilai tukar rupiah per dollar as indeks harga saham gabungan bursa efek jakarta periode januari 2002-desember 2005 bursa efek jakarta 943 pengaruh rasio profitabilitas return saham perusahaan-perusahaan tergabung lq-45 tahun 2005-2007 944 pengujian model tiga faktor fama french investasi portfolio bursa efek jakarta 945 pengaruh kinerja jangka pendek kinerja jangka panjang serta faktor-faktor mempengaruhi kinerja ipo bursa efek jakarta 946 analisis pengaruh kinerja perusahaan imbal hasil saham-saham lq 45 terdaftar bursa efek indonesia 2005 2007 947 pengaruh rumor saham pergerakan saham diperdagangkan bursa efek 948 pengaruh peristiwa pergantian presiden tahun 2001 peledakan bom bali tahun 2002 return saham bursa efek jakarta 949 faktor-faktor mempengaruhi struktur modal analisa tingkat hutang (debt ratio) perusahaan go public bursa efek jakarta 95 pajak penghasilan atas penghasilan dari transaksi penjualan saham bursa efek 95 panel data analysis mengenai determinan struktur modal pengaruhnya pembentukan struktur modal perusahaan manufaktur indonesia (periode 1998-2003) 950 analisis faktor penentu struktur modal (studi empiris emiten syariah bursa efek jakarta tahun 2004-2007) 951 analisis kinerja keuangan perusahaan industri rokok telah go publik bursa efek surabaya 952 pengaruh beta size me/be per expected return saham bursa efek jakarta 953 analisis peningkatan kinerja karyawan pt bursa efek jakarta (pt bej) 954 pengaruh variabel makro investor asing bursa telah maju indeks bursa efek jakarta 955 analisis praktik tata kelola perusahaan (corporate governance) kesulitan keuangan perusahaan (financial distress) perusahaan lq-45 periode 2004-2006 bursa efek indonesia 956 perkembangan prospek pasar modal indonesia tahun 2005 (event studypendekatan managemen strategik) 957 pergeseran strategi pengembangan bursa efek jakarta (bej) pertumbuhan liberal menuju pertumbuhan berkeadilan 958 analisa efisiensi pasar modal bentuk lemah bursa efek jakarta 959 investasi saham perusahaan menghadapi financial distress 96 pengujian efisiensi pasar modal bursa efek jakarta periode 1994-1995 96 tinjauan hukum mengenai pengalihan saham perjanjian jual beli saham melalui internet dihubungkan undang-undang 960 analisis pengaruh perubahan dividen perubahan investasi earning profitabilitas perusahaan terdaftar bursa efek indonesia periode 2004 sd 2007 961 pengaruh stock split komposisi kepemilikan institusi likuiditas perdagangan bursa efek indonesia periode 2002 2005 962 analisa pengaruh dividen return diharapkan tingkat pertumbuhan dividen harga saham bursa efek jakarta 963 pengaruh kepemilikan negara kinerja perusahaan studi empiris badan usaha milik negara indonesia perusahaan swasta terdaftar bursa efek jakarta 964 konsentrasi kepemilikan saham vs kewajiban company listing bursa efek jakarta 965 efek neraca efek suku bunga indonesiaanalisis perusahaan berorientasi ekspor terdaftar bursa efek indonesia periode 2004-2008 966 pengaruh informasi earning per share (eps) laba arus kas suku bunga return saham perusahaan perbankan lembaga keuangan lainnya go puplic bursa efek indonesia 967 analisis faktor-faktor mempengaruhi nilai perusahaan manufaktur terdaftar bursa efek indonesia (bei) 968 analisis variabel-variabel mempengaruhi struktur modal perusahaan go public bursa efek jakarta 969 analisis pengaruh tingkat suku bunga inflasi harga saham bursa efek indonesia 97 faktor-faktor mempengaruhi praktik perataan laba perusahaan terdaftar bursa efek jakarta 97 peranan simpanan masyarakat menunjang pemberian kredit pt bank rakyat indonesia (persero) tbk (pt bri (persero) tbk terdaftar bej) 970 penilaian kinerja perusahaan melalui pendekatan economic value added (eva) pt bursa efek indonesia (studi empiris perusahaan manufaktur go public bei) 971 indikasi potensi economic value added analisis rasio camel memprediksi kesehatan bank listing bursa efek jakarta 972 reaksi pasar modal pelaporan selisih kursempiris bursa efek jakarta 973 analisa capital asset pricing model menilai tingkat keuntungan tingkat resiko investasi saham perusahaan rokok terdaftar bursa efek indonesia 974 jurnal riset akuntansi manajemen indonesia 975 pengaruh profitabilitas prospektus harga saham initial public offering (ipo) bursa efek jakarta 976 pengaruh kinerja keuangan dividend payout ratio industri barang konsumsi bursa efek jakarta 977 analisis faktor-faktor mempengaruhi indeks lq-45 bursa efek jakarta (bej) periode 19971 20071 978 pengaruh dividend per share return on investment harga saham perusahaan go public bursa efek indonesia periode 2004-2007 979 analisis pengaruh informasi pengumuman laporan keuangan abnormal return saham perusahaan automotive bursa efek indonesia tahun 2005 98 analisis perbedaan kinerja perusahaan banyak lkbb bursa efek jakarta 98 pengaruh variable-variabel makro ekonomi return pasar bulan desember return pasar bulan januari melihat fenomena january effect bursa efek jakartaempiris bej januari 1989-januari 2006 980 pengaruh pemilihan metode akuntansi merger akuisisi volume perdagangan saham perusahaan publik terdaftar bursa efek indonesia (bei) (studi empiris bursa efek indonesia tahun 2001-2007) 981 analisa pengaruh struktur modal leverage nilai perusahaan (kajian empiris perusahaan manufaktur go public bei periode 2003 2007) 982 analisis pengaruh informasi pengumuman laporan keuangan abnormal return saham perusahaan automotive bursa efek indonesia tahun 2005 983 penggunaan metode constant risk market model time varying risk market model beta portofolio saham (studi bursa efek jakarta periode 2000-2003) analisis pengaruh nilai tukar rupiah arus kas dari aktivitas operasi return saham periode 1995-2002 (studi empiris perusahaan properti real estat terdaftar bursa efek 985 pengelompokan kelas industri farmasi go public bursa efek jakarta berbasis kinerja keuangan pendekatan cluster analysis 986 pengaruh tingkat kemahalan harga saham kinerja keuangan perusahaan keputusan stock split perusahaan terdaftar bursa efek jakarta 987 analisa kinerja keuangan dua perusahaan go public bergerak bidang usaha restoran fast food bursa efek jakarta 988 studi komparatif long-short investment perusahaan besar kecil terdaftar bursa efek jakarta 989 analisa capital lease operational lease roi eva debt to equity perusahaan manufaktur terdaftar bursa efek surabaya 99 analisis koefisien penyesuaian harga efektifitas penyerapan informasi baru bursa efek jakarta 99 pengaruh mekanisme corporate governance agency cost perusahaan manufaktur terdaftar bursa efek indonesia 990 evaluasi model penilaian opsi call bursa efek jakarta 991 aplikasi formula penilaian opsi-black-scholes estimasi nilai call opsi indeks saham lq-45 bursa efek jakarta 992 analisis hubungan strategi korporasi struktur modal perusahaan-perusahaan manufaktur bursa efek jakarta 993 hubungan antara karakteristik perusahaan implied cost of capital perusahaan komsumsi perusahaan aneka industri terdaftar bursa efek indonesia (bei) periode 2003 sampai 2007 994 evaluasi model penilaian opsi call bursa efek jakarta 995 analisa faktor-faktor mempengaruhi resiko investasi saham bursa efek jakarta (perusahaan asuransi general) 996 net operating profit after tax (nopat) residual income (ri) economic value added (eva) penciptaan nilai perusahaan mengenai konten informasi relatif inkremental perusahaan publik bursa efek jakarta bursa efek surabaya 997 pengaruh pengumuman seasoned equity offering (seo) imbal hasil volume perdagangan saham berdasarkan tingkat resiko finansial distress studi empiris perusahaan manufakture melakukan pengumumam seo bursa efek indonesia tahun 2001 - 2007 998 analisis penggunaan koreksi beta perdagangan saham tidak sinkron (thin market)pada bursa efek jakarta periode 2002-2003 999 analisa pengaruh pergerakan nilai tukar rp/us$ market value of the firm perusahaan manufaktur listing bursa efek jakarta periode 1 juli 1997 sampai 31 desember 2001 1 laporan keuangan 1 pengaruh perputaran piutang rentabilitas ekonomi pt pabelan surakarta 10 evaluasi penerapan prinsip-prinsip akuntansi pemerintah laporan keuangan perwakilan bpk-ri pekanbaru 10 kemampuan informasi keuangan memprediksi laba arus kas masa akan datang 100 analisis laporan keuangan sebagai dasar penilaian kinerja keuangan pt dharma samudera fishing industries tbk tahun 2000-2002 100 pengaruh cadangan utama (primary reserve) 1000 dampak produktivitas laba (perusahaan tekstil pt pismatex pekalongan) 101 analisis laporan keuangan sebagai dasar penilaian kinerja keuangan pt fajar surya wisesa tbk tahun 2002-2004 101 peranan perputaran total aktiva 102 analisis laporan keuangan sebagai dasar penilaian kinerja keuangan pt voksel electric tbk tahun 2001-2003 102 peranan pengembangan produk prangko prisma 103 analisis laporan keuangan sebagai dasar penilaian kinerja keuangan pt darya-varia laboratoria tbk tahun 2002-2004 103 sistem informasi manajemen keuangan 104 analisis laporan keuangan sebagai salah satu instrumen rangka pengambilan keputusan ekspansi kredit oleh pt bfi finance indonesia tbk 104 pengaruh bagi hasil pembiayaan mudharabah laba bersih diperoleh pt bank muamalat indonesia tbk periode 1999 - 2005 105 analisis laporan keuangan mengetahui kinerja keuangan pt ricky putra globalindo tbk tahun 2002-2004 105 pengaruh kompensasi tingkat produktivitas pegawai 106 analisis laporan keuangan mengevaluasi kinerja keuangan pt indocement tunggal prakarsa tbk tahun 2002-2004 106 peranan komputer pengolahan data 107 analisis laporan keuangan menilai kinerja keuangan pt pan brothers tbk periode 2002-2004 107 tinjauan atas pelaksanaan 108 analisis laporan keuangan menilai kinerja keuangan pt texmaco jaya tbk tahun 2001 - 2003 108 tinjauan atas penyajian laporan realisasi anggaran belanja direktorat metrologi bandung 109 analisis laporan keuangan menilai kinerja keuangan pt ultrajaya milk industry and trading company tbk periode 2002-2004 109 suatu tinjauan anggaran kas alotmen belanja dinas pertanian peternakan kabupaten pandeglang 11 bond rating hubungannya laporan keuangan 11 pengaruh informasi akuntansi prospektus ipo tingkat underpriced bursa efek indonesia 110 analisis laporan keuangan menilai kinerja keuangan pt gudang garam tbk periode 2003-2005 110 tinjauan atas prosedur 111 analisis laporan keuangan menilai kinerja pt sepatu bata tbk tahun 2001 - 2003 111 pengaruh modal sendiri tingkat solvabilitas pt hidup damai textile bandung 112 analisis rasio atas laporan keuangan mengetahui kondisi keuangan perusahaan pt jembo cable company tbk tahun 2002-2004 112 pengaruh manajemen persediaan tingkat penegmbalian investasi (kasus perusahaan industri makanan minuman terdaftar bursa efek indonesia tahun 2007) 113 evaluasi sis infoakuntansi buku besar laporan keuangan pt asuransi ramayana tbk 113 peranan return on asset meningkatkan laba perusahaan perum pegadaian kantor cabang caringin bandung 114 relevansi penyajian laporan keuangan masa ekonomi inflasi 114 usulan perancangan sistem informasi administrasi keuangan pt mil print 115 pengaruh kebijakan rotasi kap kualitas laporan keuangan 115 pengaruh modal kerja bersih tingkat likuiditas pt asuransi jasa indonesia (persero) cabang bandung 116 analisis laporan keuangan utk mengetahui kondisi keuangan pt modern photo tbk tahun 1999-2001 116 hubungan antara pemberian kredit pendapatan bank niaga kantor cabang cimahi 117 perancangan sistem informasi akuntansi pengeluaran kas menggunakan software microsoft vsiual basic 60 koperasi pegawai bkkbn propinsi jawa barat 118 sistem informasi pajak cv dharma putra 119 membangun sistem informasi akademik berbasis web smk 1 angkasa margahayu 12 pengaruh perataan laba reaksi pasar resiko investasi perusahaan terdaftar bei 12 sistem akuntansi penjualan ptgramedia asri media mall pekanbaru 120 sistem informasi pemeriksaan instalasi laboratorium rumah sakit islam al-ihsan kabupaten bandung 121 konsistensi penyajian laporan keuangan perusahaan publik analisis kritis atas opini auditor laporan keuangan auditan tahun 2000 121 sistem informasi pengolahan administrasi keuangan smk muhammadiyah 1 sumedang 122 perancangan sistem informasi akuntansi utang lease pt inter oceanindo logistiktama cabang bandung menggunakan software microsoft visual basic 60 122 studi banding penyusunan laporan keuangan metode historical cost accounting and general price level accounting masa attribute 123 perancangan sistem informasi akuntansi penggajian pt pos indonesia bandung menggunakan microsoft visual basic 60 sql server 70 berbasis client server 123 perbandingan laporan keuangan pt kurnia mustika kencana plastik analisis dinamis 124 perancangan sistem informasi transaksi niaga swindle apparel bandung 125 membangun sistem informasi lembaga pendidikan private quick english conversation 126 perancangan alat pemesanan makanan berbasis mikrokontroller menggunakan komunikasi rs 485 127 sistem informasi perpakiran koperasi keluarga pegawai (kkp) institut teknologi bandung 128 evaluasi reliabilitas laporan keuangan perusahaan publik indonesia 128 pengaruh kas modal kerja pt pos indonesia (persero) 129 laporan keuangan per 31 desember 2006 2005 129 pengaruh perputaran persediaan rasio lancar pt pindad (persero) bandung 13 analisis break-event sebagai acuan menentukan tarif harga penjualan perusahaan plastik daya tunggal kebumen 130 laporan keuangan bagian anggaran 94 tahun anggaran 2005 130 pengaruh return on investment (roi) arus kas kantor induk pt pln (persero) jasa produksi dayeuhkolot bandung 131 analisis laporan keuangan kasus laporan keuangan koperasi unit desa kotamadya banda aceh laporan penelitian 131 pengaruh laba perlembar saham (eps) harga pasar saham pt unilever indonesia tbk jakarta 132 analisis laporan keuangan sebagai salah satu cara mengukur kinerja bankkasus bank bni (delete) 132 analisis profit margin return on investment (roi) pt inti (persero) bandung 133 analisa komparatif laporan keuangan sebelum sesudah krisis (pt astra mm-205 international tbk) 133 pengaruh tingkat risiko pembiayaan likuiditas bank syariah pt bprs ishlahul ummah 134 analisis laporan keuangan sebagai salah satu cara mengukur kinerja bank bank bni 134 analisis pengaruh rasio keuangan risiko sistematik saham (saham perbankan lq45 periode januari 2004 - september 2006) 135 analisa laporan keuangan pt asuransi jiwa bringin jiwa sejahtera 135 analisis hubungan pengaruh economic value added imbal hasil saham-saham perbankan bursa efek jakarta periode 1999-2003 136 masalah dihadapi pemeriksaan fisik beberapa perkiraan hubungannya laporan keuangan akuntan 136 pengukuran return on investment human capital pt bank bni pendekatan jac fitz-enz mengenai roi human capital scorecard 137 analisis prestasi keuangan perusahaan industri semen indonesiakasus perusahaan go public periode 1991-1993 137 pemeriksaan akuntan publik atas laporan keuangan pt x rangka pemasyarakatan saham 138 kaitan pengumuman laba akuntansi harga saham volume perdagangan saham pasar modal indonesia 138 pemeriksaan akuntan atas kelayakan penyajian aktiva tetap laporan keuangan pt cii 139 analisa laporan keuangan sebagai salah satu alat bagi kreditur pemberian kredit 139 faktor-faktor mempengaruhi likuiditas saham (studi empiris bursa efek jakarta) 14 analisis kinerja keuangan koperasi pegawai republik indonesia (kpri) kpp karanganom kabupaten klaten 140 fungsi kertas kerja audit suatu penugasan audit atas laporan keuangan 140 pengaruh lobi konstituen penyusunan pernyataan standar akuntansi keuangan 141 analisa kinerja laporan keuangan ptgudang garam dari tahun 1994-1997 mengetahui likuiditas rentabilitas perusahaan 141 analisis tren laporan keuangan rumah sakit tugu ibu berdasarkan tren utilisasi tahun 1999 - 2003 142 analisa laporan keuangan pt british american tobacco ltd 142 tanggung jawab hukum hembaga profesi penunjang pasar modal melindungi investor 143 analisa kinerja laporan keuangan pt indal aluminium tbk tahun 1997-2000 143 hubungan faktor pengguna jasa pemberi jasa piutang tak tertagih frisian jaminan pribadi unit rawat inap rs jantung harapan kita jakarta 144 pengaruh pemahaman anggota tentang laporan keuangan koperasi kualitas layanan koperasi partisipasi anggota koperasi sedar kecamatan ngancar kabupaten kediri sidiq santosa 144 pengukuran kinerja pt asdp (persero) pendekatan balanced scorecard 145 analisis hubungan nilai intrinsik berdasarkan two stage dividend discount model harga pasar saham perusahaan go public 145 manfaat laporan arus kas sebagai pelengkap laporan keuangan konvensional 146 analisis harga saham perdana hubungannya laba per sahamkasus bursa efek jakarta) 146 bagaimana cara membaca laporan keuangan 147 analisis rasio keuangan pt telkom tbk tahun 1996-2006 147 kerangka dasar penyusunan pengujian laporan keuangan 148 kerangka dasar penyusunan penyajian laporan keuangan 148 struktur laba industri perbankan indonesia tahun 1992-1996pendekatan net interest margin acuan paket mei 1993 149 analisis lingkungan industri mengarah kompetensi inti marketing merek pt holcim indonesia tbk 149 laporan keuangan emitenfungsi persoalannya 15 pengaruh pendapatan perubahan hutang serta investasi laba perusahaan bursa efek indonesia tahun 2001-2005 150 kegunaan laporan keuangan mengukur efisiensi perusahaan 150 penerapan konsep economic value added (eva) menilai kinerja perusahaan pt plaza indonesia reality tbk 151 analisa perbandingan beberapa kinerja akuntansi hubungannya perubahan cumulative abnormal return 151 pengaruh informasi penghasilan perusahaan harga saham bursa efek jakarta 152 analisa laporan keuangan koperasi pegawai republik indonesia upaya kandepdikbud kabupaten malang mulai tahun 1993 sampai tahun 1997 analisis variabel mempengaruhi profitabilitas perusahaan daerah propinsi dki jakarta 153 pengaruh pemahaman anggota tentang laporan keuangan partisipasi anggota kpri al-ukhuwwah blitar perencanaan pajak penghasilan (pph) pasal 21 karyawan tetap upaya meminimalisasikan biaya pajak pt bank internasional indonesia (bii) finance center 154 analisis kesiapan rsud pasar rebo menjadi badan usaha milik daerah (bumd) tahun 2003 ditinjau dari kinerja keuangan 154 perlakuan penyajian akuntansi sumber daya manusia laporan keuangan pt pln (persero) area pelayanan jaringan malang analisis pengungkapan informasi sosial - lingkungan (social - environmental disclosure) laporan keuangan perusahaan-perusahaan go publik bursa efek jakarta keputusan pembelanjaan peluang investasi kajian empiris perusahaan go-public indonesia 156 analisis laporan keuangan menilai kinerja keuangan perusahaan pt british american tobacco tbk kebijaksanaan pajak penghasilan perusahaan properti analisis indikasi praktik manajemen laba laporan keuangan perusahaan food and beverages terdaftar bej faktor-faktor mempengaruhi efektivitas organisasi kaitannya kinerja pt perkebunankasus pt perkebunan xi (persero) jawa barat 158 penerapan akuntansi sumber daya manusia dampaknya laporan keuangan rsu ngudi waluyo wlingi usulan perancangan balanced scorecard sebagai suatu sistem pengukuran kinerja pt bank danamon indonesiatbk 159 analisis penilaian harga saham perdana menggunakan metode free cash flow to equity p/e multiple model (pt pembangunan jaya ancol tbk) 159 analisis reaksi pasar modal atas pengumuman laporan keuangan tahunan kasus perusahaan asuransi terdaftar bej analisis tingkat kesehatan perbankan metode camels (studi empiris perusahaan perbankan terdaftar bursa efek indonesia) 160 analisis perbedaan hubungan identifikasi organisasi komitmen organisasi karyawan pt por unit kerja a unit kerja x 160 evaluasi tingkat ketaatan pt telekomunikasi indonesia tbk (perseroan) anak perusahaannya psak no 4 tentang laporan keuangan konsolidasi kasus kantor cabang telkom lamongan analisis faktor-faktor determinasi kurs rupiah bedasarkan pendekatan moneterpenelitian periode 1987-1996 161 penerapan sistem akuntansi instansi menyusun laporan keuangan kantor pelayanan perbendaharaan negara serang analisis kinerja instalasi rawat jalan rsud pasar rebo dki jakarta menggunakan pendekatan konsep balanced scorecard 162 analisis perlakuan akuntansi aktiva tetap rsu ngudi waluyo wlingi kontribusinya kesesuaian penyajian laporan keuangan analisis penerapan controlled foreign companies (cfc) rule sebagai anti-tax avoidance indonesia 163 pengaruh ukuran perusahaan proporsi kepemilikan saham puplik reputasi kap likuiditas tingkat pengungkapan laporan keuangan tahunan perusahaan manufaktur terdaftar bej 164 analisis free cash flow kepemilikan manajerial kebijakan utang perusahaan manufaktur bursa efek indonesia periode 2000-2005 164 pengaruh publikasi laporan keuangan volume perdagangan saham (event study perusahaan - perusahaan lq 45 bei tanggal 31 desember 2006) 165 analisis pengaruh likuiditas rentabilitas modal kerja cv adhi wisma magetan 165 koreksi fiskal atas laporan keuangan komersial menentukan dasar perhitungan pajak terutang pt x tahun 2003 166 analisis pengaruh biaya promosi penjualan periklanan peningkatan volume penjualan perusahaan batik kepala kuda sukoharjo 166 pengaruh transfer pricing laporan keuangan pt aneka sumber kencana dampak perpajakannya 167 akuntansi sewa guna usaha penyusunan laporan arus kas pt ai 167 analisis perbandingan kinerja keuangan antara bank syariah bank konvensional (bank muamalat indonesia bank mayapada tahun 2004-2006) 168 analisis atas perbedaan laporan keuangan spt masa pajak pertambahan nilai pt adhimix precast indonesia 168 analisis kebangkrutan cv rimba sentosa tawangsari analisis z-score 169 analisis kinerja keuangan pemerintah daerah kabupaten sragen dilihat dari perspektif akuntabilitas 169 analisis laporan arus kas sebagai penunjang evaluasi kinerja keuangan pt dynaplast tbk 17 analisis penggunaan z-score altman menilai potensi kebangkrutan perusahaan manufaktur terdaftar bei 170 analisa penggunaan modal kerja perusahaan batik brotoseno desa kliwonan kabupaten sragen 170 analisis laporan arus kas sebagai penunjang kinerja keuangan pt voksel electric tbk 171 analisis rasio keuangan metode altman z-score memprediksi potensi kebangkrutan perusahaan (pt pura barutama kudus) 171 rancang bangun sistem informasi keuangan sekolah dasar surabaya 172 analisa laporan keuangan indikator kebangkrutan menilai kinerja keuangan serta kelangsungan pt mayora indah tbk beserta anak perusahaan (periode 2001-2005) 172 kemungkinan penerapan balanced scorecard mengevaluasi kinerja koperasi (koperasi pegawai negeri (kpn) jujur andong kabupaten boyolali) 173 analisis diskriminan model altman memprediksi kemungkinan kebangkrutan sepuluh perusahaan tekstil garmen bursa efek indonesia 173 perbedaan reaksi pasar antara perusahaan perata laba bukan perata laba perusahaan terdaftar bei 174 analisis pengaruh karakteristik perusahaan pengungkapan tanggungjawab sosial (studi empiris perusahaan manufaktur terdaftar bursa efek indonesia) 174 perancangan sistem pendukung keputusan memberikan pernyataan pendapat atas laporan keuangan (kantor akuntan publik ernst and young 175 analisis kinerja keuangan cv widya karya raharja sragen 175 laporan keuangan atas penggunaan bagian anggaran 62 tahun anggaran 2005 176 analisis pengaturan laba (earnings management) menghindari kerugian perusahaan go public indonesiadeteksi berdasarkan beban pajak tangguhan 176 laporan keuangan pemerintah pusat (lkpp) tahun 2006 (audited) 177 manfaat rasio keuangan memprediksi perubahan laba perusahaan manufaktur terdaftar bursa efek indonesia 178 analisis efisiensi penggunaan modal kerja ditinjau dari rasio likuiditas rentabilitas aktivitas kpri koppenda kabupaten klaten tahun 2003-2006 179 analisis tingkat kesehatan koperasi koperasi simpan pinjam syariah bmt akbar tahun buku 2006-2007 18 analisis efisiensi penggunaan modal kerja cv arrahman surakarta 18 analisis rekonsiliasi laporan keuangan komersial menjadi laporan keuangan fiskal menghitung besarnya pph terhutang ptbongman internasional 180 analisis efisiensi penggunaan modal kerja tinjau dari likuiditas solvabilitas rentabilitas ksu mandiri sukses ums surakarta 181 analisis rasio keuangan model z-score menilai tingkat kesehatan keuangan perusahaan (kasus pt atmaja jaya batur 182 pengaruh kinerja perusahaan return perusahaan manufaktur bursa efek indonesia 183 analisis pengaruh beberapa faktor fundamental return saham 184 analisis investasi piutang pengaruhnya rentabilitas ekonomi kud bhineka karya kecamatan kartasura kabupaten sukoharjo 185 pengaruh time pressure risiko audit locus of control komitmen profesi penghentian prematur atas prosedur audit (survey kantor akuntan publik surakarta daerah istimewa yogyakarta) 186 analisis perkembangan tingkat kesehatan perusahaan menggunakan rasio keuangan industri electronic office equipment terdaftar bursa efek jakarta 187 analisis tingkat kebangkrutan perusahaan model altman sektor parmaceuticals bursa efek indonesia periode 2002 2006 188 pengaruh manajemen laba biaya modal ekuitas perusahaan perbankan terdaftar bursa efek indonesia (studi perusahaan perbankan bei th 2002-2006) 189 studi tentang rentabilitas bank ditinjau dari sumber dana masyarakat perusahaan daerah bpr bkk karangmalang sragen 19 analisa laporan keuangan pt aqua golden mississippi 19 analisis pengaruh p-o-p advertising keputusan pembelian swalayan asgross cemani 190 analisis kinerja keuangan simpan pinjam kpri masa boyolali 191 pengaruh skala operasi struktur modal kinerja operasi perbankan terdaftar bursa efek indonesia (bei) 192 analisis kinerja keuangan kopma ums tinjau dari likuiditas solvabilitas profitabilitas 193 analisis pengaruh klasifikasi perdagangan dua papan discretionary accruals perusahaan perbankan 194 pengaruh kinerja keuangan perusahaan return saham (studi empiris perusahaan manufaktur terdaftar bursa efek jakarta) 195 analisis pengaruh profitabilitas investasi likuiditas leverage deviden payout ratio (studi empiris perusahaan manufaktur bursa efek indonesia) 196 analisis faktor-faktor berpengaruh earnings management perusahaan perbankan bej periode 2001-2005 197 pengaruh asimetri inforamasi struktur kepemilikan intitusional struktur kepemilikan manajerialdan ukuran perusahaan earnings management perusahaan perbankan bej periode 2004-2006 198 analisis kinerja keuangan pt tiga serangkai pustaka mandiri surakarta 199 manfaat rasio keuangan memprediksi perubahan laba perusahaan (studi empiris perusahaan manufaktur go publik bursa efek indonesia periode 2004-2006) 2 analisis penetapan standar akuntansi keuangan (sak) penyusuna laporan keuangan ptgriya maju mandiri 2 pengaruh ukuran perusahaan debt to equity ratio kualitas auditor jenis opini auditor komite audit audit delay perusahaan manufaktur bursa efek indonesia 20 analisis kinerja keuangan du pont system ud wreksa rahayu boyolali 20 analisis laporan keuangan perbankan sebagai alat penilai kinerja bank pt bank mandiri group (persero) analisis rasio keuangan sebagai alat mengetahui kinerja keuangan koperasi koperasi unit desa sidoharjo wonogiri 201 analisis pengaruh jenis usaha ukuran perusahaan profitabilitas leverage tindakan perataan laba (studi empiris bursa efek indonesia) 202 analisis tingkat likuiditas metode cash ratio loan to deposit ratio loan to asset ratio bank umum devisa tahun 2005 2007 (ptbank himpunan saudara 1906 tbk) 203 pengaruh free cash flow kepemilikan manajerial kebijakan utang perusahaan manufaktur terdaftar bej (2003-2005) 204 analisis break event point sebagai alat perencanaan laba perusahaan pt intan pariwara klaten 205 likuiditas solvabilitas rentabilitas sebagai salah satu pengukur tingkat efisiensi modal kerja kpri kopendik wonogiri tahun 2005 - 2007 206 manfaat informasi laba arus kas operasi memprediksi laba masa akan datang (studi empiris perusahaan manufaktur terdaftar bursa efek indonesia) 207 analisis pengaruh likuiditas leverage aktivitas pertumbuhan ukuran perusahaan return on investment perusahaan makanan minuman go public indonesia 208 pengaruh penerapan standar akuntansi zakat kualitas laporan keuangan berdasarkan akuntansi syari'ah lemabaga syari'ah 209 pengaruh laba arus kas 21 analisis penerapan psak 46 serta perlakuan undang-undang perpajakan no 17 tahun 2000 laporan keuangan (pt air jernih-pekanbaru 21 analisis tingkat kesehatan bank berdasarkan metode camels (studi empiris perbankan go public terdaftar bursa efek indonesia tahun 2006-2008) 210 analisis pengaruh modal pinjaman 211 analisis penerapan metode pengakuan pendapatan jasa telekomunikasi keakuratan penyajian laba operasional 212 pengaruh profitabilitas (return on investment) arus kas (cash flows) pt sucofindo (persero) cabang madya bandung 213 pengaruh perubahan modal kerja 213 peningkatan kualitas ketepatan waktu laporan keuangan konsolidasikasus pt telekomunikasi indonesia tbk/ luthfy hanum 214 kebutuhan informasi catatan atas laporan keuangan pemerintah 214 sistem komputerisasi pengolahan data 215 analisis daya banding laporan keuangan antar perusahaan indonesia 215 pelaksanaan sistem akuntansi penerimaan kas 216 analisis ketidaktepatwaktuan penyampaian laporan keuangan tahunan return saham 216 pengaruh loan to deposit ratio (ldr) tingkat pendapatan pt bank negara indonesia cabang kuningan 217 perancangan sistem informasi akuntansi pendapatan negara bukan pajak kejaksaan tinggi jawa barat menggunakan microsoft visual basic 60 217 persepsi pemakai laporan keuangan pemerintah daerah independensi auditor badan pemeriksa keuangan 218 pengaruh regulasi pengungkapan laporan keuangan oleh bapepam asimetri informasi biaya modal 218 perancangan sistem informasi akuntansi pembelian bahan baku pt nanco muda jaya menggunakan microsoft visual basic 60 219 evaluasi ketepatan waktu penyusunan laporan keuangan kabupaten bone bolango 219 perancangan sistem informasi akuntansi simpan pinjam koperasi badan koordinasi keluarga berencana nasional (bkkbn) propinsi jawa barat menggunakan microsoft visual basic 60 22 analisis penerapan psak no 27 tahun 2007 laporan keuangan koperasi madani badan penelitian pengembangan provinsi riau 22 penilaian kinerja keuangan pd bpr bkk kecamatan gesi kabupaten sragen 220 analisis laporan keuangan calon debitur keputusan pemberian kredit yasa griya pt bank tabungan negara (persero) 220 pengaruh sumber dana pihak ketiga laba bersih pt bank negara indonesia tbk 221 pengaruh modal kerja bruto tingkat return on investment (roi) pt pln (persero) distribusi jawa barat banten periode 2003-2007 221 persepsi auditor pemakai jasa general audit terdaftar bursa efek jakarta tentang tanggung jawab auditor keandalan kegunaan laporan keuangan auditan 222 evaluasi tujuan laporan keuangan koperasi unit desa mandiri bali laporan penelitian 222 pengaruh kredit cepat aman (kca) pendapatan perum pegadaian cabang pungkur bandung 223 pengaruh kebijakan dividen harga saham (penelitian empiris perusahaan-perusahaan terdaftar bursa efek jakarta) 223 proses penyusunan laporan keuangan koperasi unit desa daerah kabupaten buleleng laporan penelitian 224 hubungan struktur kepemilikan stock return penelitian empiris perusahaan-perusahaan terdaftar bursa efek jakarta 224 penerapan pengujian analitis pemeriksaan laporan keuangan laporan penelitian 225 akuntansi pensiun tepat menghasilkan laporan keuangan lebih informatif bermanfaat bagi pengambilan keputusan laporan penelitian 225 analisis penilaian harga pasar saham pendekatan per model ekonometrika perusahaan go public bursa efek jakarta 226 analisis kinerja keuangan pt garuda indonesia ditinjau dari segi profitabilitas solvabilitas tahun 1999 s/d 2003 226 pemanfaatan software audit oleh akuntan publik membantu pelaksanaan tugas pemeriksaan laporan keuangan 227 akuntansi biaya docking tepat menghasilkan laporan keuangan lebih informatif bermanfaat bagi pengambilan keputusan laporan hasil penelitian 227 kajian pengenaan pajak penghasilan atas sektor migas indonesia 228 analisis pengukuran kinerja keuangan perusahaan valuasi harga saham metode free cash flow to equity (pt excelcommindo pratama tbk) 228 temuan akuntan publik mengenai faktor-faktor merupakan penyebab terjadinya kesalahan menyusun laporan keuangan 229 analisis economic value added debt equity ratio price earning ratio stock return industri real estate properti bursa efek jakarta periode 1995-2004 229 persepsi pihak perbankan mutu laporan keuangan debitur laporan penelitian 23 analisis penerapan psak no 46 undang-undang nomor 17 tahun 2000 tentang pajak penghasilan laporan keuangan pt peputra masterindo pekanbaru 23 analisis rasio sebagai alat bantu penilaian kinerja keuangan perusahaan pt yamaha manufacture 230 evaluasi reliabilitas laporan keuangan perusahaan publik indonesia laporan penelitian 230 evaluasi strategi usulan rancangan balanced scorecard penyelenggara jasa telekomunikasi (pt abz) 231 peranan akuntansi tingkat harga umum penyajian laporan keuangan masa inflasi tahun 2000 laporan penelitian 231 persepsi wajib pajak dana pensiun tentang pembebanan biaya secara proporsional pengaruhnya perhitungan penghasilan kena pajak 232 praktek voluntary disclosure laporan keuangan sebagai pendukung prinsip good corporate governance perusahaan publik indonesialaporan penelitian 232 tinjauan perbedaan antara akuntansi pajak akuntansi komersial upaya pendekatannya indonesia 233 analisis arus tunai instalasi gawat darurat rumah sakit pusat pertamina tahun 2001-2002 233 kajian implementasi kebijakan pengungkapan laporan keuangan perusahaan publik indonesia laporan penelitian 234 analisis efektifitas komite audit rangka penerapan good corporate governance pt permodalan nasional madani (persero) 234 kajian implementasi kebijakan pengungkapan laporan keuangan perusahaan publik indonesia laporan kegiatan 235 analisis kinerja instalasi rawat inap rumah sakit umum daerah pasar rebo jakarta menggunakan pendekatan konsep balanced scorecard 235 analisis perbandingan conventional costing abc integrasi abc eva keandalan laporan keuangan 236 analisis subsidi pelayanan pasien peserta wajib pt (persero) asuransi kesehatan indonesia unit instalasi rawat inap rumah sakit persahabatan jakarta tahun 2001 236 pernyataan standar akuntansi keuangan merupakan penyempurnaan pai pengaruhnya penyajian laporan keuangan 237 analisis kinerja keuangan perusahaan telah go public periode 1994 s/d 1996 serta pengaruhnya price to book valuekasus atas 130 perusahaan manufaktur 237 rekonstruksi laporan keuangan pajak komersial (sak) tata cara melayani pemeriksaan pajak 238 analisis strategi bisnis pt kalbe farma tbk melalui aktifitas merger internal 238 sinergi oposisi binterformulasi tujuan dasar laporan keuangan akuntansi syariah 239 unsur - unsur biaya perusahaan tidak diperkenankan sebagai pengurang penghasilan bruto (wajib pajak pt x ) 239 urgensi laporan keuangan (akuntansi syariah) praktik ekonomi islam 24 analisis penerapan psak no27 tahun 2007 laporan keuangan koperasi pekerja putri tujuh (kop-ppt) ptpertamina (persero) up ii dumai sei pakning 24 penilaian kinerja keuangan perusahaan perusahaan daerah air minum (pdam) kabupaten boyolali 240 pengaruh publikasi laporan keuangan tahunan harga saham bursa efek jakarta 240 pengukuran risiko strategik metode generalized information-based ordinal time series sub industri perbankan periode 2002-2005 241 analisis kegunaan laporan keuangan pengambilan keputusan investasi pasar modal indonesia 241 analisis pengaruh return on assets debt equity ratio dividend payout ratio value of stock kasus perusahaan publik bursa efek jakarta 242 kajian implikasi restrukturisasi hutang pt x ditinjau dari sudut pandang akuntansi perpajakan 242 pengaruh konservatisma laporan keuangan earnings response coefficient 243 analisis kualitas pengungkapan laporan keuangan berdasarkan kinerja keuangansektor manufaktur bej 243 evaluasi kebijakan modal dikaitkan kinerja keuangan perusahaan kasus pt jakarana tama 244 kemampuan arus kas laba memprediksi arus kas perusahaan (perusahaan manufaktur go publik bursa efek jakarta) 244 penyajian laporan keuangan kerangka tax planningkasus pt x bandung 245 manajemen laba status keterlambatan perusahaan menyampaikan laporan keuangan tahunan 245 pengaruh beta saham volume perdagangan saham perusahaan manufaktur go publik bursa efek jakarta tahun 2007 246 analisis laporan keuangan koperasi karyawan universitas kuningan tahun buku 2004-2005 246 analisis tingkat kesehatan bank bpr bkk jetis kecamatan karanganyar 247 analisis kinerja keuangan rasio du pont system perusahaan meubel cv permata tujuh wonokarto wonogiri 247 deskripsi atas proses akuntansi kandungan informasi laporan keuangan tujuan pelaporan umum 248 analisis perbandingan kinerja keuangan antara bank konvensional bank syariah (pt bank artha graha internasional pt bank muamalat indonesia) 248 laporan keuangan bank dipublikasikan sebagai indikator kesehatan bank 249 analisis kinerja keuangan perusahaan koperasi karyawan bri cabang tuban 249 pengungkapan kerugian kontinjensi laporan keuangan 25 analisis rasio kinerja ditinjau dari aspek keuangan perusahaan daerah air minum kabupaten sukoharjo 25 perlakuan koreksi fiskal laporan keuangan pt x menentukan besarnya pajak penghasilan terutang 250 hubungan laporan keuangan upaya penghindaran pajak penghasilan tinggi 250 kemampuan rasio likuiditas profitabilitas solvabilitas aktivitas memprediksi perubahan laba perusahaan manufaktur memperhatikan ukuran perusahaan (perusahaan manufaktur terdaftar bursa efek jakarta tahun 2002-2005) 251 analisa hubungan pengelolaan laba melalui akrual harga saham perdana perusahaan dampaknya kinerja perusahaan setelah penawaran umum perdana 251 peranan laporan keuangan klien kualitas opini akuntansuatu tinjauan pustaka 252 analisis ratio menilai performance perusahaan dari laporan keuangan disampaikan nasabahsuatu tinjauan pustaka 252 sistem informasi operasional perjalanan dinas harian koperasi telekomunikasi selular tasikmalaya 253 pemeriksaan khusus oleh akuntan publik atas kelayakan penyajian aktiva tetap laporan keuangan pttetra mega satria 253 pengaruh financial leverage 254 analisis degree of operating leverage 254 pemeriksaan akuntan ekstern aktiva tetap sebagai bagian dari pelaksanaan pemeriksaan (general audit) atas laporan keuangan pt polly ultra chemical co 255 pemeriksaan akuntan publik piutang penjualan sebagai bagian dari pelaksanaan pemeriksaan (general audit) atas laporan keuangan pt kintana agung serasi 255 tinjauan atas arus kas masuk 256 pemeriksaan akuntan publik piutang perkiraan-perkiraan berhubungan (berkaitan) menentukan kewajaran atas laporan keuangan suatu pt bat indonesia 256 pengaruh laverage ratio tingkat profitabilitas perusahaan (pt perusahaan gas negara (persero) tbk) 257 analisa laporran keuangan pt yanmar diesel indonesia mengetahui likiuiditas rentabilitas perusahaan 257 pengaruh perputaran aktiva lancar profitabilitas divisi jaringan telekomunikasi seluler pt industri telekomunikasi indonesia (persero) bandung 258 evaluasi standar analisa belanja (sab) belanja operasional pemeliharaan (bop) kegiatan pelatihan dinas pendidikan kota bogor 258 tinjauan analisa laporan keuangan ptmatahari putra prima tahun 1994-1997 mengetahui likuiditas rentabilitas pola pembelanjaan perusahaan 259 analisis hubungan kinerja risiko perusahaan perbankan bursa efek jakarta 259 relevansi konsep historical cost penyajian laporan keuangan volatilitas tingkat daya beli uang 26 penggunaan informasi laba arus kas memprediksi laba masa akan datang 26 rekonsiliasi laporan keuangan komersial menjadi laporan keuangan fiskal menghitung pajak penghasilan terutang pt x 260 financial audit atas penjualan piutang dagang pt x 260 kajian kebijakan perpajakan kerangka transfer pricing perusahaan multinasional sehubungan perjanjian alokasi biaya pt xyz indonesia 261 desentralisasi bidang pariwisata daerah (peletakan kewenangan pengelolaan taman wisata candi prambanan daerah istimewa yogyakarta) 261 financial audit atas aktiva tetap pt x 262 analisis hubungan investasi kinerja rasio kecukupan dana produk dometik bruto perkembangan investasi dana pensiun indonesiaperiode tahun 1996-2001 262 management audit atas aktiva tetap pt halliburton 263 analisis evaluasi penerapan blue ocean strategy kbtm (kelompok bina usaha tani muslim) usaha peternakan ayam 263 pengaruh laporan keuangan auditan respon investor pengambilan keputusan investasi 264 penerapan sak no 46 tentang akuntansi pajak penghasilan laporan keuangan pt x surabaya 264 return pasar saham kebijaksanaan moneter 265 analisis faktor-faktor mempengaruhi audit delay empiris bursa efek jakarta tahun 2003 265 analisis pengaruh roi eva mva kasus perusahaann industri jasa telekomunikasi tranportasi 266 analisis kemampuan prediksi laporan arus kas kinerja perusahaan berdasarkan rasio arus kas kasus pt excelcomindo pratama tbk 266 pendekatan kombinasi metode ahp metode cut off point tahap analisis keputusan perancangan sistem informasi penjualan ptx 267 hasil pemeriksaan atas laporan keuangan brr nad-nias tahun anggaran 2005 267 penerapan akuntansi manajemen perusahaan manufaktur milik swasta indonesia 268 pengaruh perputaran modal kerja perubahan harga saham pt hm sampoerna tbk bandung 268 peran laporan keuangan sebagai alat bantuan propinsi banten (implementasi peraturan pemerintah ri no 24 tahun 2005 269 analisis hubungan return saham earning cash flow jangka panjang bursa efek jakarta 269 laporan keuangan periode april 1994 s/d maret 1995 april 1995 s/d juni 1995 27 analisis pengaruh rasio profitabilitas solvabilitas aktivitas pertumbuhan laba perusahaan manufaktur terdaftar bursa efek jakarta periode 2002-2005 27 pemahaman pelaku bisnis sektor rumah makan restoran laporan keuangan kota pekanbaru 270 dampak perubahan harga informasi terdapat laporan keuangan tersaji berbasis harga perolehan 270 pengaruh kurs perolehan laba kilang pt pertamina (persero) up-vi balongan 271 analisis perbedaan return abnormal return cummulative abnormal return (cab) cummulative average abnormal return (caar) security return variability (srv) sahan sebelum setelah pengumuman laporan keuangan tahun 2006 (studi perusahaan manufa 271 how bits and bytes work 272 analisis perancangan sistem informasi akuntansi penerimaan pengeluaran kas berbasis web menghasilkan laporan keuangan partai politik (partai keadilan sejahtera) 273 pemeriksaan akuntan atas penjualan piutang usaha pt graha insan selular menunjang pengendalian intern 28 analisis kegiatan perdagangan saham variabilitas return saham sekitar hari pengumuman laporan keuangan tahunan 28 analisis kinerja perusahaan manufaktur sebelum sesudah melakukan merger akuisisi bursa efek indonesia 29 pengaruh profesionalisme auditor penemuan indikasi kecurangan laporan keuangan klien kantor akuntan publik sumatera 29 pengaruh struktur kepemilikan manajerial struktur kepemilikan institusional ukuran perusahaan pengaturan laba (earnings management) 3 analisis faktor-faktor mempengaruhi ketetapan waktu penyampaian laporan keuangan ke publik perusahaan terdaftar bei (2005-2007) 3 analisis pengaruh akuisisi kinerja perusahaan (studi empiris pt sampoerna tbk bursa efek indonesia) 30 analisis perbedaan likuiditas volume perdagangan saham sebelum sesudah stock split bursa efek indonesia 30 reaksi pasar atas pengumuman laba perusahaan lq-45 bursa efek indonesia tahun 2008 305 perlakuan pajak penghasilan pajak lebih bayar pengaruhnya laporan keuangan perusahaan konstruksi 306 analisis atas ketaatan penyajian laporan keuangan perusahaan terbuka indonesia 307 manipulasi laporan keuangan oleh emiten bergerak sebagai perusahaan efek (analisis kasus pt united capital indonesia tbk) 308 studi komparasi metode data mining memprediksi kebangkrutan bank 309 tinjauan atas laporan keuangan sebagai alat bantu mengukur rasio rentabilitas koerpas karyawan ptbank jabar cabang soreang 31 evaluasi rekonsiliasi laporan keuangan komersial laporan keuangan fiskal menghitung pajak penghasilan terutang pt app 31 pengaruh kepemilikan manajerial kepemilikan institusional kebijakan hutang perusahaan perusahaan manufaktur bej periode 2004-2006 310 analisa laporan keuangan atas rasio likuiditas ptbank negara indonesia (persero) tbk cabitb taman sari bandung 311 analisis rasio solvabilitas atas laporan keuangan ptbank bni (persero) tbk cabang itb bandung 312 pengaruh pengumuman laporan keuangan variabilitas tingkat keuntungan saham memperhatikan perubahan laba akuntansi 313 persepsi pengguna laporan keuangan kualitas informasi akuntansi (survey bpr sukoharjo) 314 analisis pengaruh faktor-faktor keuangan pengungkapan sukarela laporan keuangan tahunan perusahaan manufaktur terdaftar bursa efek indonesia 315 kebijaksanaan undang-undang pajak penghasilan tahun 1983 menimbulkan laba berbeda akibat timing differences serta pengaruhnya laporan keuangan laporan penelitian 316 laporan keuangan sebagai laporan pertanggung jawaban pengelolaan dana smp widya sakti daerah tk ii kodya denpasar laporan penelitian 317 analisis laporan keuangan koperasi primer daerah kabupaten buleleng tahun buku 1992 laporan penelitian 318 pengaruh budaya sikap pimpinan puncak kepala bagian akuntansi perusahaan go public survei penyajian laporan keuangan pengambilan keputusan para investor pasar modal jakarta 319 efektivitas manajemen melalui evaluasi laporan keuangan pt perkebunan xxvii (persero) jember laporan penelitian 32 analisa laporan keuangan pt samudera indonesia tbk periode 2002-2004 32 pengaruh kepemilikan manajerial kepemilikan institusional kebijakan hutang perusahaan non manufaktur bursa efek indonesia periode 2004 - 2006 320 analisis relevansi laporan keuangan perusahaan go-public manfaatnya pengambilan keputusan investasi pasar modal indonesia laporan akhir hasil penelitian 321 pedoman tentang penyusunan laporan keuangan penyajian harga pokok pengganti sekarang bagi perusahaan telah menawarkan efeknya melalui pasar modal (replacement accounting) tahun 1982/1983 laporan tim penelitian 322 pengaruh perlakuan akuntansi tingkat harga umum informasi laporan keuangan koperasi bali laporan penelitian 323 manfaat penerapan akuntansi tingkat harga umum laporan keuangan perusahaan kasus bursa efek jakarta laporan penelitian 324 studi eksplorasi tentang kesiapan akuntan publik jawa timur berkaitan penugasan audit laporan keuangan pemerintah daerah laporan penelitian 325 praktek voluntary disclosure laporan keuangan sebagai pendukung prinsip good corporate governance perusahaan publik indonesia laporan penelitian 326 analisis hubungan laporan keuangan pemecahan masalah permodalan ukm berbasis agribisnis kota pontianak kalimantan barat laporan penelitian 327 pengaruh penerapan good corporate governance kualitas laporan keuangan nilai perusahaan 328 analisis karakteristik perusahaan sebagai penentu kualitas laba implikasinya pengguna laporan keuangan 329 analisis model laporan keuangan upaya meningkatkan akuntabilitas publik pengelolaan keuangan perguruan tinggi swasta kabupaten sidoarjo 33 analisis break even manfaatnya sebagai dasar perencanaan laba perusahaan plastik tri tan lestari telukan sukoharjo 33 analisis laporan keuangan pt astra otoparts tbk periode 2002-2004 330 analisis pengaruh antara tingkat ketaatan pengungkapan informasi laporan keuangan (disclosure) per eps perusahaan telekomunikasi listing burs efek jakarta (bej) th 2003-2005 331 pengujian size hypothesis debt/equity hypothesis mempengaruhi tingkat konservatisma laporan keuangan perusahaan tehnik analisis multinominal logit 332 reaksi pasar ketepatwaktuan penyampaian laporan keuangandi bursa efek jakarta 333 analisis perbedaan elemen-elemn laporan keuangan database bursa efek jakarta (bej) indonesian capital market directory (icmd) 334 faktor-faktor mempengaruhi kelengkapan pengungkapan laporan keuangan perusahaan manufaktur terdaftar bursa efek jakarta 335 pengaruh ketepatan waktu publikasi laporan keuangan kandungan kualitas informasi laba akuntansi pasar modal indonesia 336 analisis laporan keuangan metode z-score unuk memprediksi kemungkinan kepailitan pt bakrie brothers tbk 337 investasi pasar modal berdasarkan laporan keuangan harga saham 338 aspek-aspek penting dipahami oleh para ahli/praktisi hukum penyusunan laporan keuangan suatu perseroan terbatassuatu pendekatan good corporate governance 339 analisis faktor-faktor mempengaruhi tingkat kelengkapan pengungakapn informasi laporan keuanganempiris perusahaan manufaktur bej 34 analisis laporan keuangan pt indofarma (persero) tbk 34 perubahan rasio keuangan sebagai prediktor pertumbuhan laba perusahaan perbankan terdaftar bursa efek indonesia 340 analisis beberapa faktor mempengaruhi kelangkapan penungkapan laporan keuangan perusahaan jasa transportasi perdagangan manufaktur tercatat bursa efek jakarta 341 analisis hubungan antara profesionalisme auditor pertimbangan tingkat materialitas proses pengauditan laporan keuangan 342 kajian atas beberapa karakteristik kualitatif laporan keuangan bernilai tinggi ditinjau dari kualitas informasi hirarki kualitas akuntansi 343 perbedaan perilaku etis tekanan kerja perspektif gender audit judgment laporan keuangan historis kompleksitas tugas 344 standard akuntansi perbankan dasar proses pencatatan operasional bank 345 tinjauan analisis rasio laporan keuangan koperasi ppdia bandung 346 pengaruh laporan keuangan kinerja saham pt bank mandiri (persero) tbk dibandingkan pt bni 46 (persero) tbk pt bank rakyat indonesia (persero) tbk 347 faktor-faktor mempengaruhi kelengkapan pengungkapan wajib laporan keuangan industri manufaktur termasuk saham-saham lq 45 bursa efek indonesia 348 analisis manajemen aset atau barang milik negara mendukung penyusunan laporan keuangan pemerintah pusat studi sekolah lingkungan departemen agama propinsi diy tahun 2008 349 analisis pengaruh perubahan laba (rugi) selisih kurs perubahan eps perubahan cash flow cumulative abnormal return sekitar tanggal publikasi laporan keuangan study kasus saham-saham lq 45 bei 35 analisis kinerja keuangan ksps-baitul maal wat tamwil (bmt) dinar barokah jumapolo karanganyar tahun 2007-2008 35 analisis laporan keuangan pt indonesian satellite corporation tbk 350 analisis faktor-faktor mempengaruhui ketepatan waktu penyampaian laporan keuangan studi empiris perusahaan-perusahaan terdaftar bej periode 2004-2006 351 pengaruh pengumuman laporan keuangan 2007 abnormal return trading volume activity perusahaan lq 45 2002-2006 352 persepsi akuntan publik mengenai faktor-faktor penyebab tidak terungkapnya penyimpangan audit report 353 persepsi akuntan publik mengenai faktor-faktor penyebab tidak terungkapnya penyimpangan audit report 354 risiko materialitassuatu pertimbangan pelaksanaan audit 355 analisa pengaruh akuntansi tingkat harga umum laporan keuangan rasio keuangan perusahaan-perusahaan go publik 356 perbedaan pengaruh laporankeuangan diaudit tidak diaudit pemeriksaa pajak kasus kantor pemeriksaan penyidikan pajak karawang 357 penerapan psak no 46 tentang akuntansi pajak penghasilan rangka menyajikan laporan keuangan lebih relevan infomatif pt x 358 penerapan standar akuntansi keuangan nomor 46 penyajian laporan keuangan ptx 359 penerapan psak no 52 pt nusa sastratara utama surabaya 36 analisa break even point sebagai alat perencanaan laba perusahaan jamu pt air mancur palur karanganyar 36 analisis pencatatan aktiva tetap penyusutan laporan keuangan pt mitra folding gate 360 perancangan pembuatan sistem informasi akuntansi pt citrasulawesi sejahtera 361 analisis faktor-faktor mempengaruhi kelengkapan pengungkapan laporan keuangan (pada perusahaan manufaktur terdaftar bursa efek indonesia) 362 evaluasi penyusunan laporan keuangan koperasi pegawai republik indonesia (kpri) keluarga kabupaten sragen 363 peranan laporan keuangan komersial 364 tinjauan atas prosedur pemeriksaan laporan keuangan daerah perwakilan xi badan pemeriksa keuangan republik indonesia bandung 365 suatu tinjauan analisa ratio solvabilitas cvarya duta bandung 366 suatu tinjauan atas analisa ratio rentabilitas 367 dampak pengumuman laporan keuangan variabilitas tingkat keuntungan saham memperhatikan laba akuntansi 368 evaluasi penerapan penyajian laporan keuangan lembaga keuangan syariah berdasarkan psak no 59 (survai bmi bmt) analisis faktor-faktor mempengaruhi kelengkapan pengungkapan sukarela laporan keuangan perusahaan manufaktur terdaftar bursa efek indonesia (bei) 37 analisis faktor-faktor mempengaruhi struktur modal perusahaan manufaktur terdaftar bursa efek indonesia 37 analisis rasio atas laporan keuangan mengukur kinerja pt erakomp infonusa 370 akuntansi dasar 371 akuntansi keuangan menengah ii 372 aplikasi teori kebangkrutan kelangsungan hidup industri perternakan makanan ternak indonesia (perusahaan terbuka peternakan makanan ternak periode 1998 - 2000) 373 penilaian kinerja keuangan perusahaan industri farmasi menggunakan analisis return on investment (roi) economic value added (eva) 374 analisa laporan keuangan pt x melihat kinerja perusahaan 375 analisis kinerja keuangan empat perusahaan go public kelompok industri kosmetik barang keperluan rumah tangga periode 1998 - 2002 376 pemeriksaan laporan keuangan atas siklus penjualan penagihan pt deka adhinusa 377 analisis pengaruh perubahan kebijakan kredit pendapatan pt dutaflow hidrolik 378 financial audit audit atas aktiva tetap pt 'x' 379 faktor-faktor mempengaruhi risiko sahamempiris perusahaan go public indonesia (the factors that affect stock riskempirical study of go public enterprises in indonesia) 38 analisis kinerja keuangan perusahaan publik melakukan merger akuisisi sebelum sesudah krisis moneter bursa efek jakarta 38 evaluasi laporan keuangan komersial mengefesiensikan pph badan pt aidc 380 evaluasi perlakuan akuntansi penyajian sewa guna usaha laporan keuangan ditinjau dari sisi lessor (pt sgf) 381 finansial audit atas aktiva tetap pt xyz (financial audit on fixed assets in the pt xyz) 382 financial audit atas penjualan piutang dagang penerimaan kas ptx 383 analisa laporan keuangan perusahaan sebagai dasar perhitungan pajak penghasilan bagi pt x 384 analisis kinerja keuangan perusahaan industri rokok periode 1999-2003 385 perbandingan laporan keuangan tahun 2000 2001 kaitannya pph pasal 21 ptpuncak mas perkasa 386 implementasi metode akuntansi perminyakan production sharing contract dibandingkan psak nomor 29 industri migas pengaruhnya laporan keuangan 387 evaluasi pemenuhan kewajiban perpajakan perusahaan jasa persewaan mobil pt x (evaluation of fulifillment of tax obligation in car rental company case study pt x) 388 financial audit atas penjualan piutang dagang pt x 389 analisis perbandingan kinerja keuangan pt telekomunikasi indonesia tbk pt indonesian satellite corporation tbk periode 2000 - 2004 39 analisis penilaian kinerja keuangan perusahaan go public sektor consumer goods (pt mustika ratu tbk terdaftar bei) 39 optimalisasi pemanfaatan teknologi informasi dlm pembuatan laporan keuangan 390 peranan analisis laporan arus kas bagi perusahaankasus pt hms 391 simulasi pengukuran balanced scorecard pt biotek indonesia 392 simulasi pengukuran balanced scorecard pt biotek indonesia 393 analisis hubungan pergerakan rasio-rasio arus kas pergerakan return saham pergerakan volume perdagangan saham 394 audit keuangan atas aktiva tetap pt alam sumbervita 395 analisa perlakuan penerapan pajak penghasilan pt pratama jaya nusantara dihubungkan laporan keuangan perusahaan 396 analisis pencatatan piutang penyisihan piutang tak tertagih laporan keuangan dikeluarkan oleh pt tira austenite tbk 397 analisis penerapan psak no 46 pengaruhnya laba pt sentosa selamanya 398 analisis pengaruh struktur kepemilikan proporsi dewan komisaris independen ukuran perusahaan kredibilitas laporan keuangan 399 evaluasi atas perlakuan akuntansi penyajian sewa guna usaha laporan keuangan ditinjau dari sisi lessee pt spinning mills 4 analisis perkembangan tingkat kesehatan perusahaan rasio keuangan industri cement terdaftar bursa efek indonesia 4 resume laporan keuangan kementerian negara/lembaga laporan keuangan bun tahun 2008 40 laporan keuangan tahun anggaran 2003 40 penilaian kinerja keuangan koperasi bmt binamaal kecamatan bobotsari purbalingga 400 audit keuangan atas pendapatan piutang usaha pt indosat tbk 401 penerapan balanced scorecard pengukuran kinerja hotel arwida 402 audit finansial atas daftar aktiva tetap menguji kewajarannya tanggal 31 desember 2007 pt chiquita talonplas zipper 403 analisa perlakuan akuntansi atas sewa penyajiannya laporan keuangan pt sinar indonesia finance 404 analisis perhitungan pph pasal 21 pt multisarana kaitan laporan keuangan 2004 405 analisis kinerja keuangan pt (persero) asuransi kesehatan indonesia periode 2001 - 2005 406 analisiskinerja keuangan prediksi kebangkrutan pt indah kiat pulp paper tbk periode 2002-2006 407 hubungan antara manajemen laba tingkat pengungkapan laporan keuangan 408 analisis faktof-faktor mempengaruhi luas pengungkapan sukarela laporan tahunan perusahaan manufaktur terdaftar bursa efek indonesia 409 analisis laporan keuangan 41 analisis kinerja keuangan koperasi mahasiswa ums surakarta 410 peranan sistem informasi akuntansi 411 sikap analisis keuangan ciri kualitatif nilai prediktif laporan keuangan 412 penerapan pajak masukan tidak dapat dikreditkan serta pengaruhnya laporan keuangan pt x kaltim 413 rekonsiliasi fiskal perusahaan pertambangan pt x 414 evaluasi perlakuan akuntansi transaksi lindung nilai valuta asing laporan keuangan pt x 415 perlakuan pajak pertambahan nilai atas impor inden serta pengaruhnya laporan keuangan fiskal pt x surabaya 416 persepsi mahasiswa akuntansi etika profesi auditor mendeteksi kecurangan penyajian laporan keuangan (survey universitas muhammadiyah surakata universitas sebelas maret) 417 dampak pengumuman laporan keuangan variabilitas tingkat keuntungan saham memperhatikan laba akuntansi 418 analisis pengaruh informasi pengumuman laporan keuangan abnormal return saham perusahaan automotive bursa efek indonesia tahun 2005 419 analisis pengaruh publikasi laporan keuangan abnormal return saham perusahaan manufaktur bursa efek jakarta 42 analisis titik impas sebagai dasar penentuan target laba perusahaan dikehendaki pt aqua golden mississipi tbk tahun 2005-2007 420 penerapan standar akuntansi keuangan penyusunan laporan keuangan perusahaan manufaktur kabupaten sragen 421 pengaruh profitabilitas perusahaan opini audit ketepatan waktu pelaporan laporan keuangan (studi perusahaan manufaktur bej th 2003-2005) 422 analisis pengaruh pengumuman laporan keuangan abnormal return saham perusahaan manufaktur bursa efek jakarta 423 analisis pengaruh informasi pengumuman laporan keuangan abnormal return saham perusahaan automotive bursa efek indonesia tahun 2005 424 analisis penggunaan modal kerja mengukur efisiensi operasi perusahaan pt ultrajaya milk industry trading company tbk 425 persepsi pemakai laporan keuangan auditor mahasiswa akuntansi expectation gap (studi empiris kota medan) 426 analisa kinerja keuangan bank muamalat indonesia 427 analisis kinerja keuangan perusahaan perbankan bumn periode 2000-2003 428 analisis pengaruh faktor-faktor keuangan non keuangan pengungkapan sukarela laporan keuangan tahunan perusahaan manufaktur terdaftar bei 429 perbedaan pengaruh perhitungan laba menurut akuntansi ketentuan perpajakan laporan keuangan penetapan besarnya pajak penghasilan 43 pengaruh informasi akuntansi efektivitas pembayaran premi asuransi jiwa bumi putera (ajb) 1912 rayon klaten 430 tinjauan prosedur penyajian laporan keuangan perusahaan daerah kebersihan (pdk) kota bandung 431 pengaruh komponen laporan keuangan harga saham beberapa perusahaan asuransi kerugian diuraikan rasio early warning system (1998-2003) 432 analisis laporan keuangan sebagai salah satu aspek pertimbangan penentuan alternatif pendanaankasus pt x 433 perancangan sistem informasi akuntansi laporan keuangan toko buku nirwana cimahi 434 analisis laporan keuangan rasio likuiditas pt bank jabar 435 analisis laporan keuangan sebagai salah satu 436 analisis rasio laporan keuangan sebagai alat bantu manajemen menilai kinerja keuangan perusahaan pt asuransi jiwasraya (persero) branch office 437 tinjauan prosedur penyajian laporan keuangan hotel taman sari sukabumi 438 peranan ratio likuiditas 439 analisis laporan keuangan pt bank jabar cabang pembantu padalarang 44 analisis penilaian tingkat kesehatan bank (studi empiris bank umum swasta nasional go public terdaftar bursa efek indonesia tahun 2005-2007) 440 analisis laporan keuangan pt industri telekomunikasi indonesia (persero) 441 hubungan kandungan informasi pendapatan bunga bersih komponen arus kas pengungkapan pos-pos laporan keuangan expected return saham perbankan (studi industri perbankan tedaftar bej periode 2002 - 2006) 442 evaluasi metode pengakuan pendapatan diterapkan pt surya kencana adimas dampaknya laporan keuangan 443 perancangan pembuatan sistem informasi akuntansi pt merpati duta niaga 444 pengaruh budaya sistem akuntansi pelaporan keuangan 445 perbandingan standar akuntansi fiskal serta pengaruhnya laporan keuangan 446 rerangka konseptual pelaporan keuangan perspektif islam 447 sarbanes-oxley act mungkinkah diterapkan indonesia? 448 pengaruh struktur modal profitabilitas perusahaan kelengkapan pengungkapan (disclosure) laporan keuangan (studi empiris perusahaan terdaftar bei) 449 dampak pengumuman laporan keuangan return volume perdagangan saham perusahaan manufaktur bursa efek indonesia 45 analisis tingkat kesehatan keuangan metode camel (pt bpr binalanggeng mulia sukoharjo tahun 2005-2007) 450 analisa kinerja keuangan rumah sakit amal sehat slogohimo kabupaten wonogiri tahun 2005 2007 451 analisis pengaruh manajemen laba (earnings management) penyajian laporan keuangan perusahaan publik (study empiris perusahaan manufaktur bei periode 2003 2005) 453 pengaruh ukuran perusahaan laverage likuiditas profitabilitas reputasi auditor tingkat kelengkapan pengungkapan sukarela laporan keuangan (studi empiris perusahaan manufaktur terdaftar bursa efek indonesia tahun 2006) 454 pengaruh analisa rasio keuangan investasi aktiva tetap pt inti (persero) bandung 455 analisis perbandingan perhitungan laba sebelum pajak menurut standar akuntansi keuangan penghasilan kena pajak menurut ketentuan peraturan perundang-undangan perpajakan (pt pos indonesia (persero) tahun 2002 - 2005) 456 analisa kinerja perusahaan fuzzy inference systems 457 pengantar akuntansi 458 evaluasi perlakuan akuntansi pelaporan transaksi sewa guna usaha (leasing) laporan keuangan ditinjau dari sisi lessor (pt bfi finance indonesia tbk) 459 audit keuangan atas penjualan harga pokok penjualan menilai kewajaran serta penerapan matching principle pt surya agroindustri rekayasa 46 flypaper effect dana alokasi umum (dau) pendapatan asli daerah (pad) belanja daerah kabupaten/ kota propinsi jawa tengah tahun anggaran 2007 460 analisis penerapan pajak penghasilan dana pensiun sint carolus 461 analisis kinerja keuangan pt surya citra media tbk pendekatan analisis rasio keuangan periode 2003 2007 462 audit manajemen atas fungsi personalia khususnya fungsi perekrutan sumber daya manusia menilai efisiensi efektivitas pt hero supermarket tbk 463 analisa laporan keuangan pemenuhan kewajiban perusahaan menggunakan rasio solvabilitas (debt to asset ratio) ptasuransi jiwa seraya bandung regional office 464 proses pembuatan laporan keuangan pengambilan barang primer primkopad kodim 0604 karawang 465 manajemen laba status keterlambatan perusahaan menyampaikan laporan keuangan tahunan 466 perbedaan persepsi mahasiswa akuntansi etika penyusunan laporan keuangan 467 pengaruh publikasi laporan keuangan perubahan harga saham transaksi perdagangan saham 468 program aplikasi laporan keuangan penginapan wisma dirgantara bandung 469 sistem pembukuan menunjang laporan keuangan dinas pertanian tanaman pangan propinsi jawa barat 47 analisis rasio keuangan mengukur efisiensi penggunaan dana pt pln (persero) area pelayanan pelanggan semara 470 pengaruh ketepatwaktuan publikasi laporan keuangan kandungan kualitas informasi laba akuntansi pasar modal indonesia 471 analisis laporan keuangan menggunakan rasio camel metode altman sebagai alat memprediksi tingkat kegagalan usaha bank' 472 bahan bukti audit 473 prinsip standar akuntansi 474 pemisahan laporan keuangan menurut unit bisnis peningkatan kinerja perbankan kasus bank xyz 475 reaksi return volume perdagangan saham publikasi laporan keuangan interimkasus beberapa perusahaan listing pt bej 476 analisis laporan keuangan memprediksi potensi kebangkrutan perusahaan dunia sandang abadi jaten karanganyar 477 analisis penerapan pernyataan standar akuntansi keuangan perkoperasian (survey koperasi kecamatan tanon kabupaten sragen) 478 faktor-faktor mempengaruhi waktu penyampaian laporan keuangan tahunan (studi empiris perusahaan manufaktur terdaftar bej) 479 peran analisis laporan keuangan calon nasabah keputusan pemberian kredit (bri unit nguter) 48 perbedaan discretionary accruals antara perusahaan manufaktur laba perusahaan manufaktur rugi 480 pengaruh ukuran perusahaan leverage likuiditas profitabilitas price book value tingkat kelengkapan pengungkapan laporan tahunan (studi empiris perusahaan manufaktur terdaftar bursa efek jakarta tahun 2005) 481 perlakuan akuntansi pajak pertambahan nilai capital lease rangka penyajian laporan keuangan fiskal pt x sidoarjo 482 analisis penerapan standar akuntansi keuangan koperasi koperasi pegawai republik indonesia (kpri) (survei kpri wilayah kabupaten boyolali) 483 analisis penerapan standar akuntansi keuangan koperasi koperasi pegawai republik indonesia sragen 484 pengaruh faktor-faktor keuangan non keuangan pengungkapan sukarela laporan keuangan (studi empiris perusahaan manufaktur terdaftar bursa efek indonesia) 485 analisis faktor-faktor berpengaruh ketepatan waktu pelaporan keuangan perusahaan manufaktur terdaftar bursa efek indonesia 486 sistem informasi laporan keuangan 487 analisa penyusunan laporan keuangan 488 prosedur pembukuan menunjang laporan keuangan dinas pertanian tanaman pangan propinsi jawa barat bandung 489 prosedur penyusunan laporan keuangan sub bagian perencanaan keuangan kantor wilayah badan pertanahan nasional provinsi jawa barat bandung 49 analisis rasio keuangan metode altman z-score memprediksi potensi kebangkrutan perusahaan pt bentoel internasional investama tbk 490 analisis laporan keuangan sebagai bahan melakukan prediksi keuangan model z-score pdam tirta patriot kota bekasi 491 perancangan sistem informasi akuntansi laporan keuangan neraca pt makdis tour menggunakan microsoft visual basic 60 microsoft sql server 70 berbasis client server 492 pengaruh dividend payout leverage earning variability accounting beta risiko sistematis (ß) saham-saham perusahaan tergabung lq-45 (periode 2004-2006) tria astiana 493 pengaruh mekanisme corporate governance kualitas kantor akuntan publik integritas informasi laporan keuangan (perusahaan publik listing bej) 494 perbandingan and penerapan akuntansi selisih kurs ats transaksi impor aktiva tetap scr kredit menurut psak 10 and peraturan perpajakan serta pengaruhnya penyajian dlm laporan keuangan pt x 495 analisis biaya kualitas dilihat dari laporan keuangan tahunan perusahaan go public 496 penerapan pph badan rangka koreksi fiskal atas laba kena pajak pt x jakarta 497 analisis horizontal/analisis trend atas laporan keuangan (neraca aktiva)pada pt sucofindo (persero) cabang madya bandung 498 tinjauan atas analisis perbandingan laporan keuangan pt pln (persero) upj rancaekek 499 pengaruh rasio keuangan laba perusahaan manufaktur terdaftar bei 5 analisis penilaian tingkat kesehatan bank metode camel (pd bpr bkk tasikmadu cabang jatiyoso) 50 analisis rasio profitabilitas memprediksi laba (studi empiris perusahaan manufaktur terdaftar bei tahun 2004-2006) 500 analisis dampak restrukturisasi hutang pph badan kinerja keuangan pt x 501 perlakuan akuntansi pajak pertambahan nilai atas transaksi impor inden serta pengaruhnya laporan keuangan fiskal perusahaan indentor cv x 502 persepsi nasabah bank syariah informasi harus diungkapkan laporan nilai tambah laporan pertanggungjawaban sosial laporan keuangan bank syariah (survey bank bri syariah bank muammalat cabang surakarta) 503 analisis kemampuan laba akuntansi arus kas operasi memprediksi arus kas operasi masa depan (studi empiris perusahaan manufaktur go public bursa efek jakarta tahun 2002-2004) 504 evaluasi perlakuan akuntansi kapitalisasi atas biaya bunga pinjaman (psak no 26) ditinjau melalui pendekatan sejarah konseptual serta dampaknya sektor properti indonesia 505 pengaruh biaya standar pengendalian biaya produksi (pt coca cola company bandung) 506 studi mengenai dampak pengumuman laporan keuangan triwulan volume saham lq-45 (periode februari 2000 sampai desember 2005) 507 pengaruh non performing loan profitabilitas (suatu kasus pt bank syariah mandiri) 508 tinjauan analisis laporan keuangan atas rasio likuiditas koperasi pegawai pttelkom divre iii 509 tinjauan atas analisis rasio rentabilitas laporan keuangan ptpln (persero) p3b region jawa barat tahun 2003 2004 51 analisis efisiensi modal kerja koperasi karyawan rumah sakit islam surakarta tahun 2004 2006 510 tinjauan analisis laporan keuangan atas rasio solvabilitas ptkereta api (persero) 511 analisis laporan keuangan atas rasio solvabilitas ptkereta api (persero) bandung periode 2001-2003 512 tinjauan prosedur penyusunan laporan keuangan pt yoshida kogyo kabushiki kaisha (ykk) 513 perancangan sistem informasi akuntansi laporan keuangan taman bacaan psi comics plus bandung menggunakan microsoft access 2003 514 peranan rasio profitabilitas penilaian efisiensi aktifitas perusahaan koperasi waris primer ii banjarsari selatan surakarta periode tahun 1995-2001 515 peranan audit sistem informasi akuntansi berbasis komputer 516 analisis rasio rentabilitas atas laporan keuangan pt bank jabar 517 analisis laporan keuangan pt bank syariah mega indonesia 518 analisis penerapan standar akuntansi keuangan koperasi koperasi pegawai republik indonesia (kpri) (survey kpri surakarta) 519 analisis faktor-faktor mempengaruhi kelengkapan pengungkapan laporan keuangan perusahaan terdaftar bursa efek jakarta 52 perbedaan pengaturan laba antara perusahaan laba perusahaan rugi (studi empiris perusahaan manufaktur terdaftar bei) 520 penggunaan rasio keuangan memprediksi perubahan laba masa akan datang (studi empiris perusahaan perbankan terdaftar bej) 521 perancangan pembangunan aplikasi pembukuan berbasis open source menggunakan gambas bentuk live cd 522 analisis pengaruh arus kas operasi harga saham persistensi laba sebagai variabel intervening 523 analisis kinerja keuangan koperasi pegawai republik indonesia (kpri) karya sejahtera kabupaten blora 524 usulan perancangan sistem informasi laporan keuangan perusahaan penyewaan alat-alat sound sistem cv jasela 525 analisis laporan keuangan menggunakan akan rasio likuiditas pt bank jabar cabang majalengka 526 optimalisasi investasi pasar modal peralatan analisis hubungan harga saham rasio keuangan 527 model alternatif screening pembiayaan mudharabah musyarakah bank syariah indonesia 528 ketepatan waktu laporan keuangan perusahaan pasar modal berkembang 529 penerapan double entry bookkeeping badan usaha koperasi 53 pengaruh economic value added profitabilitas perusahaan return pemegang saham (studi empiris perusahaan manufaktur terdaftar bursa efek indonesia) 530 pencabutan ijin usaha perusahaan asuransi indonesia 531 evaluasi strategi penerapan akuntansi berbasis akrual laporan keuangan pemerintah menggunakan model kebutuhan dasar 532 tanggung jawab hukum akuntan publik atas opini laporan keuangan (ptkimia farma tahun 2001) 533 pengaruh profesionalisme auditor terhadappertimbangan tingkat materilitas prosespengauditan laporan keuangan (survei auditor kap wilayah surakarta yogyakarta) 534 analisis biaya-volume-laba koperasi wanita serba usaha setia budi wanita malang 1990-2004 muhammat abdul munir 535 dampak perusahaan dasar pengakuan pendapatan margin murabahah pendapatan operasi utama profitabilitas distribusi bagi hasil pt bank syariah muamalat indonesia tbk 536 laporan keuangan fungsi koperasi peternakan jakarta (koperda) ditinjau dari prinsip akuntansi undang-undang perkoperasian tahun 1992 serta implikasinya kesejahteraan anggotanya 537 benarkah arus kas operasi memiliki earnings persistance lebih tinggi dibanding akrual apakah return saham mencerminkan earnings arus kas operasi akrual?kajian empiris bursa efek jakarta 2000-2004 538 analisis tingkat pengungkapan wajib perusahaan-perusahaan manufaktur tercatat bursa efek jakarta tahun 2003-2005 539 analisa laporan keuangan unit waserda 54 analisis tingkat kesehatan bank konvensional bank umum syariah indonesia periode 2002-2006 540 analisis rasio likuiditas menilai keuangan pt btpn (persero) bandung 541 perancangan sistem informasi akuntansi laporan keuangan laba rugi pt sanggar mas jaya bandung menggunakan microsoft visual basic 60 sql server 70 berbasis client server 542 informasi fundamentalimplikasi prediksi laba pertimbangan moneter bank sentral selama periode 1998-2001 bursa efek jakarta 543 tinjauan peranan sistem informasi akuntansi perusahaan production sharing contract menghasilkan laporan keuangan sebagai pertanggungjawaban pertamina perusahaan induk serta partners 544 evaluasi implementasi standar akuntansi pemerintahan sekretariat jenderal departemen hukum ham ri 545 analisis rasio keuangan memprediksi pertumbuhan laba perusahaan manufaktur go public bei 2005-2007 546 analisis rasio keuangan sebagai alat pengawasan aktivitas finansial (kud kota boyolali) 547 hubungan antara profesionalisme auditor pertimbangan tingkat materialitas proses pengauditan laporan keuangan (survey auditor kantor akuntan publik wilayah surakarta yogyakarta) 548 analisis indikasi earnings management perusahaan manufaktur laba perusahaan manufaktur rugi indonesia (ditinjau dari laporan keuangan tahunan periode tahun 2002-2004) 549 faktor-faktor mempengaruhi ketepatan waktu penyampaian laporan keuangan perusahaan manufaktur terdaftar bursa efek jakarta (studi empiris periode 2002-2005) 55 analisis tingkat kesehatan keuangan pt perkebunan nusantara ix (persero) jawa tengah 550 analisis rasio keuangan menilai kinerja perusahaan consumer goods perusahaan kosmetik terdaftar bursa efek jakarta 551 prediksi kebangkrutan ditinjau dari analisis laporan keuangan 552 analisis laporan keuangan sebagai alat evaluasi kinerja koperasi pegawai negeri (kpn) jujur boyolali 553 sistem informasi arus kas masuk keluar berbasis client server percetakan 554 tinjauan atas proses penyusunan penyajian laporan keuangan cv mega data 555 analisis efisiensi industri perbankan indonesia 556 pengaruh rasio profitabilitas leverage prediksi perubahan laba masa depan perusahaan manufaktur go publik terdaftar pt bursa efek jakarta periode tahun 2003-2005 557 penggunaan metode economic value added (eva) sebagai alat pendukung pengukuran kinerja perusahaan pt hm sampoerna surabaya 558 penerapan tax planning mengefisiesikan nilai pajak penghasilan pt jatim lubritama gemilang surabaya 559 studi hubungan antara persepsi analis kredit pelaksanaan audit berkualitas dari kantor akuntan publik keputusan pemberian kredit 56 pengaruh rasio profitabilitas likuiditas leverage dividend payout ratio (studi empiris perusahaan manufaktur bej) 560 analisa capital lease operational lease roi eva debt to equity perusahaan manufaktur terdaftar bursa efek surabaya 561 evaluasi atas perhitungan pajak penghasilan laporan keuangan fiskal pt sumber purnama sakti metode tax planning 562 peranan kode etik profesi meningkatkan kepercayaan publik profesi akuntan publik 563 evaluasi kinerja keuangan perusahaan berdasarkan analisis rasio solvabilitas pt kereta api (persero) daop 2 bandung 564 analisis rasio rentabilitas atas laporan keuangan ptbank negara indonesia (persero) tbk kantor cabang itb bandung periode(2003-2007) 565 rasio keuangan sebagai prediktor tingkat kesehatan bumd dki jakarta 566 peranan metode lowballing cost oleh kantor akuntan publik surabaya 567 pengaruh tingkat pendidikan masa kerja pelatihan posisi pemerintahan pemahaman laporan keuangan daerah (studi empiris eksekutif legislatif lembaga pemerintahan kabupaten banjarnegara) 568 indikasi earnings management padalaporan keuangan fiskal laporan keuangan komersial (studi empiris wajib pajak badan kpp tegal purwokerto) 569 pengaruh motivasi intrinsik motivasi ekstrinsik persepsi kemudahan penggunaan (perceived ease of use) niat berperilaku menggunakan komputer penyusunan laporan keuangan (studi empiris skpd pemerintah daerah kota/ kabupaten se-propinsi bengkulu) 57 analisa pengaruh biaya keagenan resiko perusahaan kesempatan investasi kebijakan dividen perusahaan manufaktur terdaftar bursa efek indonesia 570 perbandingan penerapan psak no39 peraturan perpajakan aktiva dibiayai secara build operate and transfer (bot) 571 evaluasi perubahan bentuk badan usaha antara perusahaan perseroan perseroan terbatas serta implikasinya dari aspek perpajakan 572 persamaan perbedaan akuntansi keuangan akuntansi perpajakan 573 analisis perbandingan kinerja perusahaan menggunakan metode balance scorecard (perusahaan asuransi kota bandung) 574 mempersoalkan tanggung jawab opini auditor independen 575 peran prospek akuntan manajemen persaingan global 576 dampak reformasi pajak jasa profesi akuntan 577 masa kuliah international accounting gagasan antisipasi menghadapi era globalisasi ekonomi 578 pengaruh publikasi publikasi laporan arus kas volume perdagangan saham perusahaan bursa efek jakarta 579 perlindungan hukum pengguna jasa akuntan publik indonesiakini prospektifnya 58 pengaruh rasio profitabilitas beta akuntansi financial laverage likuiditas asset growth beta saham syariah perusahaan publik bursa efek jakarta (bej) 580 pembuatan sistem olap menganalisa profitabilitas konsumen produkkasus pt x sidoarjo 581 implementasi metode ensemble menilai performa bank 582 tinjauan akuntansi pertanggungjawaban sebagai dasar menilai kinerja manajer pusat investasi perusahaan daerah air minum (pdam) bekasi 583 pengaruh besarnya beban piutang usaha tak tertagih tingkat pendapatan usaha pt pln (persero) apj cianjur 584 hubungan beban pemasaran pendapatan (pt telekomunikasi indonesia tbk divisi flexi) 585 pengaruh non performing loan rentabilitas bank (kasus pt bank bukopin cabang bandung periode bulan januari 2005-mei 2006) 586 penggunaan pembelajaran kontekstual meningkatkan kemampuan penyelesaian soal siswa praktikum akuntansi [myob] penelitian tindakan kelas smk negeri 1 subang 587 pemanfaatan program billing rental komputer local area network (lan) 588 perancangan sistem informasi akuntansi laporan keuangan sumber dana penggunaan daanaa zakat () lwz salman itb bandung menggunakan microsoft visual basic 60 589 sistem informasi penyusunan anggaran biaya pt pln (persero) jasa produksi bandung 59 pengaruh rasio keuangan perubahan kinerja perusahaan manufaktur terdaftar bursa efek indonesia (bei) 590 prosedur laporan keuangan unit simpan pinjam koperasi pegawai kesehatan purwakarta 591 laporan hasil praktek kerja lapangan divisi management information system (mis) reporting bank bali tbk 592 penelitian tentang pengungkapan akuntansi sosial lingkungan oleh perusahaan 593 analisis atas manajemen aset tetap penerapan sistem akuntansi barang milik negara rumah sakit berstatus blukasus rsupn dr cipto mangunkusumo 594 manajemen laba status keterlambatan perusahaan publik menyampaikan laporan keuanganempiris perusahaan terdaftar bursa efek jakarta 595 analisis pencadangan biaya pesangon pt pgn (persero) tbk 596 analisis hubungan capital adequacy ratio loan to deposit ratio non performing loan net interest margin biaya operasional pendapatan operasional profitabilitas bank umum listing bursa efek indonesia periode 2003-2007 597 peran prinsip transparansi mewujudkan good corporate governance perseroan terbatas terbuka 598 pengaruh asimetri informasi disclosure cost of capital (studi perusahaan listing bei) ika fitriasih 599 management intention ke mana? 6 analisis kinerja keuangan sentra industri kerajinan kulit kabupaten magetan 6 analisis laporan keuangan ditinjau dari aspek likuiditas solvabilitas rentabilitas pt fitri muda pekanbaru 60 analisis camel rating system sebagai alat prediksi kebangkrutan bank (studi empiris bank go public tahun 2005-2006) 600 analisis pengaruh rasio-rasio keuangan bank go public harga sahamsuatu studi bank-bank go public bursa efek jakarta (bej) 601 bukti audit dari prespektif hukum 602 penerapan konsep economic value added (eva) sebagai alternatif penilaian kinerja perum pegadaian 603 peranan akuntansi manajemen pengambilan keputusan manajerial 604 analisis laporan keuangan menggunakan konsep economic value added mengetahui performansi perusahaan sebagai dasar penentuan strategi 605 evaluasi atas kesiapan pemerintah kota bekasi menerapkan laporan keuangan sesuai standar akuntansi pemerintah mewujudkan good government 606 hubungan rasio keuangan ukuran perusahaan arus kas laporan keuangan interim tahunan abnormal return saham empiris perusahaan manufaktur terdaftar bursa efek indonesia tahun 2002-2006 607 analisis efisiensi pasar saham-saham tergabung jakarta islamic index 608 faktor - faktor penyebab lemahnya fungsi sosial (baitul maal) bmt lampung 609 implementasi asas keterbukaan akuntabilitas yayasankasus yayasan kehati 61 mekanisme corporate governance perusahaan mengalami kesulitan keuangan (studi empiris bursa efek indonesia) 610 penilaian pelaksanaan sistem pengendalian intern pengelolaan sset tetap pemkot depok 611 analisis penerapan standar akuntansi keuangan koperasi koperasi pegawai republik indonesia (kpri) kabupaten klaten 612 evaluasi penyajian pengungkapan laporan keuangan perbankan syariah berdasarkan psak no 59 pt bank syariah mandiri tbk 613 analisis kinerja laporan keuangan (bank rakyat indonesia tbk tahun 2003 2007) 614 analisis rasio keuangan menilai kinerja perusahaan pertambangan jasa pertambangan terdaftar bursa efek indonesia 615 pengaruh informasi laporan arus kas return saham studi perusahaan manufaktur bei) 616 analisis rasio keuangan memprediksi pertumbuhan laba perusahaan manufaktur go public bursa efek jakarta tahun 2001-2005 617 analisis indikasi earnings management laporan keuangan tahunan perusahaan publik indonesia periode 2002 2006 (studi empiris perusahaan manufaktur terdaftar bei) 618 analisis indikasi earnings management laporan keuangan perusahaan publik terdaftar bursa efek jakarta 619 analisis penggunaan z-score altman menilai potensi kebangkrutan perusahaan manufaktur bursa efek jakarta 62 camel sebagai dasar penilaian tingkat kesehatan bank (studi bmt khasanah) 620 analisis laporan keuangan mengukur kinerja keuangan pt tambang timah tbk periode tahun 2005 2007 621 analisis kinerja laporan keuangan koperasi ternak makmur kauman desa karang anyar 622 analisa laporan keuangan mengukur kinerja keuangan bkk juwiring kabupaten klaten 623 pengaruh rasio keuangan perubahan kinerja perusahaan perbankan telah terdaftar bursa efek jakarta 624 mengukur kinerja keuangan menggunakan pendekatan analisis rasio keuangan cv permata 7 wonogiri 625 hubungan antara profesionalisme auditor pertimbangan tingkat materialitas proses pengauditan laporan keuangan (survey auditor kantor akuntan publik wilayah surakarta yogyakarta) 626 analisa laporan keuangan menilai kinerja keuangan perusahaan (studi pt eksport leaf indonesia tbk) 627 analisis penilaian kesehatan keuangan memprediksi potensi kebangkrutan perusahaan semen go public (studi empiris bursa efek jakarta periode 2002-2005) 628 analisis faktor-faktor berpengaruh perataan laba perusahaan manufaktur terdaftar bursa efek indonesia 629 analisa rasio keuangan penilaian kinerja perusahaan cv permata 7 furniture wonogiri 63 analisis kinerja keuangan kpri rasa tunggal kecamatan banjarsari 630 analisis laporan keuangan sebagai alat pengukur kinerja keuangan (pt batik danar hadi surakarta) 631 analisis perbandingan kinerja keuangan antara bank konvensional bank syariah periode 2005-2007 632 analisis laporan keuangan sebagai dasar penilaian tingkat kinerja keuangan koperasi subur surakarta 633 analisa efisiensi bursa efek jakarta ditinjau dari informasi tahunan perusahaan 634 pengaruh pemberian tugas terstruktur berbasis inkuiri peningkatan motivasi prestasi belajar akuntansi siswa smk salahuddin malang rika wijayanti 635 pengaruh ukuran perusahaan profitabilitas harga saham praktik perataan laba perusahaan manufaktur asing indonesia listing bursa efek indonesia tahun 2004-2006 rachma aulia 636 penerapan undang-undang no18 tahun 2000 penyerahan perolehan barang/jas kena pajak pt sido muncul surabaya 637 analisis perhitungan internal growth rate sustainable growth rate menentukan kebangkrutan perusahaan 638 rekonsiliasi fiskal perusahaan real estate pt x 639 analisis moving average convergence divergence (macd) menetukan sinyal membeli menjual perdagangan saham industri telekomunikasi bej 64 analisis faktor-faktor mempengaruhi harga saham (studi empiris perusahaan textile mill product manufaktures periode 2005-2007) 640 rekayasa akrual meminimalkan pajak perusahaan go publik 641 penerapan activity analysis meminimumkan biaya produksi pt 'x' 642 analisa hubungan jenis integrasi operasional perusahaan-perusahaan go publik 643 pengaruh tingkat perputaran persediaan barang jadi modal kerja pt pindad (persero) bandung 644 pengaruh modal kerja tingkat likuiditas perusahaan pt inti (persero) 645 penerapan sap pernyataan n002 laporan realisasi anggaran mewujudkan akuntabilitas transparansi pengelolaan keuangan daerah (unit kerja biro keuangan pemerintah provinsi jawa barat) 646 hubungan kredit macet rentabilitas bank bank rakyat indonesia unit cibalong cabang singaparna tasikmalaya (kajian rentabilitas berdasarkan return on assets (roa)) 647 penilaian kinerja keuangan bank berdasarkan analisis camel (pt bank jabar cabang majalengka) 648 pola pembelajaran ilmu pengetahuan sosial 649 tinjauan atas pencatatan 65 analisis efisiensi penggunaan modal cv widya karya raharja sragen 650 analisis laporan keuangan rasio profitabilitas bagian administrasi keuangan divisi jit (jasa integrasi teknologi) pt inti (persero) bandung 651 peranan return on asset (roa) return on equity (roe) mengukur perkembangan laba bersih perusahaan 652 studi empiris dua faktor mempengaruhi return saham industri food beverages bursa efek jakarta 653 penerapan model multiple discriminant analysis menilai kinerja bpr kabupaten banyuwangi 654 analisis hubungan kebutuhan jasa akuntansi skala perusahaan kota bengkulu 655 hubungan cvp (cost volume profit) anggaran perencanaan usaha 656 studi komparasi kinerja keuangan perusahaan bank asuransi terdaftar bursa efek jakarta tahun 2003 657 saling-peran (interplay) antara akuntansi budaya perusahaanpenelitian empiris metode interpretif etnografis 658 akuntansi keuangandari stewardship menuju predictive informational approach 659 konfirmasi piutang sebagai indikasi meyakinkan saldo piutang langganan pt putri ayu kuta audit 66 penerapan kebijakan penjualan kredit usaha meningkatkan rentabilitas dealer yamaha harpindo jaya purwodadi 660 pengaruh devidend yield harga saham pt gudang garam tbk 661 pembangunan perangkat lunak pelaporan keuangan balai pertemuan bumi sangkuriang 662 pembuatan laporan keuangan dinas pertanian tanaman pangan 663 tinjauan atas permasalahan kinerja keuangan terkait pencabutan izin usaha bankkasus pt bank asiatic 664 penerapan economic value added mengukur kinerja koperasi pegawai pt indosat tbk 665 penerapan metode fcff menentukan nilai intrinsik saham pt astra agro lestari tbk 666 menggali potensi pajak sektor informal melalui undang-undang laporan keuangan/wajib audit upaya pemberdayaan peran akuntan publik 667 manajemen perubahan sistem pelaporan keuangan departemen kehakiman hak asasi manusia republik indonesia 668 dampak informasi hasil pengembalian atas investasi (roi) laba bersih per saham (eps) perusahaan volume perdagangan saham suatu studi sekitar pengumuman laporan keuangan perusahaan go public bursa efek jakarta 669 pengaruh perlakuan akuntansi atas biaya riset pengembangan (randd) penyajian laporan keuangan pt hm sampoerna tbk surabaya 67 analisa pengaruh biaya keagenan resiko perusahaan kesempatan investasi kebijakan dividen perusahaan manufaktur terdaftar bursa efek jakarta 670 perancangan pembuatan sistem informasi pemberian kredit usaha mikro kecil pt bank pembangunan kalimantan tengah 671 sistem parkir prabayar menggunakan rfid pusat perbelanjaan 672 perlakuan akuntansi transaksi pajak pertambahan nilai pt x surabaya 673 perlakuan revaluasi aktiva tetap ditinjau dari aspek perpajakan 674 perancangan pembuatan program sistem informasi akuntansi transaksi pembelian penjualan pt florarom nusantara 675 pengelolaan laporan keuangan unit pelaksana pusat pertokoan pembelanjaan (up-4) pasar turi menuju akuntabilitas rangka otonomi daerah kota surabaya 676 evaluasi pilihan kebijakan akuntansi bagi heritage assets akuntansi pemerintahan ri 677 hubungan varian return saham likuiditas perdagangan 678 analisis sistem pengakuan pendapatan pasien rawat inap rsup nasional dr cipto mangunkusumo menurut standar akuntansi rumah sakit pemerintah 679 analisis atas pajak tangguhankasus pt wika realty 68 pengaruh pengumuman laba perubahan harga saham perusahaan manufaktur bursa efek indonesia tahun 2004-2006 680 faktor-faktor variabel makroekonomi mempengaruhi kekuatan bank syariah 681 pengaruh profesionalisme auditor tingkat aterialitas proses pemeriksaan laporan keuangan (studi empiris kap wilayah surakarta yogykarta) 682 analisis kinerja keuangan industri perbankan indonesia (studi empiris industri perbankan terdaftar bursa efek indonesia) 683 analisis rasio keuangan menilai kinerja keuangan perbankan (studi empiris bank go public bursa efek indonesia tahun 2004-2006) 684 analisis kinerja keuangan perusahaan rokok terdaftar bursa efek indonesia tahun 2007 685 analisis kinerja keuangan industri kerajinan tembaga kuningan cv trisna gallery tumang cepogo boyolali 686 analisis rasio keuangan menilai kinerja keuangan perbankan (studi empiris bank go public bursa efek indonesia tahun 2003-2005) 687 analisis perbedaan pengaturan laba (earnings management) perusahaan laba rugi perusahaan manufaktur go publik indonesia (ditinjau dari laporan keuangan tahunan periode tahun 2004-2006) 688 analisis laporan keuangan mengukur kinerja keuangan kud serba usaha dimojosongo boyolali 689 penggunaan informasi rasio keuangan memprediksi perubahan laba (studi empiris perusahaan manufaktur go publik bursa efek indonesia) 69 penggunaan informasi laba arus kas memprediksi laba masa akan datang 690 analisis laporan keuangan sebagai alat mengevaluasikinerja perusahaan (kpri guru sukodono sragen) 691 analisis komparasi metode camel memprediksi kesehatan z-score memprediksi kebangkrutan perbankan go public 692 analisis laporan keuangan sebagai pertimbangan guna menilai kelayakan pengajuan kredit bank cv nugraha samodra sakti sragen 693 pengaruh komitmen profesional komitmen organisasional kepuasan kerja auditor (studi empiris kantor akuntan publik se eks-karesidenan surakarta daerah istimewa yogyakarta) 694 faktor-faktor penting pertimbangan pemberian kredit bank bagi perusahaan kontraktor 695 pengaruh leverage rasio aktivitas rentabilitas ekonomi rentabilitas modal sendiri perusahaan food and beverages periode tahun 2004-2006 nathalia dian prasetyani 696 pengaruh tingkat disclosure ukuran perusahaan tingkat risiko cost of equity capital (studi perusahaan food and beverage listing bej periode 2005-2006 fajar heru pratomo 697 analisis perbedaan kinerja keuangan bank pemerintah bank swasta menggunakan metode camel (bank pemerintah bank swasta terdaftar bej periode 2004-2006) achmad murdiono 698 peran akuntan menegakkan prinsip good coorporate governance (tinjauan perspektif agency theory) 699 penilaian kinerja pt bank niaga tbk menggunakan konsep economic value added 7 pengaruh laporan keuangan publikasian kinerja saham perusahaan listing bursa efek jakarta 7 pengaruh mekanisme corporate governance kinerja perusahaan manufaktur bursa efek indonesia 70 analisis kinerja keuangan baitul maal wat tamwil (bmt) kabupaten klaten tahun 2005 700 analisis ramalan kebangkrutan bank menggunakan z-score model upaya pemecahan masalah dihadapi bank-bank tergolong mengalami gejala kebangkrutan 701 pengaruh pengumuman dividen tunai abnormal return hubungannya eps mbr return market 702 tingkat kepatuhan pemerintah kabupaten/kota indonesia pp nomor 24 tahun 2005 hubungannya pendapatan asli daerah total aktiva 703 hubungan penerapan corporate governance kinerja perusahaan publik indonesia price to book value price to sales ratio 704 hubungan antara volume perdagangan intrahari volatilitas imbal hasil intrahari saat ada berita saat tidak ada berita 705 analisis pengaruh informasi arus kas laba akuntansi harga saham syariah 706 analisis penggunaan rasio konsep pertumbuhan sebagai alat bantu menentukan fokus pemeriksaan pajakkasus pt xyz 707 analisa data panel hubungan rasio keuangan return saham perusahaan manufactur terdaftar lq-45 708 implementasi perencanaan pajak meningkatkan manajemen pendidikan uhamka 709 penerapan model altman z-score bumn indonesia 71 evaluasi perkembangan kinerja keuangan berdasarkan analisis rasio camel (pd bpr bkd kabupaten karanganyar) 710 analisis variabel penentu mitra utama kantor pelayanan utama tipe direktorat jendral bea cukai tanjung priok jakarta 711 hubungan eva nilai perusahaan pemakmuran pemegang saham uji empiris perusahaan-perusahaan terdaftar bursa efek jakarta periode 1997-2001 712 analisis tarif pelatihan pemanfaatan prasarana pelatihan bapelkes cilandak tahun 2002 713 kandungan informasi laba arus kas koperasi akrual laba akan datang hubungannya imbal hasil saham 714 analisa keuangan program celah bibir sehati rsab harapan kita tahun anggaran 1994 - 2000 715 analisa penyusunan neraca pemkab indonesia berdasarkan pp nomor 24 tahun 2005 716 analisis kinerja keuangan kpri guru kecamatan mondokan kabupaten sragen 717 analisis rasio keuangan sebagai penilai kinerja pabrik semen (pt semen gresik tbk pt indocement tunggal prakasa tbk) 718 analisis perbandingan kinerja keuangan antara bank syariah bank konvensional study kasus bank muamalat indonesia bank artha graha internasional tahun 2005-2007) 719 pengaruh informasi akuntansi harga saham (studi empiris perusahaan manufaktur terdaftar bej) 72 evaluasi penghitungan pajak penghasilan pasal 21 rumah sakit permata bunda purwodadi 720 pengaruh rasio keuangan harga saham perusahaan manufaktur bursa efek indonesia (bei) periode 2005-2007 721 analisis indikasi earnings management laporan keuangan perusahaan publik terdaftar bursa efek jakarta (bej) periode 2003-2005 722 analisis laporan keuangan sebagai alat mengukur efisiensi operasi perusahaan cv putra nugraha solo 723 analisis efisiensi penggunaan modal kerja perusahaan rasio keuangan pt gudang garam tbk tahun 2000-2004 724 analisis rasio camel z -score memprediksi kebangkrutan bank periode 2004-2006 (studi empiris perusahaan perbankan terdaftar bei) 725 analisis fundamental perusahaan bergerak bidang automotive and allied products sebagai dasar penentuaninvestasi (6 perusahaan automotive and allied products) bursa efek indonesia 726 penggunaan informasi laba arus kas operasi memprediksi laba masa depan (studi empiris perusahaan manufaktur terdaftar bursa efek indonesia) 727 manfaat beban pajak tangguhan mendeteksi earnings management menghindari penurunan laba perusahaan manufaktur bursa efek jakarta 728 analisis pengaruh perubahan modal kerja perubahan profitabilitas perusahaan manufaktur go public bursa efek indonesia 729 pengaruh kinerja keuangan perubahan harga saham perusahaan manufaktur bursa efek indonesia 73 pengaruh tingkat pendidikan pengalaman persepsi manajer koperasi tentang informasi akuntansi penerapan psak no27 kabupaten grobogan 730 analisis kinerja keuangan perusahaan semen terdaftar bei (pt semen gresik tbk) 731 analisis rasio profitabilitas leverage prediksi laba masa depan perusahaan go public terdaftar bursa efek indonesia 732 analisis kinerja perusahaan tobacco manufacturs terdaftar bursa efek indonesia tahun 2002-2006 733 pengaruh dividend payout ratio (dpr) earning per share (eps) harga saham perusahaan manufaktur terdaftar bursa efek indonesia 734 evaluasi kinerja (performance) keuangan diukur dari rasio likuiditas rentabilitas permodalan pd bpr bank pasar kabupaten klaten 735 pengaruh pengumuman laba perubahan harga saham perusahaan manufaktur bursa efek indonesia tahun 2003-2006 736 analisis kemampuan laba arus kas memprediksi arus kas masa depan tudi empiris perusahaan manufaktur terdaftar bursa efek indonesia) 737 pengaruh pendapatan perubahan hutang serta investasi laba perusahaan bursa efek indonesia 738 analisis rasio keuangan menilai kinerja keuangan perbankan syariah (2003-2007) 739 kemampuan informasi laba arus kas memprediksi earnings masa akan datang (studi empiris perusahaan manufaktur terdaftar bei) 74 analisis pengaruh informasi laba akuntansi arus kas operasi return saham (studi empiris perusahaan go public bursa efek indonesia) 74 faktor-faktor mempengaruhi kualitas laporan keuangan persepsi bankir faktor-faktor mempengaruhi kualitas laporan keuangan 740 pengaruh perubahan modal kerja perubahan profitabilitas perusahaan manufaktur go public (studi empiris perusahaan manufaktur bei tahun 2003 2004 2005) 741 analisis laporan keuangan sebagai alat pengawasan aktifitas finansial (koperasi pegawai republik indonesia sido mulyo kecamatan sambi boyolali) 742 earnings management melakukan penawaran saham perdana (ipo) perusahaan go public bursa efek jakarta (bej) periode 2001-2005 743 analisis pengaruh strategi pemasaran volume penjualan laba penjualan cv bumi putra surakarta 744 perlakuan akuntansi bagi hasil bank syariah ditinjau dari sistem pendanaan sistem pembiayaan laporan keuangan bank syariah mandiri cabang surakarta 745 pengukuran kinerja menggunakan balanced scorecard pdam boyolali 746 pengaruh kinerja keuangan perubahan harga saham perusahaan manufaktur terdaftar bursa efek indonesia periode 2003-2005 747 analisis perkembangan kinerja keuangan (perusahaan industri rokok bursa efek indonesia tahun 2004-2006) 748 analisis pengaruh rasio keuangan perubahan laba (studi empiris perusahaan perbankan terdaftar bursa efek indonesia) 749 studi komparasi pembelajaran akuntansi antara metode drill metode konvensional sma negeri i karangdowo klaten tahun pelajaran 2008/2009 75 pengaruh variabel fundamental variabel uncontrollable pendapatan saham pt semen gresik tbk perbedaan laporan keuangan komersial laporan keuangan fiskal 750 evaluasi kinerja perusahaan menggunakan analisis rasio laporan keuangan (cv widya duta) 751 analisis efisiensi penggunaan modal kerja perusahaan electronics equipment terdaftar bei 752 analisis kinerja keuangan pt gudang garam tbk terdaftar bursa efek indonesia tahun 2002-2007 753 kemampuan informasi keuangan memprediksi laba arus kas masa akan datang 754 tinjauan atas pelaksanaan siklus akuntansi 755 tinjauan atas kebijakan akuntansi 756 analisa dampak pemberlakuan keputusan menteri keuangan republik indonesia nomor 231/kmk06/2002 rasio keuangan dana pensiun 757 penerapan psak no 46 tentang akuntansi pajak penghasilan pt x surabaya 758 perancangan pembuatan sistem informasi akuntansi terkomputerisasi atas siklus penjualan pembelian toko mebel selalu jaya 759 peningkatan laba retrukturisasi modal melalui hutang jangka panjang perusahaan perorangan pandowo jaya 76 perancangan sistem informasi akuntansi 760 pembuatan sistem informasi akuntansi denny textil 761 pengukuran analisa kinerja menggunakan metode balance scorecard ptx 762 penerapan alat ukur non finansial digunakan sebagai alat bantu pengukuran analisa kinerja pt x 763 aspek perlakuan perhitungan pembayaran pajak pertambahan nilai industri tembakau rokok 764 penerapan akuntansi pajak penghasilan (psak 46) pt x 765 persepsi para akuntan publik faktor-faktor mempengaruhi penentuan materialitas kantor akuntan publik surabaya 766 perancangan sistem pakar proses pengambilan keputusan investasi bursa efek surabaya 767 perancangan pembuatan sistem informasi manajemen operasional akuntansi pt megafood sukses sejahtera 768 pengaruh tingkat risiko kredit mudharabah tingkat profitabilitas bank syariah(pt bank muamalat indonesia) 769 analisis perbandingan mengenai tingkat pendapatan perusahaan sebelum sesudah adanya dana bantuan pemerintah 77 laporan praktek kerja lapangan 77 peranan fungsi internal audit suatu pemeriksaan laporan keuangan oleh akuntan publik (suatu kasus pemeriksaan laporan keuangan arii oleh kantor akuntan publik (c and l) 770 pengaruh perbedaan penilaian aktiva tetap menurut standar akuntansi keuangan perpajakan penetapan besarnya penghasilan kena pajak 771 pengaruh laba per lembar saham (earning per share) harga pasar saham 772 pencatatan atas laporan arus kas bagian keuangan 773 prosedur pelaksanaan rekonsiliasi kas bank 774 klasifikasi laporan laba rugi kandungan informasinya peramalan laba perusahaan manufaktur telah go publik indonesia 775 analisis pengaruh struktur kepemilikan rasio-rasio keuangan bank size return on equity (study kasuspada perusahaan perbankan listed bei) 776 analisis perhitungan tingkat suku bunga kredit menggunakan metode weighted average cost of fund concept perolehan laba perusahaan daerah bank pasar klaten 777 analisis pengaruh dividend payout ratio lag asset sales debt to equity ratio lag return on asset (perbandingan perusahaan non keuangan pma pmdn listed bej) 778 analisis kinerja keuangan koperasi unit usaha simpan pinjam (koperasi jasa sejahtera semarang) 779 analisa pemilihan strategi pelaporan transaksi keuangan 78 analisa laporan keuangan pt modern photo tbk sebelum dam sesudah krisis moneter kurun waktu 1994-1998 78 sistem informasi pengolahan data keuangan berbasis client server pusat inkubasi bisnis usaha kecil (pinbuk) kota kab tasikmalaya 780 analisis transaksi leveraged buyout rencana merger antara pt bumi resources tbk pt energi mega persada tbk 781 faktor-faktor mempengaruhi kaitan antara pengumuman laba perkembangan harga saham perusahaan go public bursa efek jakarta 782 analisis pengaruh perhitungan tingkat kesehatan bank versi bank indonesia (se bi no 30/23/upbb tanggal 19 maret 1998) bank bermasalah indonesia 783 penilaian kelayakan merjer antar bank terkait wacana single presence policykasus pt bank danamon tbk pt bank internasional indonesia tbk 784 penerapan analisis camel menilai tingkat kesehatan pt bank himpunan saudara 1906 785 pengaruh perputaran modal kerja tingkat likuiditas perusahaan pt ultrajaya milk industry trading company tbk 786 analisis trend tingkat rentabilitas perusahaan pt bank tabungan pensiunan nasional kantor pusat sebagai ukuran kemampulabaan periode 2000 - 2004 melalui roa roe nim bopo 787 pengaruh tingkat perputaran persediaan barang jadi tingkat rentabilitas pt pindad (persero) bandung 788 pengaruh tingkat perputaran modal kerja tingkat rentabilitas pt pindad (persero) bandung 789 hubungan saldo kas bersih dari aktivitas operasi kemampuan pemenuhan kewajiban jangka pendek pt inti (persero) bandung dari tahun 1995 sampai tahun 2004 79 pemeriksaan laporan keuangan pt gt petrochem industries tbk sustu tinjauan atas penilaian rekening aktiva tetap (divisi nylon) 79 perancangan pembuatan sistem informasi administrasi keuangan ud adil jaya yogyakarta 790 pengaruh hasil pemeriksaan khusus tingkat penerimaan pajak penghasilan badan kantor pelayanan pajak bandung karees 791 pengaruh debt to equty ratio (der) rentabilitas modal sendiri pt inti bandung 792 hubungan tingkat perputaran piutang rate of return on investment pt inti (persero) bandung 793 analisis modal kerja mengukur tingkat likuiditas koperasi bkpt ciawi tasikmalaya 794 pengaruh perputaran modal kerja tingkat rentabilitas kud sarwa mukti 795 pengaruh arus kas dari aktivitas operasi tingkat likuiditas keuangan perusahaan pt pln (persero) distribusi jawa barat banten 796 pengaruh tingkat risiko pembiayaan tingkat profitabilitas bmt bmt babussalam bantarujeg majalengka 797 pengaruh perputaran modal kerja return on investments (roi) pt telekomunikasi indonesia tbk 798 pengaruh volume pemberian kredit tingkat pendapatan bank (suatu kasus bank jabar bandung) 799 hubungan pendapatan wajib pajak jumlah pajak penghasilan pasal 21 terutang setelah perubahan penghasilan tidak kena pajak (ptkp) (wajib pajak kpp bandung tegallega) 8 manfaat rasio keuangan memprediksi pertumbuhan laba (study kasus perusahaan real estate property terdaftar bej) 8 pengaruh financial distress good corporate governance rekayasa laporan keuangan 80 analisa laporan keuangan pt plaza indonesia realty tbk tahun 1994-1999 80 pengaruh price earnings ratio (per) tingkat return saham pt bank nisp tbk periode tahun 1999-2003 800 pengaruh jumlah pemberian kredit efektivitas perolehan laba (suatu kasus bank jabar) 801 pengaruh karakteristik keuangan saham sektor perdagangan saham sektor properti kinerja saham 802 pengaruh biaya tenaga kerja langsung produktivitas tenaga kerja langsung pt pg rajawali ii unit pabrik gula subang 803 pengaruh tingkat perputaran piutang jumlah modal kerja perusahaan ptpindad (persero) 804 pengaruh perubahan loan to deposit ratio (ldr) perubahan jumlah pemberian kredit pt bank rakyat indonesia tbk 805 pengaruh kesehatan bank harga saham pt bank danamon indonesia tbk 2003-2005 806 analisis perbandingan kinerja keuangan pt kereta api (persero) (sebelum sesudah perubahan bentuk perusahaan dari perusahaan umum menjadi perusahaan perseroan dinilai perspektif keuangan) 807 analisis finansial kinerja pelayanan perusahaan daerah air minum tirta buana kabupaten merangin 808 perbaikan sistem penanganan order pendekatan analisis desain terstruktur (dl pt taco putra) 809 strategi peningkatan pelayanan pdam penyediaan air bersih bagi masyarakat kota kupang 81 analisa laporan keuangan pt cipendawa farm enterprise mengetahui likuiditas rentabilitas perusahaan tahun 1994-1999 81 analisis hubungan modal kerja tingkat profitabilitas pt pln (persero) majalengka 810 pengaruh risiko kredit profitabilitas bank negara indonesia 46 (bni) cabang itb bandung periode 2000-2004 811 perancangan sistem informasi akuntansi penjualan tunai pd deros 812 perancangan sistem informasi akuntansi penjualan secara kredit pd sinar mas sakti bandung 813 sistem pencatatan anggaran belanja rutin menunjang laporan keuangan dinas pertanian tanaman pangan propinsi jawa barat 814 tinjauan laporan keuangan 815 perancangan sistem informasi akuntansi pendapatan pt asuransi intra asia cabang bandung menggunakan microsoft visual basic 60 816 analisis laporan keuangan atas rasio likuiditas bank rakyat indonesia (bri) tbk 817 perancangan sistem informasi akuntansi kas padapt makdis tour bandung menggunakan software microsoft visual basic 60 sql server 70 berbasis client server 818 perancangan sistem informasi akuntansi penjualan perum bulog subdivisi bandung menggunakan software microsoft visual basic 60 sql server 70 berbasis client server 819 dampak implementasi standardized approach risiko kredit rasio kecukupan modal portfolio kreditkasus bank x 82 financial audit atas aktiva tetap pt x 82 pengaruh financial leverage melalui pendekatan debt to equity ratio (der) rentabilitas modal sendiri pt hutama karya bandung 820 pengaruh ukuran kantor akuntan publik earnings response coefficients 821 faktor-faktor mempengaruhi investasi perusahaan kasus sektor pertanian pertambangan barang konsumsi indonesia tahun 2004-2007 822 analisa pengaruh laporan tahunan kinerja emiten beta saham jakarta islamic index antara 2000-2005 823 analisis pengaruh dari return on assets return on equity earning per share profit margin assets turn over rasio leverage debt to equity ratio return sahamstudy saham-saham termasuk lq-45 bursa efelk jakarta tahun 2001 824 faktor-faktor mempengaruhi minat nasabah mendapatkan pembiyaan bank bni syariahkasus cabang xyz 825 analisis perancangan sistem informasi akuntansi x consulting 826 analisis pengaruh informasi akuntansi harga pasar saham perusahaan publik bursa efek jakarta 827 analisis rasio keuangan berpengaruh pengadopsian program stock option (perusahaan publik melaksanakan esop 1 tahun 200-2007 828 hak merek sebagai jaminan kredit 829 pengaruh karakteristik kerusahaan struktur sapital perusahaan termasuk indeks bisnis 27 periode 2003-2007 83 akuntansi keuangan menengah i 83 hubungan analisis rasio likuiditas 830 penggunaan laporan keuangan sebagai alat analisis produktivitas pt asuransi raksa pratikara tahun 1996-2000 831 pengaruh mekanisme corporate governance peringkat surat utang perusahaan indonesia 832 kejahatan akuntansi kesiapan kita 833 faktor mempengaruhi profibilitas uus ptbank x menggunakan rasio keuangan 834 analisis perbedaan kinerja perusahaan sebelum setelah penerbitan obligasi syariah ijarah indonesia periode penelitian 2003 - 2007 835 pengaruh rasio capital adequacy ratio loan deposit ratio non performing loan net interest margin biaya operasional pendapatan operasional profitabilitas bank umum indonesia periode 2002-2003 836 analisis kemandirian keuangan rs aneka tambang-kijang tahun 2002 rangka persiapan swakelola pasca tambang bauksit 837 kajian kinerja bagian keuangan rumah sakit umum kabupaten tangerang pra eraswadana 838 analisis assets liabilities bank x mengukur kesehatan meningkatkan profitabilitas 839 pengumuman dividen serta dampaknya stock return future earning perusahaan lq 45 bursa efek jakarta 84 audit finansial atas perkiraan penjualan piutang usaha pt sarana teknik industri 84 pengaruh biaya dana (cost of fund) return on asset (roa) pt bank tabungan negara (persero) cabang bandung 840 penerapan the balanced scorecard sebagai tolok ukur kinerja pt x meningkatkan daya saing era turbulen 841 analisis pengaruh pengumuman deviden pengumuman earning harga saham perusahaan go public bursa efek jakarta 842 perbandingan antara kinerja keuangan berdasarkan laporan basis akrual laporan arus kas serta hubungannya imbal hasil sahamkomparatif sebelum masa krisis ekonomi 843 alternatif pendanaan imbalan pasca kerja berdasarkan undang-undang nomor 13 tahun 2003 tentang ketenagakerjaan 844 analisis kinerja keuangan penilaian harga saham menggunakan metode free cash flowpt telekomunikasi indonesia tbk 845 audit sistem informasi evaluasi pengendalian internkasus sistem penjualan kredit pt astra graphia 846 respon pasar pengumuman laba tercermin abnormal return terjadi bursa efek jakartaempiris dari januari 2004 hingga juni 2006 847 manfaat rasio keuangan memperediksi rating obligasi 848 aktivitas pengendalian mutu jasa audit laporan keuangan historis kasus beberapa kantor akuntan publik surabaya 849 reaksi pasar modal pelaporan selisih kursempiris bursa efek jakarta 85 pengaruh loan to deposit ratio (ldr) 85 pengaruh return saham earnings volume perdagangan saham bid ask spread sebelum sesudah pengumuman laporan keuangan perusahaan manufaktur listing bej 850 kelayakan investasi penambahan mesin baru perusahaan percetakan cv sahabat klaten 851 analisis penggunaan z-score altman menilai potensi kebangkrutan perusahaan sektor tobacco manufacturers bursa efek indonesia periode 2003-2007 852 analisis perbedaan kinerja keuangan perusahaan sebelum sesudah merger akuisisi (study empiris perusahaan manufaktur bei) 853 pengaruh angka laba return saham (studi empiris perusahaan manufaktur go public bej) 854 analisis faktor-faktor mempengaruhi praktik perataan laba (income smooting) perusahaan manufaktur keuangan terdaftar bei 855 kemampuan laporan arus kas memprediksi laba perusahaan manufaktur terdaftar bursa efek jakarata (studi empiris periode tahun 2003 2004) 856 analisis pengaruh strategi pemasaran volume penjualan perusahaan plastik teguh jaya surakarta 857 analisis kinerja keuangan perusahaan makanan minuman terdaftar bursa efek indonesia periode 2005-2007 858 pengaruh economic value added market value added rasio profitabilitas perusahaan harga saham perusahaan manufaktur terdaftar bei (2003-2005) 859 analisis rasio keuangan memprediksi kesehatan perbankan (perbankan go publik terdaftar bei) 86 penerapan konsep materialitas pemeriksaan atas laporan keuangan pemerintah daerah tahun anggaran 2006 oleh perwakilan bpk ri pekanbaru 86 sistem informasi laporan keuangan penjualan pembelian cv kurnia elektronik 860 pengaruh kandungan informasi arus kas komponen arus kas laba akuntansi return saham (studi empiris perusahaan manufaktur bursa efek indonesia) 861 analisis rasio keuangan mengukur kinerja keuangan perusahaan semen terdaftar bursa efek indonesia (pt indocement tunggal prakasa tbk terdaftar bei) 862 pengaruh economic value added profitabilitas perusahaan return pemegang saham perusahaan otomotif indonesia (perusahaan otomotif terdaftar bei) 863 analisis kinerja keuangan pt gudang garam tbk periode tahun 2002 - 2006 864 analisis perubahan rasio keuangan memprediksi laba mempertimbangkan size effect (perusahaan manufaktur go publik bej) 865 analisis pengaruh rasio keuangan kinerja keuangan (bank perkreditan rakyat bkk boyolali kota tahun 1999-2006) 866 penggunaan informasi laba arus kas operasi memprediksi laba masa depan (studi empiris perusahaan manufaktur terdaftar bursa efek jakarta) 867 analisis perkembangan kinerja keuangan perusahaan industri semen terdaftar bursa efek indonesia periode 2005-2007 868 pengaruh kinerja keuangan pertumbuhan laba perusahaan go public terdaftar jii periode 2003-2006 869 analisis laporan keuangan menggunakan rasio likuiditas rentabilitas sebagai alat pengambilan keputusan (kpri smp n 7 skh) 87 analisis perhitungan laporan keuangan berdasarkan psak nomor 46 undang-undang pajak penghasilan nomor 17 tahun 2000 pt riau cipta nugraha pekanbaru 87 pengaruh net working capital (modal kerja 870 analisis faktor-faktor mempengaruhi praktik perataan laba (income smoothing) perusahaan manufaktur keuangan terdaftar bei 871 analisis kinerja keuangan pt mustika ratu tbk bursa efek indonesia 872 pengaruh promotion mix volume penjualan dealer timbul maridy jaya sukoharjo 873 analisis penilaian tingkat kesehatan bank berdasarkan metode camel pd bpr bkk tasikmadu cabang karangpandan 874 analisis perbandingan kinerja keuangan bank konvensional bank syariah indonesia 875 analisis rasio keuangan memprediksi kondisi financial distress perusahaan manufaktur terdaftar bursa efek indonesia 876 analisis laporan keuangan menggunakan rasio likuiditas solvabilitas rentabilitas aktivitas sebagai alat bantu pengambilan keputusan manajer (koperasi mahasiswa universitas muhammadiyah surakarta) 877 analisis rasio sebagai dasar penilaian kinerja keuangan perusahaaan daerah air minum kabupaten kudus 878 pengaruh perubahan rasio profitabilitas leverage perubahan laba perusahaan manufaktur terdaftar bursa efek jakarta periode 2001 - 2005 879 analisis laporan keuangan sebagai dasar penilaian tingkat kinerja keuangan koperasi simpan pinjam keluarga sumber bahagia 210 kecamatan banjarsari surakarta 88 pengaruh ukuran dewan komisaris tingkat leverage tingkat profitabilitas pengungkapan imformasi lingkungan hidup (studi empiris laporan keuangan perusahaan rawan lingkungan listing bej periode 2004-2006 88 perancangan sistem informasi akuntansi penjualan tunai menggunakan microsoft access 2003 cv karya mitra usaha 880 manfaat informasi rasio keuangan memprediksi perubahan laba (studi empiris perusahaan manufaktur go publik bursa efek indonesia) 881 analisis laporan keuangan penilaian kesehatan pd bpr bank daerah kabupaten karanganyar tahun 2005-2007 882 analisis perbedaan kinerja keuangan perusahaan sebelum sesudah go-public serta pengaruhnya tingkat hasil saham pasar modal indonesia thailand jepang 883 pengaruh variable cost break even point pt pindad (persero) divisi tempa cor 884 tinjauan atas sumber 885 pergeseran paradigma akuntansi dari positivisme ke perspektif sosiologis implikasinya pendidikan akuntansi indonesia 886 analisis pengaruh profitabilitas industri rasio leverage keuangan tertimbang intensitas modal tertimbang serta pangsa pasar roa roeperusahaan manufactur go-public indonesia 887 pengaruh efisiensi biaya produksi laba cv intech manufaktur bandung 888 analisis sumber penggunaan modal kerja sebagai alat kontrol mengukur tingkat likuiditas perusahaan pt pindad (persero) bandung 889 pengaruh modal kerja bersih tingkat rentabilitas modal sendiri koperasi simpan pinjam (ksp) sumber bahagia kota bandung 89 analisis pengaruh rasio likuiditas leverage aktivitas profitabilitas return saham perusahaan industri barang konsumsi go puplik bursa efek indonesia (bei) 89 perancangan sistem informasi akuntansi penerimaan kas dari penjualan tunai menggunakan microsoft access 2003 pd yomart 890 pengaruh tingkat perputaran piutang penetapan jumlah modal kerja divisi tempa cor pt pindad (persero) bandung (pt pindad periode tahun 1993 2002) 891 pengaruh tingkat perputaran modal kerja return on investment (roi) kopti kota bandung 892 pengaruh beban klaim beban komisi pendapatan premi asuransi jiwa bersama bumiputera 1912 kantor operasional serang 893 analisis penilaian kinerja bumn perspektif keuangan pt inti (persero) (sebelum sesudah penerapan konsep balanced scorecard sebagai model pengukuran kinerja perusahaan) 894 pengaruh jumlah modal kerja tingkat profitabilitas perusahaan pt pindad (persero) bandung 895 analisis sumber penggunaan modal kerja mengukur tingkat likuiditas perusahaan koperasi mahasiswa bumi siliwangi upi 896 perbandingan rentabilitas bank danamon antara sebelum sesudah merger sebagai indikator kelangsungan usaha (going concern 897 pengaruh modal kerja tingkat likuiditas koperasi unit desa (kud) sinar jaya bandung 898 pengaruh profitabilitas perubahan harga saham pt telekomunikasi indonesia tbk bursa efek jakarta 899 peranan rasio aktivitas penilaian 9 akuntabilitas laporan keuangan perwakilan bpk ri pekanbaru 9 analisis efisiensi pengelolaan kas piutang koperasi pengusaha angkutan kota (kopata) purwokerto 90 dampak pengumuman laporan keuangan kegiatan perdagangan saham variabilitas tingkat keuntungan 90 perancangan sistem informasi akuntansi penggajian yayasan pendidikan esti bakti menggunakan microsoft visual basic 60 900 perancangan sistem informasi 901 pengolahan data balai pengelolaan laboratorium kemetrologian sub bagian tata usaha 902 tinjauan atas penyusunan anggaran kas pengendalian intern penerimaan pengeluaran kas perusahaan daerah air minum (pdam) kota bandung 903 tinjauan sistem informasi akuntansi penerimaan kas unit parawisata perum jasa ii jatiluhur purwakarta 904 tinjauan atas rasio rentabilitas laporan keuangan koperasi peternak sapi bandung utara (kpsbu) lembang unutk tahun 20032004 2005 905 perancangan sistem informasi akuntansi persediaan barang dagang pt mitra gemilang madani menggunakan database sql server 70 software microsoft visual basic 60 906 pengaruh profil aparatur pemerintah persepsi penerapan program sistem akuntansi instansi proses pembuatan laporan keuangan tahun 2006 907 perancangan sistem informasi akuntansi persediaan barang dagang pt limas citra lestari menggunakan microsoft visual basic 60 908 peranan kredit pensiun upaya meningkatkan laba bersih pt bank tabungan pensiun nasional kantor cabang pembantu majalaya 909 tinjauan tentang informasi keuangan departemen sales and marketing 91 analisa laporan keuangan pt celma unggultama indonesia hubungannya pelaporan spt pph 91 perancangan sistem informasi akuntansi penggajian pt industri sandang nusantara menggunakan microsoft visual basic 60 910 peranan good corporate government (gcg) menunjang kualitas laporan keuangan pt bni (persero) kantor cabang kuningan 911 peranan kualitas laporan keuangan debitur pengambilan keputusan pemberian kredit 912 analisis sumber penggunaan modal kerja pt asuransi jasa indonesia (persero) kcu-bandung 913 analisis atas sistem pelaporan keuangan pertamina dampaknya penilaian kinerja perusahaan 914 penerapan standar akuntansi (psak no 46) atas pajak penghasilan pt x 915 pembuatan sistem informasi pengiriman barang administrasi up king stone surabaya 916 rekayasa ulang proses penjualan meningkatkan efisiensi biaya operasi pt standardmegah steelindotama industries pasuruan 917 perlakuan akuntansi ppn fasilitas pembebasan bea masuk ppn impor tidak dipungut rangka ekspor harga perolehan bahan baku atas transaksi pembelian bahan baku impor kaus 918 studi kelayakan salon mobil banjarmasin ditinjau dari aspek pasar teknis manajemen keuangan 919 pembuatan perangkat lunak sistem perhitungan gaji perusahaan x 92 analisa laporan keuangan sebagai alat ukur penilaian kinerja keuangan pt kimia farma tbk periode 2004-2006 92 perancangan sistem informasi akuntansi penerimaan kas dari jasa service pd sinar mas sakti bandung menggunakan microsoft access 2003 920 perancangan pembuatan perangkat lunaksistem informasi perdagangan ud hero keramik 921 evaluasi aspek perpajakan penghasilan atas pengalihan hak tanah dan/atau bangunan instrument tax planning pt belirang kalisari pasuruan 922 perancangan pembuatan sistem informasi pemberian kredit kepada usaha kecil menengah kantor dinas koperasi sulawesi selatan 923 analisis pengaruh pemilihan strategy bersaing probabilita kebangkrutan perbankan indonesia periode 1989-1998 924 tinjauan azas keadilan kebijakan pengenaan pajak penghasilan atas penghasilan transaksi penjualan saham bursa efek 925 pengaruh rekayasa akrual meminimalkan pajak industri sektor perbankan bursa efek jakarta periode 2001-2005 926 asosiasi laba tahunan perusahaan emiten harga saham bursa efek jakarta ditinjau dari ukuran perusaahan debt-equity ratio perusahaan 927 analisa indikasi manajemen laba melalui discretionary allowance for loan losses perbankan pasca rekapitalisasi 928 analisis rasio lancar rsu bhakti yudha depok tahun 2000 2001 2002 929 hubungan antara komponen kedua sisi neraca perusahaan non-keuangan indonesiaanalisa korelasi kanonikal 93 analisa laporan keuangan mengevaluasi kinerja keuangan pt pan brothers tbk periode 2004-2006 93 pengaruh kredit bermasalah laba pt bni (persero) tbk 930 analisis laporan keuangan sebagai alat prediksi keberhasilan kredit industri kayu 931 tingkat perolehan sekuritas pasar modal indonesia 932 pengaruh kredit jangka pendek simpanan deposito likuiditas bank pt bpr arta daya cabang palur karanganyar 933 analisis laporan keuangan sebagai alat ukur mengevaluasi kinerja keuangan koperasi pesat banyudono boyolali tahun 2005-2008 934 pengaruh tingkat absensi pengalaman kerja peningkatan produktivitas kerja karyawan pt mondrian klaten 935 kemampuan perubahan rasio keuangan memprediksi perubahan laba perusahaan manufaktur terdaftar bursa efek indonesia 936 analisis kinerja keuangan pt tambang timah tbk periode tahun 2001 2006 937 analisis rasio sebagai dasar penilaian kinerja keuangan perusahaan daerah air minum (pdam) kabupaten boyolali 938 perancangan sistem informasi toko emas 939 analisis pengaruh beberapa faktor eksternal perusahaan imbal hasil saham bursa efek jakarta 94 analisis atas laporan keuangan mengetahui kinerja keuangan pt fajar surya wisesa tbk periode 2002-2004 94 pengembangan sistem informasi administrasi 940 analisis perbandingan likuiditas profitabilitas perusahaan industri sebelum sesudah perubahan undang - undang perpajakan 1994 941 faktor-faktor berhubungan terjadinya piutang penderita rawat inap rumah sakit husada 942 analisis kinerja instalasi rawat inap rsup persahabatan menggunakan konsep balanced scorecard 943 pengaruh metode kas akrual laba/rugi dividen nilai perusahaan zakatkasus bmt mulia bersama 944 pengelolaan dana cadangan sekunder (secondary reserve) kasus divisi treasury pt bank xyz 945 kombinasi bisnis (business combination)suatu kajian komparatif dari aspek akuntansi pajak 946 perbandingan efisiensi perbankan konvensional perbankan syariah indonesia 947 analisa indikator modal intelektual pt x metode proses analisa bertingkat analytic hierarchy process 948 pengaruh aktivitas financial literacy komite audit jenis manajamen laba 949 analisis implementasi kebijakan sistem akuntansi barang milik negara departemen hukum ham ri 95 analisis atas laporan keuangan menilai kinerja pt central proteinaprima tahun 2002-2004 95 pengaruh piutang rentabilitas modal sendiri (return on equity) pt ultrajaya milk industry trading company tbk bandung 950 analisis sistem penatalaksanaan piutang pasien rawat jalan rawat inap jaminan pihak ketiga rumah sakit mekar sari bekasi tahun 2002 951 perencanaan pajak penghasilan melalui pemilihan lokasi usahakasus pt bmk tahun pajak 1995 1996 952 analisis hubungan strategi korporasi struktur modal perusahaan-perusahaan manufaktur bursa efek jakarta 953 kinerja pelayanan keimigrasian berbasis kartu saphire bandara soekarno- hatta pendekatan balanced scorecard 954 prediksi return saham rasio-rasio keuangan bej tahun 1999 s/d 2002 955 penelaahan atas pengukuran kinerja keuangan rangka penentuan tingkat kesehatan bumn asuransi sosial (pt jamsostek) 956 rasio-rasio keuangan keterkaitannya return saham 957 persepsi kelompok manajemen keuangan perubahan status rumah sakit dari instansi pengguna penerimaan negara bukan pajak menjadi perusahaan jawatan tahun 2001 958 penerapan teknologi berbasis artificial neural network proses pengolahan limbah tinta guna meningkatkan kinerja manufakturpabrik percetakan uang ptx 959 analisis pengaruh variable-variabel makroekonomi pembiayaan simpanan mudharabah laba bruto bank-bank syariah indonesia (januari 2001-desember 2003) kasus bank muamalat bank syariah mandiri bni unit syariah 96 analisis perancangan aplikasi laporan keuangan berbasis web pt intellisys 96 pengaruh risiko kredit 960 pengaruh rasio-rasio keuangan utama perusahaan harga saham-saham perusahaan terdaftar jakarta islamic index tahun 2004 961 analisis hubungan besarnya perusahaan pembayaran pajak pengasilan kpp jakrta pasar minggu 962 penerapan manfaat enterprise concept serta laporan nilai tambah mengukur kinerja bumn (pt yodya karya (persero)) 963 perbandingan pemeringkatan menggunakan sistem internal credit risk rating bank x pemeringkatan pefindo 964 analisa tarif lokal sljj era multi operator 965 profit sharing moral hazard penyaluran dana pihak ketiga bank umum syariah indonesia 966 pengaruh kebijakan suku bunga kesehatan perbankan nasionalprofil bank pra pasca krisis 967 pengaruh penerapan enterprise resource planning (erp) kinerja pt telekomunikasi indonesia tbk 968 pengembangan sistem informasi sekolah 969 aplikasi pha analisis memilih bentuk kerjasama terbaik bagi lembaga bahasa pendidikan profesional (lbpp) lia pembukaan gerai kursus bahasa inggris jakarta 97 analisis laporan keuangan sebagai alat mengevaluasi kinerja keuangan pt plaza indonesia realty tbk tahun 2001-2003 97 pengaruh rentabilitas ekonomi (return on investment) rentabilitas modal sendiri (return on equity) pt sucofindo (persero) cabang madya bandung 970 determinan debt to equity ratio perusahaan industri makanan minuman bursa efek jakarta 971 analisis penilaian perusahaan kelayakan harga saham kemungkinan merger antara pt bank niaga tbk pt bank lippo tbk wacana single presence policy serta penilain sinergi kinerja bank pasca merger 972 analisis akuntabilitas pengelolaan anggaran belanja lingkungan sekretariat jenderal departemen negeri 973 analisis hubungan antra komite audit komisaris independent praktek manajemen labaempiris perusahaan bej 974 analisis kebijakan penanganan tindak pidana bidang perpajakan oleh direktorat jenderal pajak 975 potential loss perbankan syariah akibat pengenaan ppn pembiayaan akad murabahahkasus pt bank syariah mandiri 976 optimalisasi return pengelolaan portofolio earning asset (bni syariah) 977 risk return capital charge porfolio investasi reksadanakasus pt asuransi astra buana 978 relevansi rasio keuangan harga saham 979 pengaruh jumlah modal pajak penghasilan pt ismbfm 98 analisis laporan keuangan sebagai alat menilai kinerja keuangan pt sari husada tbk tahun 2004-2006 98 pengaruh modal kerja bersih (net working capital) rasio lancar (current ratio) pt pos indonesia (persero) bandung 980 eksistensi peran komite audit perusahaan publik indonesia rangka implementasi good corporate governance 981 pengaruh faktor-faktor budaya perusahaan iklim organisasi kepuasan kerja karyawan pam jaya 982 pengaruh beberapa rasio kesehatan bank tingkat pengembalian atas asset (roa) bank umum swasta nasional periode tahun 2001-2004 983 analisis return on equity (roe) pendekatan sistem du pont pt brantas abipraya () 984 analisis hubungan value based management corporate social responsibility iklim bisnis indonesia kasus perusahaan swa100 2006 985 analisis pengaruh implementasi good corporate governance return volatilitas saham 986 pengukuran analisis efisiensi operasional bank pembangunan daerah indonesia menggunakan metode data envelopment analysis (dea) 987 analisis leverage kinerja keuangan perusahaan publik bursa efek jakarta selama periode 1989-1993 988 analisa indikator modal intelektual pt x metode proses analisa bertingkat (analytic hierarchy process) 989 analisa penatalaksanaan piutang pasien rawat inap jaminan pribadi rumah sakit tebet tahun 2000 99 analisis laporan keuangan sebagai dasar pengambilan keputusan investasi pt asahimas flat glass tbk 99 pengaruh dividen tunai (cash dividend) 990 faktor dominan mempengaruhi pertumbuhan aset lembaga keuangan mikro syariah (program peningkatan kemandirian ekonomi rakyat jp2ker yogyakarta thn 1997-2002) 991 analisa beberapa faktor fundamental makroekonomi mempengaruhi risiko sistematis (beta) 992 pengaruh market share berdasarkan dana pihak ketiga pemberian kredit profitabilitas perbankan indonesia berdasarakan return on assets net interest margin 993 analisa kebijakan dividen kebijakan struktur permodalan arus kas mendatang 994 prediksi kebangkrutan analisis diskriminan perusahaan industri barang konsumsi indonesia 995 analisis hubungan antara jenis pembiayaan jenis investasi perusahaan manufaktur go public bursa efek jakarta 996 studi tentang informasi analisa kredit 997 pengaruh modal jumlah anggota sisa hasil usaha kud lalung jaya karanganyar tahun 2004 - 2008 998 analisis tingkat kesehatan keuangan metode camel (pt bpr binalanggeng mulia sukoharjo tahun 2005-2007) 999 penilaian kinerja keuangan pd bpr bkk kecamatan wedi kabupaten klaten aspek ekonomi lingkungan pemanfaatan batubara aspek teknologi lingkungan hidup binaan kebijaksanaan lingkungan kesempatan kerja lingkungan penelitian pendidikan indoneiaa media massa pengembangan lingkungan hidup membina lingkungan hidup melalui perpustakaan pemantauan lingkungan sekitar reaktor serpong pemukiman lingkungan angka pelita v pengaruh pestisida lingkungan pertanian peran organisasi pengelolaan lingkungan hidup perlindungan pengelolaan lingkungan hidup aplikasi biosensor pemantauan lingkungan ilmu lingkungan sebagai pendukung pembangunan kependudukan lingkungan hidup indonesia lingkungan hidup pembangunan konteks metrologi pengukuran pencemaran lingkungan pandangan lingkungan sikap wanita pedagang pelestarian budaya pembangunan perkotaan pemberdayaan wanita mengelola lingkungan pengaruh genotipa lingkungan hewan ternak pengembangan kependudukan lingkungan hidup pengendalian/pengelolaan pencemaran lingkungan permukiman berwawasan lingkungan tinjauan sumber pembiayaan pengelolaan lingkungan hidup wajah lingkungandalam paradigma pembangunan bantuan hukum lingkungan departemen keuangan dampak pencemaran lingkungan kesehatan jabatan fungsional perencana lingkungan lipi menciptakan lingkungan pemukiman berskala besar pemanfaatan sumberdaya hayati pegunungan seribu peningkatan peran aktif pusat studi lingkungan petunjuk pemantauan debu terendap (file depkes) tata air kerentanan lingkungan lahan gambut jakarta lingkungan (file propinsi dki jakarta) konsep dasar aspek lingkungan daerah perkotaan masalah keamanan tradisional lingkungan asean mendorong kompetisi tekanan isu lingkungan model hidrograf satuan sintetik sungai lombok perkembangan hukum lingkungan beberapa negara simulasi erosi lahan berdasarkan analisa terrain standar lingkungan perumahan rumah sederhana etika lingkungan ditinjau dari ajaran agama islam interaksi antara pembangunan lingkungan hidup kepedulian lingkunganaspek strategis perusahaan lingkungan hidup permasalahan kebijaksanaan lingkungan sosial pembangunan berkelanjutan radioaktivitas udara ruangan lingkungan sistem terintegrasi neraca lingkungan ekonomi arsitektur lingkungan pasca arsitektur modern asean tantangan kerjasama bidang lingkungan beberapa kendala penegakan hukum lingkungan energi lingkungantantangan menjelang abad 21 karakteristik lingkungan geologi laut indonesia ketahanan adaptasi escherichia coli lingkungan konsep pola penambangan berwawasan lingkungan penataan lingkungan sosial bagi penderita dimensia pencemaran lingkungan upaya penanggulangannya pengaruh eksploitasi air tanah lingkungan sistem akuisisi data industri lingkungan transmigran lingkunganmenuju proses adaptasi ekosistem mangrove pembangunan lingkungan hidup kampung perencanaan pembangunan lingkungan kota menggagas sistem pertanian modern berbasis kearifan notulensi diskusi lingkungan hidup perempuan lsm pemanfaatan sumber daya lingkungan bandar banten pengaruh matematika stokastik model lingkungan pengelolaan lingkungan negara maju indonesia peran wanita pengelolaan lingkungan pemukiman statistik lingkungan hidup indonesia environmental statistik lingkungan hidup kabupaten jeneponto 2004 aspek kelembagaan pengelolaan lingkungan hidup dinamika analisis residu pestisida lingkungan kalibrasi parameter hidrograf satuan sistetik snyder lingkungan laut kondisi geografi ekonomi nelayan pembangunan berkelanjutan berwawasan lingkungan pengembangan peningkatan kapasitas lembaga bapedalda pola pembangunan nasional berwawasan lingkungan tatakrama lingkungan keluarga cerita rakyat anak lingkungan ditinjau pendekatan sistem asean lingkungan geo-strategis ekonomi baru konsep lingkungan sosial pengelolaan lingkungan konsep-konsep dasar kependudukan lingkungan hidup kualitas kependudukan lingkungan hidup dusun diro peranan iptek pembangunan berwawasan lingkungan perspektif pertanian lingkungan terkontrol studi sistem pengelolaan sampah dikota bandar lampung asas pengelolaan sumber daya alam lingkungan hidup foraminifera sebagai bioindikator pencemaraan perairan kebijakan menunjang bisnis berwawasan lingkungan pembangunan berkelanjutan; tinjauan teoretis empiris pengembangan industri manufaktur berwawasan lingkungan upaya penegakan hukum lingkungan wilayah jabopunjur analisis sumber daya alam lingkungan hidup nasional beban lingkungan pembangkitan listrik hingga tahun 2003 bio-toilet pengenalan wc kering berwawasan lingkungan gagasan pembentukan organisasi lingkungan hidup global pengkajian bahaya longsor tipe jahuan batuan (rockfall) peranan hasil pembangunan bidang lingkungan hidup perkembangan industri teknologi berwawasan lingkungan perkembangan ruko arsitektur lingkungan perkotaan promosi membaca lingkungan lembaga pendidikan formal tradisi makan minum lingkungan kraton yogyakarta beberapa aspek pengelolaan lingkungan hidup indonesia dampak emisi gas buang kesehatan lingkungan kearifan budaya masyarakat lokal melestarikan lingkungan manajemen bioregional jabodetabektantangan harapan manusia lingkungan ditinjau dari segi moral teologis penentuan indeks kualitas air lingkungan pemukiman petunjuk pelaksanaan pengawasan kebisingan (file depkes) system analysis lingkungan sosial budaya indonesia adaptasi lingkungan perkembangan kebudayaan talaud analisis dampak lingkungan kualitas manusia indonesia faktor manusia komunikasi mengenai lingkungan hidup kapasitas buffer plasma semen manusia lingkungan komunikasi nonverbal lingkungan perawatan kesehatan mekanisme pelestarian lingkungan penerapan standarnya mekanisme pelestarian lingkungan penerpaan standarnya menata kembali hubungan manusia lingkungan alamnya pemilihan teknologi energi pertimbangan lingkungan pengelolaan dampak lingkungan daerah sawah bukaan baru perkembangan pengelolaan kualitas lingkungan indonesia persyaratan asesmen lingkungan dari bank pembangunan asia toksikologi pestisida pengaruhnya lingkungan tunjangan jabatan fungsional pengendali dampak lingkungan aspek kesehatan lingkungan penataan daerah perkotaan integrated approach to budgeting the budgeting environment layanan informasi pdii-lipi bidang bioteknologi lingkungan makna teologis etis bagi pembangunan berwawasan lingkungan membangun negeri keanekaan hayati (file menneg klh) pembangunan teknologi berwawasan lingkungan lampung penduduk ruang fasilitas lingkungan perkotaan mataram pengaruh pengembangan usaha manufaktur lingkungan peranan ilmu hayat pembangunan berwawasan lingkungan rumpun bambu sebagai pengendali tataan alam lingkungan analisa dampak gangguan elektromagnetik lingkungan berbagai masalah pencemaran logam berat lingkungan kita geologi lingkungan daerah pulau belitung' sumatera selatan' himpunan karangan ilmiah bidang perkotaan lingkungan masalah global sebagai aspirasi dasar pendidikan lingkungan pemanfaatan gas bumi kaitannya dampak lingkungan peranan energi nuklir kontribusinya lingkungan perkembangan lingkungan usaha industri makanan indonesia promosi membaca lingkungan lembaga pendidikan non formal studi pengembangan ruang simulator kondisi lingkungan kerja tunjangan jabatan fungsional pengendalian dampak lingkungan audit lingkungan perusahaan tambang timah cv bintang terang dampak perubahan lingkungan pasar strategi korporat foraminefera bentik sebagai bioindikator lingkungan estuarin fungsi sistem informasi pengendalian dampak lingkungan kegiatan industri hukum lingkunganpendekatan normatif pembangunan industri masalah pencemaran lingkungan hidup penelitian lingkungan hidup produksi inokulan skala 100 kg pengembangan keserasian kependudukan lingkungan hidup penyesuaian sosial remaja awal panti asuhan vincentius putra peran serta masyarakat industri pengelolaan lingkungan peranan standardisasi sertifikat 14001 bagi lingkungan hidup peraturan standar kebisingan lingkungan permukiman hubungan mikroba lingkungan ekstraksi bijih uranium investasi perlindungan lingkungan negara-negara berkembang kajian penyusunan strategi pengembangan jasa lingkungan hutan kekuatan lelah baja struktur lingkungan kelembaban tinggi meningkatkan produksi ternak ruminansia berwawasan lingkungan pemanfaatan jasa lingkungan hutan sebagai kawasan ekotourisme pemasyarakatan masyarakat terasing pelestarian lingkungan adaptasi tumbuhan mangrove lingkungan salin jenuh air konsep ekonomi lingkungan pengelolaan sumberdaya alam model pengelolaan sampah kawasan lingkungan berbasis teknologi pembangunan perumahan massal dampaknya lingkungan pendidikan lingkungan hidup menyongsong perubahan global pengaruh laju infiltrasi limpasan erosi permukaan peranan pengelolaan lingkungan pembangunan berkelanjutan audit lingkungan salah satu instrumen pembangunan berkelanjutan hutan sebagai masyarakat tumbuhan hubungannya lingkungan kelembagaan pengelolaan kependudukan lingkungan hidup kerusakan lingkungan oleh limbah industri adalah masalah itikad penataan kawasan perumahan sederhana berwawasan lingkungan penemuan asas pembangunan perumahan berwawasan lingkungan pengaruh pencemaran lingkungan kegagalan bahan sistem penyelesaian perselisihan lingkungan melalui mediasi lingkungan perkembangan daya saing obyek wisata kondisi lingkungan sumberdaya manusia pembangunan nasionalaspek lingkungan tunjangan jabatan struktural lingkungan kepolisian negara ri upaya peningkatan pendapatan daerah dari sektor jasa lingkungan isu lingkungan dinamika industri pulp kertas indonesia membangkitkan peran perempuan pengelolaan lingkungan hidup pengaruh bahan? bahan kimia buangan industri lingkungan pengaruh lingkungan daya tarik fisik komunikasi manusia perancangan jalan saarad meminimalkan kerusakan lingkungan pertimbangan standar lingkungan perdagangan internasional perundangan lingkungan hidup analisis mengenai dampak lingkungan proses-proses lingkungan mempengaruhi kebakaran biomasa analisa mengenai dampak lingkungan penegakan hukum lingkungan ganti rugi penyelesaian sengketa lingkungan (hak atas lingkungan hidup baik sehatlaporan penelitian isu lingkungan pengoperasian pengembangan pltu batubara lingkungan ekono-politik global perdagangan luar negeri indonesia mendorong pertumbuhan perdagangan melalui regulasi lingkungan meningkatkan devisa sektor kehutanan tanpa mengabaikan lingkungan no 20/1990 tgl 5 juni 1990 tentang pengendalian perencanaan air pengaruh interaksi genotipe lingkungan hasil kedelai pengaruh isu lingkungan perdagangan eropa tentang lingkungan pengelolaan lingkungan sebagai materi inti pendidikan lingkungan peranan keluarga masyarakat upaya konservasi lingkungan rehabilitasi lingkungan perairan danau semayang kalimmatan timur super efisiensi data evelopment analysis kinerja lingkungan dampak perubahan lingkungan pasar peran akuntan manajemen dimensi tata krama lingkungan melayu cerita rakyat dumai kali surabaya pollution control study; final report summary report kearifan tradisional pelestarian lingkungan hidup indonesia kerusakan fisik lingkungan akibat penyadaran sistem mekanis lingkungan kerja guru sekolah dasar islam as-shofa kota pekanbaru menuju interaksi harmonis bidang teknik sipil lingkungan hidup pengelolaan konteksnya penataan lingkungan permukiman pengelolaan lingkungan masalahnya propinsi kalimantan timur sistem manajemen lingkungan menyongsong era ramah lingkungan teknologi simulasi pengembangan motor bakar ramah lingkungan tunjangan hakim pengadilan lingkungan peradilan militer usaha-usaha pemanfaatan batubara dampaknya lingkungan acuan pengelolaan lingkungan penambangan batubara indonesia dampak perubahan lingkungan pasar organisasi manajemen deteksi bakteri pencemar kualitas air perairan pulau bunaken dimensi arsitektur lansekap pembangunan berwawasan lingkungan konsultasi masyarakat amdal sebuah panduan pemrakarsa pemanfaatan energi alternatif sebagai upaya perlindungan lingkungan peranan hpti menunjang agribisnis berwawasan lingkungan pertambangan berwawasan lingkungan menuju pembangunan berkelanjutan proses audit lingkungan lingkup sistem pengelolaan lingkungan wanita lingkungan hidup kerangka pembangunan terlanjutkan analisis stabilitas beberapa galur padi mutan berbagai lingkungan batuan gunungapi kalimaan interpretasi lingkungan tektoniknya keberhasilan lingkungan sebagai upaya meningkatkan derajat kesehatan kependudukan lingkungan hidup suatu tinjauan (file menneg klh) manfaat radiasi industri lingkungan kesehatan masyarakat masalah manusia pembangunan lingkungan perumahan pemukiman penanganan masalah dampak lingkungan dari pembangunan kota-kota baru standardisasi lingkungan direktorat jenderal pertambangan umum lingkungan sosial residivis sebuah kabupaten kudus optimasi penyebaran inti kondensasi dampaknya lingkungan pelaksanaan hukum waris islam lingkungan adat mandailing godang pelesetan penggunaan bahasa istilah lingkungan mahasiswa fisip usu pengaruh lingkungan fisik perilakusuatau tinjauan arsitektural perlindungan lingkungan melalui penerapan sistem manajemen lingkungan respons broiler berbagai kondisi lingkungan sikap perilaku jender kebersihan lingkungan rumah tangga tunjangan panitera pengadilan lingkungan peradilan militer analisis turbulensi lingkungan perusahaan garmen pt indotex jaya dampak penambangan gambut energi lingkungan biogeofisik ekosistem unit dasar lingkungan hidupbeberapa prinsip dasar ekologi interaksi genetipe x lingkungan galur-galur tomat laporan penelitian kepedulian mahasiswa masalah lingkungan ada indonesia keselarasan industri perunggasan lingkungan manusia pangan modifikasi rumah tinggal sebagai strategi mengatasi tekanan lingkungan penyidikan tindak pidana bidang lingkungan hidup (studi poldasu) perkembangan lingkungan usaha industri pangan nasional pasar global pokok-pokok pengelolaan kondisi lingkungan hidup daerah lampung etika lingkungan (usul tentang cara merumuskan memasyarakatkannya) kali surabaya pollution control study; final report volume 2 appendices kebijakan perkotaan kaitannya pengelolaan lingkungan hidup kebijaksanaan pembangunan kawasan industri berwawasan lingkungan kerangka uraian pengelolaan lingkungan hidup pembangunan nasional pokok-pokok kebijaksanaan tabungan wajib perumahan lingkungan tni-ad redistribusi tanah obyek landreform berwawasan lingkungan kota medan sikap pegawai mutasi lingkungan universitas riau pekanbaru tugas aparatur penegak hukum lingkungan masalah perbedaan persepsi kajian pengembangan alternatif pendanaan lingkungan hidup; laporan akhir kejahatan lingkungan hidup pelaku kolusi upaya penanggulangannya masalah pemanasan global perspektif hukum lingkungan internasional penerapan sanksi hukum administrasi pencemaran lingkungan hidup peraturan membangun menjamin keserasian lingkungan keamanan bangunan sistem ilmu pengetahuan teknologi kedokteran nasional lingkungan studi tentang dampak demplot penghijauan lahan kering dari murabahah menuju musyarakah upaya mendorong optimalisasi sektor riel analisis faktor-faktor mempengaruhi kecenderungan penerimaan opini audit going concern analisis pengaruh dana alokasi umum (dau) pendapatan asli daerah (pad) prediksi belanja daerah (studi empirik wilayah propinsi jawa tengah diy) analisis pengaruh etika kerja islam sikap karyawan bagian akuntansi perubahan organisasi (bank umum non syariah wilayah eks karesidenan banyumas jawa tengah) analisis pengaruh komitmen organisasi keterlibatan kerja hubungan antara etika kerja islam sikap perubahan organisasi analisis pengaruh pengumuman earning abnormal return tingkat likuiditas sahamanalisis empiris nonsynchronous trading analisis perilaku wajib pajak orang pribadi pelaksanaan self assessment systemsuatu studi bangkalan analisis rasio keuangan memprediksi kondisi financial distress perusahaan manufaktur terdaftar bursa efek jakarta analisis variabel akuntansi kuartalan variabel pasar arus kas operasi mempengaruhi bid-ask spread autokorelasi silang return saham perusahaan besar perusahaan kecil bursa efek jakarta beyond the limit of a theory indonesian case of islamic banking accounting standards cultural influence on perceived usefulness of islamic corporate reporting model dampak jangka panjang merger akuisisi pemegang saham bej perbandingan akusisi internal eksternal dampak set peluang investasi nilai perusahaan publik bursa efek jakarta describing the undescribed (the odd revenue sharing of psak no 59) determinan pengadopsian layanan internet bankingperspektif konsumen perbankan daerah istimewa yogyakarta dupont analysis of an information technology enabled competitive advantage efek informasi asimetri kebijakan dividen efektifitas mekanisme bondingkasus perusahaan-perusahaan dikontrol komisaris independen eksplorasi kebutuhan stakeholders informasi laporan audit pemerintah daerah elaborasi reformasi akuntansi sektor publik telaah kritis upaya aktualisasi kebutuhan sistem akuntansi keuangan pemerintah daerah evaluasi non performing loan (npl) pinjaman qardhul hasan (bni syariah cabang yogyakarta) faktor-faktor berpengaruh kepuasan kerja kinerja manajer perusahaan manufaktur faktor-faktor mempengaruhi earnings response coeficient perusahaan terdaftar bursa efek jakarta faktor-faktor mempengaruhi kebijakan devideninvestigasi pengaruh teori stakeholder faktor-faktor mempengaruhi praktik perataan laba perusahaan asing non asing indonesia flypaper effect dana alokasi umum (dau) pendapatan asli daerah (pad) belanja daerah kabupaten/kota indonesia hubungan antara kinerja lingkungan kualitas pengungkapan lingkungan kinerja ekonomi perusahaan indonesia hubungan antara tipologi strategi kompetitif kematangan teknologi informasi ukuran perusahaan perbankan respon strategik menghadapi globalisasi hubungan kebijakan hutang insider ownership kebijakan dividen mekanisme pengawasan masalah agensi indonesia kinerja keuangan perbankan swasta nasional indonesia sebelum setelah krisis ekonomi konsekuensi penggunakan entity theory sebagai konsep dasar standar akuntansi perbankan syari’ah manajemen laba oleh perusahaan pengakuisisi sebelum merger akuisisi indonesia pendidikan akuntansi perempuandari ideologi patriarki ke praktik pemujaan tubuh pengaruh budaya efektivitas organisasi dimensi budaya hofstede pengaruh desian organisasional locus of control perilaku manipulatif menetapkan harga transfer pengaruh intensitas persaingan pasar strategi ketidakpastian lingkungan dirasakan penggunaan informasi sistem akuntansi manajemen kinerja unit bisnis pengaruh kecanggihan investor ketepatan reaksi pasar merespon pengumuman dividen meningkat pengaruh kepuasan gaji kultur organisasi persepsi aparatur pemerintah daerah tentang tindak korupsi pengaruh komitmen anggaran kultur organisasional hubungan partisipasi penganggaran kinerja manajerial kondisi stretch targets pengaruh komitmen organisasi kepuasan kerja akuntan publik role stress sebagai variabel moderating pengaruh komitmen organisasional keterlibatan kerja hubungan antara etika kerja islam sikap perubahan organisasi pengaruh komitmen respon auditor atas tekanan sosialsebuah eksperimen pengaruh kompleksitas tugas locus of control hubungan antara gaya kepemimpinan kepuasan kerja auditor pengaruh kualitas corporate governance kinerja perusahaan publik (peringkat 10 besar cgpi tahun 2003 2004 2005) pengaruh kualitas pengungkapan informasi hubungan antara penerapan corporate governance kinerja perusahaan bursa efek jakarta pengaruh partisipasi penyusunan anggaran kepuasan kerja kinerja manajer pengaruh partisipasi penyusunan anggaran kepuasan kerja kinerja manajerrole ambiguity sebagai variabel antara pengaruh penggunaan anggaran gaya manajemen hubungan antara perubahan strategik kinerja organisasi pengaruh pertumbuhan utang asosiasi nilai pasar - laba nilai buku ekuitas pengaruh sistem kontrol tidak langsung hubungan participation standard setting standard tightness standard-based incentive job-related stress job performance pengaruh strategi perusahaan kematangan teknologi informasi ukuran perusahaan respon strategik menghadapi globalisasi pengaruh struktur kepemilikan perusahaan kinerjafaktor ketidakpastian lingkungan sebagai pemoderasi pengaruh struktur organisasi terhadapkomunikasi tim audit pengaruh tindakan supervisi kepuasan kerja akuntan pemula pengukuran kinerja bank komersial pendekatan efisiensiterhadap perbankan go public indonesia penilaian asset akuntansi syari’ah perkembangan penelitian akuntansi keperilakuanberbagai teori pendekatan melandasi persepsi mahasiswa jurusan akuntansi reguler non reguler tentang pendidikan profesi akuntansi persepsi penyedia pemakai laporan keuangan pengungkapan biaya riset pengembangan pilihan-pilihan akuntansi aplikasi teori akuntansi positif pola pergerakan harga saham tingkat likuiditas saham pengumuman bonusshareempiris thin market privatization frameworkpolitical economy perspective relevansi nilai earnings pendekatan terintegrasihubungan nonlinier relevansi nilai informasi arus kas rasio laba harga perubahan laba harga sebagai variabel moderasihubungan nonlinier sifat-sifat time-series dari angka akuntansi konservatisme industri manufaktur sikap akuntan advertensi jasa akuntan publik sebagai strategi riset mengembangkan akuntansi sektor publik tax literacy rate among taxpayersevidence from malaysia the analysis of company characteristic influence toward csr disclosureempirical evidence of manufacturing companies listed in jsx the effects of experience and task – specific knowledge on auditors’ performance in assessing a fraud case the power of politic and lobbying parties in the australian accounting regulation reform program understanding the un-present of management accounting in actionan ethnography of a bottling water company value relevance of accounting numbersevidence from the jakarta stock exchange (jsx) would the objectives and characteristics of islamic accounting for islamic business organizations meet the islamic socio-economic objectives? pengaruh epilepsi terjadinya gangguan daya ingat penderita epilepsi anak rsud dr moewardi surakarta pengaruh kemampuan awal motivasi belajar kecemasan menghadapi tes matematika prestasi belajar matematika siswa pengaruh kemampuan awal motivasi belajar kecemasan menghadapi tes matematika prestasi belajar matematika siswa pengaruh kesiapan belajar pola asuh orang tua gaya belajar matematika prestasi belajar matematika siswa kelas iii semester 1 smp negeri 1 banjarnegara tahun ajaran 2005/2006 pengaruh model pembelajaran pbl model pembelajaran sscs ditinjau dari kreativitas inteligensi siswa (materi pokok usaha energi kelas xi ia sma taruna nusantara kabupaten magelang tahun pelajaran 2008 2009) pengaruh model pembelajaran problem based learning cooperative learning prestasi belajar fisika ditinjau dari tingkat kecerdasan emosi siswa (studi eksperimen siswa smp negeri kecamatan wonogiri) pengaruh model pembelajaran quantum learning software computer algebraic system (cas) prestasi belajar matematika ditinjau dari motivasi belajar siswa sma kabupaten sragen pengaruh pemanfaatan media lingkungan media gambar peningkatan prestasi belajar matematika ditinjau dari kreativitas siswa (penelitian eksperimen smp negeri wilayah ngawi barat) pengaruh pembelajaran kooperatif model circ time token kedisiplinan siswa menyelesaikan tugas belajar kimia kompetensi kognitif pengaruh penambahan vitamin c vitamin a dosis rendah suplementasi besi folat kadar hemoglobin ibu hamil anemia sukoharjo pengaruh pendapatan asli daerah (pad) lain-lain pendapatan sah (lps) dana alokasi umum (dau) dana bagi hasil (dbh) pengalokasian anggaran belanja modal pemerintah daerah (studi empiris pemerintah kabupaten/kota pulau kalimant pengaruh penggunaan metode resitasi prestasi belajar akuntansi siswa kelas xi-is semester ii sma muhammadiyah i surakarta tahun ajaran 2006/2007 pengaruh penggunaan metode konseptual bimbingan praktek klinik keperawatan pencapaian kompetensi pengaruh penggunaan media pembelajaran model gambar prestasi belajar ilmu pengetahuan alam ditinjau dari minat belajar siswa (studi komparasi siswa kelas v sdn gugus 02 kecamatan ngawi tahun pelajaran 2008/2009) pengaruh persentase kadar air bentonit mampu alir pasir (flowability) cetakan pasir basah pengaruh persepsi motivasi prestasi belajar ujian akhir program mahasiswa diploma iv kebidanan universitas sebelas maret surakarta pengaruh persepsi dukungan organisasional komitmen organisasi lokus kendali eksternal otonomi kerja sebagai variabel pemoderasi (studi tenaga perawat rumah sakit umum daerah dr moewardi surakarta) pengaruh program on the job training (ojt) prestasi belajar mata diklat mesin-mesin bisnis kesiapan memasuki dunia kerja siswa kelas iii program keahlian penjualan smk negeri 6 surakarta tahun diklat 2005/2006 pengaruh program on the job training (ojt) prestasi belajar mata diklat mesin-mesin bisnis kesiapan memasuki dunia kerja siswa kelas iii program keahlian penjualan smk negeri 6 surakarta tahun diklat 2005/2006 pengaruh stress work outcomes dilihat dari peranan felt challenge psychological strain (perawat rumah sakit dr oen solo baru) pengaruh temperatur austenisasi media pendingin kekerasan austempered medium carbon steel (amcs) proses austempering baja hq 760 pengaruh work family conflict kepuasan kerja komitmen organisasional turnover inventions (studi karyawati rumah sakit islam surakarta) pengaruh abnormal return saham aktivitas volume perdagangan saham bid-ask spread sebelum sesudah pengumuman laporan keuangan tahunan pengaruh agency cost kebijakan dividen perusahaan-perusahaan bursa efek jakarta pengaruh agresivitas aktivitas belajar siswa prestasi belajar matematika siswa kelas vii semester 2 smp negeri 1 baki sukoharjo tahun pelajaran 2005/ 2006 pengaruh agroforestry kehidupan sosial ekonomi sikap petani agroforestry lingkungannya desa genengsari kecamatan toroh kabupaten grobogan tahun 2002 pengaruh ajaran ibnu rusyd gerakan renaissance eropa awal abad xiv pengaruh ajaran ibnu rusyd gerakan renaissance eropa awal abad xiv pengaruh akrual kelolaan growth profitabilitas masa depan perusahaan manufaktur terdaftar bursa efek jakarta tahun 2005 – 2007 pengaruh aktifitas antioksidatif ekstrak tempe kedelai (glycine maxlmer) kualitas daging sapi giling selama penyimpanan kondisi berbeda pengaruh aktivitas fisik submaksimal waktu pemberiam antioksidan vitamin tingkat kebugaran kondisi otot pengaruh anemia motivasi belajar siswa smp pgri i surakarta tahun 2007 pengaruh anemia prestasi belajar siswa kelas i;ii smp pgri surakarta tahun ajaran 2006/2007 pengaruh anggaran partisipatif kinerja manajerial keputusan kerja locus of control dimensi kultum sebagai variabel moderating pengaruh antara anggaran partisipatif kinerja manajerial structur organisasi sebagai variabel moderating job relevan information sebagai variabel intervening pengaruh antara berat badan bayi terjadinya sepsis pengaruh aplikasi probiotik em4 kelangsungan hidup benih lele dumbo (clarias gariepinus) pengaruh aras suplementasi probiotik substitusi bekatul padi wheat pollard persentase bagian karkas lemak abdominal ayam broiler pengaruh asal universitas tingkat inteligensi persepsi mahasiswa akuntansi memahami prinsip akuntansi berterima umum (pabu) standar akuntansi keuangan (sak) pengaruh asap pelelehan lilin batik (malam) struktur histologis trakea alveoli pulmo jumlah eritrosit serta kadar hemoglobin mencit (mus musculus l) pengaruh asimetri akuntansi hubungan antara regulasi perbankan manajemen laba serta dampaknya kinerja saham pengaruh asimetri informasi kualitas auditor manajemen laba perusahaan bergerak sektor keuangan terdaftar bei pengaruh asimetri informasi penganggaran partisipatif beberapa yayasan/lembaga sosial masyarakat kota surakarta sebuah survei pengaruh asimetri informasi praktik manajemen laba perusahaan perbankan go publik terdaftar bursa efek jakarta pengaruh aspartam kadar treatinin serum struktur histologis ren mencit (mus musculus l) strain swiss pengaruh aspek kepemimpinan mentoring tindakan supervisi kepuasan kerja karyawan bagian akuntansi pengaruh aspek kepemimpinan mentoring tindakan supervisi kepuasan kerja karyawan bagian akuntansi pengaruh asset growth debt to equity ratio return on equity earning per share beta saham perusahaan jasa bej periode 2000-2002 pengaruh atmosfir toko kenyamanan kesesuaian keragaman produk harga pelayanan personil pembentukan citra toko eceran (wilayah kotamadya surakarta) pengaruh atribut kepribadian organizational citizenship behavior studi karyawan pt pondok solo permai solo baru sukoharjo tahun 2003 pengaruh atribut kualitas jasa kepuasaan pelanggan cv aditama elkomedia surakarta pengaruh authoritarianism tekanan kepatuhan judgment auditor (suatu eksperimen semu mahasiswa fakultas ekonomi jurusan akuntansi telah menempuh mata kuliah auditing) pengaruh back exercise nyeri punggung bawah (studi experimen perbandingan dua model latihan punggung bawah rumah sakit dr moewardi surakarta) pengaruh bahan organik pupuk fosfor ketersediaan serapan fosfor andisols indikator tanaman jagung manis (zea mays saccharata strurt) pengaruh bahan tambah sika viscocrete sikament nn kuat lekat beton mutu tinggi pengaruh bahan tambah sika viscocrete sikament nn kuat lentur beton pengaruh based self-esteem keinginan pindah komitmen organisasi sebagai variabel intervening pengaruh bauran pemasaran keputusan konsumen memiliki kartu kredit bri (bri kantor cabang solo slamet riyadi) pengaruh bauran pemasaran keputusan mahasiswa program studi pendidikan ekonomi uns pengaruh bauran pemasaran keputusan mahasiswa program studi pendidikan ekonomi uns membeli produk im3 pengaruh bauran pemasaran omzet penjualan produk madurasa jeruk sachet (kasus pt air mancur) pengaruh bauran pemasaran peralihan merek pengguna kartu seluler gsm prabayar tahun 2009 (studi mahasiswa pendidikan ekonomi universitas sebelas maret surakarta) pengaruh bauran promosi volume penjualan harian umum solopos pengaruh beberapa atribut kepribadian perilaku etika pekerja wanita tingkat pelecahan seksual tempat kerja penelitian sebuah kawasan perumahan karanganyar pengaruh berbagai jenis beras aktivitas antimikrobia angkak oleh monascus purpureus pengaruh berbagai jenis beras aktivitas antioksidan angkak oleh monascus purpureus pengaruh berbagai konsentrasi em4 fermentasi pupuk organik pertumbuhan hasil tanaman bayam merah (amaranthus tricolor l) secara hidroponik pengaruh berbagai macam pupuk organik dosis pengapuran perkembangan penyakit akar bengkak (plasmodiophora brassicae woronin) tanaman kubis pengaruh beta saham volume perdagangan saham perusahaan manufaktur go publik bej tahun 2002 (studi empiris perusahaan manufaktur mengeluarkan saham biasa) pengaruh beta size me/be per return saham perusahaan manufaktur bursa efek jakarta pengaruh biaya bauran promosi pt danliris sukoharjo peningkatan volume penjualan produk kain printing batik pengaruh biaya distribusi volume penjualan primkopti klaten pengaruh biaya keagenan struktur kepemilikan kebijakan dividen perusahaan manufaktur terdaftar bursa efek indonesia periode 2003-2007 pengaruh biaya periklanan biaya personal selling biaya promosi penjualan volume penjualan pt garuda indonesia cabang solo pengaruh biaya promosi penjualan bb harum sari pt air mancur karanganyar pengaruh biaya saluran distribusi peningkatan penjualan perusahaan iklan asin mino arto cilacap pengaruh biaya saluran distribusi volume penjualan perusahaan furniture pt cipta kreasi klasik surakarta pengaruh bimbingan belajar ketrampilan bina diri anak tuna daksa peningkatan kemandirian siswa sdlb d-1 slb - d ypac surakarta tahun 2006/2007 pengaruh bimbingan belajar ketrampilan bina diri anak tuna daksa peningkatan kemandirian siswa sdlb d-1 slb- d ypac surakarta tahun 2006/2007 pengaruh bimbingan tenaga kesehatan kompetensi dukun bayi pelayanan kia puskesmas mrebet kabupaten purbalingga pengaruh budaya indis perkembangan arsitektur surakarta awal abad xx pengaruh budaya organisasi lingkungan kerja kinerja perawat rsud dr moewardi surakarta pengaruh budaya organisasi cohesiveness budgetary slack pengaruh budaya organisasi gaya kepemimpinan situasional semangat kerja pegawai dinas pengelola kekayaan daerah kabupaten sukoharjo pengaruh budaya organisasi komitmen organisasi sebagai variabel moderating hubungan partisipasi penyusunan anggaran kinerja aparat pemerintah daerah satuan kerja perangkat daerah kabupaten karanganyar pengaruh budget goal difficulty kinerja manajer self efficacy budget goal commitment sebagai variabel pemoderasi pengaruh ca(oh)2 karakteristik gel instan dari daun cincau hijau (premna oblongifolia merr) pengaruh calcium channel blocker l n analgesia akupunktur (studi eksperimental rattus norvegicus) pengaruh campuran bahan bakar minyak kerosin minyak pelumas variasi putaran mesin unjuk kerja mesin diesel kama pengaruh campuran bahan bakar minyak kerosin minyak pelumas variasi putaran mesin unjuk kerja mesin diesel kama pengaruh campuran pasir sifat keramik berbahan baku lempung dari industri genteng kebakkramat kab karanganyar pengaruh cara belajar fasilitas belajar prestasi belajar teknologi informasi komunikasi siswa kelas x sma n 3 boyolali tahun ajaran 2008/2009 pengaruh citra hypermarket keputusan pembelian konsumen hypermart solo grand mall surakarta tahun 2006 pengaruh computer anxiety computer attitude keahlian akuntan pendidik menggunakan komputer pengaruh consumer-level factor kesuksesan private label brands (survei konsumen perusahaan ritel kota solo memiliki produk plbs) pengaruh core campuran sampah daun kering kertas koran plastik hdpe komposit sandwich uprs cantula 3d nilai sound transmission loss pengaruh corporate governance mechanisms cost of equity capital pengaruh corporate governance etnis latar belakang pendidikan kinerja keuangan perusahaanempiris perusahaan publik terdaftar bursa efek indonesia pengaruh corporate governance etnis latar belakang pendidikan environmental disclosure empiris perusahaan listing bursa efek indonesia pengaruh corporate image customer satisfaction customer loyalty variabel moderasi switching cost (studi pelanggan kartu seluler esia) pengaruh corporate social responsibility kinerja keuangan perusahaan perusahaan sektor pertambangan otomotif indonesia pengaruh corporate social responsibility disclosure institutiona ownership firm value (studi empiris perusahaan konstruksi property real estate bei tahun 2005-2007) pengaruh corporate social responsibility disclosure institutional ownership firm value (studi empiris perusahaan konstruksi property real estate bei tahun 2005-2007) pengaruh corporate social responsibility disclosure kinerja keuangan pengaruh customer commitment customer trust loyalitas konsumen dimoderasi oleh gender (hotel laweyan surakarta) pengaruh dana alokasi khusus (dak) pendapatan asli daerah (pad) belanja daerah bidang pendidikan kabupaten/kota sulawesi pengaruh defisit anggaran belanja negara defisit neraca transaksi berjalan indonesia (tinjauan teori mundell-flemming ekuivalensi ricardian) pengaruh desain kompensasi-insentif kinerja tenaga penjual motivasi kerja sebagai variabel intervening pengaruh desain kompensasi-insentif kinerja tenaga produksi motivasi kerja sebagai variabel intervening pengaruh deviden capital gain volume perdagangan saham bursa efek jakarta pengaruh dimensi komitmen karyawan organisasi komitmen karyawan supervisor kinerja tugas studi pt batik danar hadi surakarta pengaruh dimensi kualitas pelayanan kepuasan nasabah kredit perorangan pd bpr bank daerah kabupaten karanganyar pengaruh dimensi kualitas pelayanan kepuasan pelanggan pt perusahaan listrik negara (persero) area pelayanan jaringan klaten pengaruh dimensi-dimensi disiplin kerja prestasi kerja karyawan tetap bagian produksi pg tasikmadu pengaruh dimensi-dimensi kecerdasan emosional persepsi kinerja iklim organisasi sebagai variabel moderator pengaruh disiplin belajar siswa minat baca buku pelajaran oleh siswa prestasi belajar ilmu pengetahuan sosial siswa smp ykab surakarta tahun pelajaran 2006 pengaruh disiplin belajar siswa minat baca buku pelajaran oleh siswa prestasi belajar ilmu pengetahuan sosial siswa smp ykab surakarta tahun pelajaran 2006 pengaruh disiplin kerja karyawan lingkungan kerja fisik prestasi kerja karyawan bagian texturizing produksi pt mutu gading karanganyar pengaruh distribusi promosi volume penjualan perusahaan roti ganep’s surakarta pengaruh dorongan organisasional kinerja tugas kontrak psikologis sebagai variabel pemediasi (studi karyawan pt danliris sukoharjo jawa tengah) pengaruh dosis bahan organik dolomit kapasitas pertukaran kation kejenuhan basa oxisol jumapolo indikator tanaman kacang tanah (arachis hypogaea l) pengaruh dosis bahan organik konsentrasi paklobutrazol kuantitas hasil minyak atsiri tanaman poko (mentha arvensis l) pengaruh dosis pupuk majemuk konsentrasi em-4 pertumbuhan bibit stek tebu (saccharum officinarum l) pengaruh dosis pupuk nitrogen konsentrasi paklobutrazol kuantitas hasil minyak atsiri tanaman poko (mentha arvensis l) pengaruh dukungan organisasi hubungan computer anxiety keahlian auditor menggunakan teknik audit berbantuan komputer pengaruh dukungan sosial keseimbangan kerja keluarga serta hasil kerja (studi dosen wanita universitas sebelas maret surakarta) pengaruh earning ratio volume penjualan suku bunga sbi return saham perusahaan bergerak bidang financial bursa efek jakarta pengaruh earnings management corporate governance nilai perusahaanempiris perusahaan manufaktur terdaftar bei pengaruh economic value added (eva) rasio keuangan perubahan harga saham perusahaan manufaktur bursa efek jakarta pengaruh economic value added (eva) market value added (mva) rasio profitabilitas harga saham perusahaan manufaktur bursa efek jakarta pengaruh efektivitas efisiensi manajemen keuangan daerah pertumbuhan ekonomi (suatu telaah empirik kabupaten karanganyar tahun 1990 – 2005) pengaruh efektivitas iklan kesadaran merek kekuatan iklan semen holcim melalui media televisi loyalitas konsumen pengaruh efektivitas sistem akuntansi manajemen peningkatan kinerja manajerial ketidakpastian lingkungan struktur organisasional sebagai variabel moderating pengaruh ekspektasi kinerja ekspektasi usaha faktor sosial kepuasan pemakai penggunaan sistem informasi berbasis komputer perusahaan penerbitan surakarta pengaruh ekspektasi pelanggan aplikasi bauran pemasaran loyalitas toko modern kepuasan pelanggan sebagai intervening (hypermart solo grand mall) pengaruh ekstrak akar manis (glycyrrhiza glabra) kerusakan dinding lambung mencit (mus musculus) diinduksi aspirin pengaruh ekstrak bawang putih (allium sativum l) struktur mikroanatomi hepar kadar glutamat piruvat transaminase (gpt) serum tikus putih (rattus norvegicus l) setelah pemberian karbon tetraklorida (ccl4) secara oral pengaruh ekstrak bawang putih (allium sativum linn) kadar glukosa darah tikus putih (rattus norvegicus) pengaruh ekstrak biji pare (momordica charantia l) mortalitas larva aedes aegypti l pengaruh ekstrak kencur lama simpan cendawan terbawa benih viabilitas benih jeruk (citrus sp) pengaruh ekstrak kulit apel rome beauty mengurangi kerusakan histologis hati mencit diinduksi ccl4 pengaruh ekstrak kulit apel rome beauty peningkatan kadar alanine aminotransferase mencit dipapar ccl4 pengaruh ekstrak lidah buaya (aloe vera) pertumbuhan pseudomonas aeruginosa pasien osteomielitis bangsal cempaka rumah sakit ortopedi prof dr r soeharso surakarta invitro pengaruh ekstrak tanaman daun sendok (plantago major l) hitung jenis sel leukosit darah tepi mencit model alergi pengaruh ekstrak temulawak lama penyimpanan cendawan terbawa benih viabilitas benih jeruk (citrus sp) pengaruh ekuitas merek keputusan pembelian air minum berkarbonasi merek fanta (studi mahasiswa program studi pendidikan ekonomi angkatan 2003 jurusan pendidikan ilmu pengetahuan sosial fkip uns) pengaruh ekuitas merek keputusan pembelian air minum berkarbonasi merek fanta (studi mahasiswa program studi pendidikan ekonomi angkatan 2003 jurusan pendidikan ilmu pengetahuan sosial fkip uns) pengaruh elemen bauran pemasaran ekuitas erek dimediasi oleh perceived quality brand associations sim card prabayar simpati pengaruh elemen-elemen marketing mix brand equity merek samsung (mahasiswa fakultas ekonomi universitas sebelas maret surakarta) pengaruh elevasi tungkai penurunan kejadian hipotensi anestesi spinal pengaruh etos kerja islam sikap perubahan organisasi menggunakan komitmen organisasional sebagai variabel moderatorpada pengurus hmi lingkup cabang surakarta pengaruh evaluasi kinerja pengembangan karir karyawan pt bank mandiri (persero) tbk surakarta pengaruh extrinsic cues (harga citra merek citra toko country of origin) perceived quality perceived sacrifice perceived value pengaruh faktor bunga penagihan tindakan penagihan pelayanan wajib pajak upaya mendapatkan kepastian hukum kepatuhan pelunasan hutang pajak pengaruh faktor demografi personality keahlian end-user computing (euc) akuntan pendidik mahasiswa akuntansi kota solo pengaruh faktor demografis kepuasan kerja (karyawan rekam medis non-pns rsud dr moewardi surakarta tahun 2006) pengaruh faktor eksternal keputusan pembelian sepeda motor honda (survey dealer astra motor nonongan-solo) pengaruh faktor keuangan non keuangan ketepat waktuan penyampaian laporan keuangan perusahaan perbankan terdaftar bursa efek indonesia pengaruh faktor komunikasi pemakai-pengembang konflik pemakai proses pengembangan pengaruh faktor lingkungan kerja usia masa pensiun tingkat stres kerja kinerja pegawai perseroan terbatas (pt) duta ananda textile pekalongan pengaruh faktor organisasional stres kerja para perawat pengalaman kerja sebagai variabel pemoderasi pengaruh faktor pelayanan tarif keamanan kendaraan kepuasan konsumen pengaruh faktor personal lingkungan keinginan berwirausaha (penelitian mahasiswa universitas sebelas maret surakarta) pengaruh faktor personality computer training keahlian menggunakan komputer mahasiswa fakultas ekonomi universitas sebelas maret surakarta pengaruh faktor psikologi sosial fisik finansial kepuasaan kerja beauty advisor pt sinar makro pesona sejahtera (martha tilaar group) cabang surabaya pengaruh faktor struktur aktiva return on asset (roa) ukuran perusahaan (size) book value equity per share (bves) earning per share (eps) harga saham pengaruh faktor tax payer keberhasilan penerimaan pajak bumi bangunan kecamatan pangkalan kabupaten karawang pengaruh faktor usia ukuran jenis industri aktivitas environmental scanning {sebuah studi replikasi perluasan pengujian model mohan neill (1995) perusahaan manufaktur perusahaan jasa kota surakarta pengaruh faktor – faktor individual penggunaan sistem informasi berbasis komputer kinerja karyawan pt jamsostek (persero) pengaruh faktor – faktor marketing mix keputusan berbelanja hypermarket nilai persepsi sebagai variabel mediasi (assalaam hypermarket) pengaruh faktor-faktor fundamental risiko sistematik harga saham (perusahaan manufaktur listed bei) pengaruh faktor-faktor individual keahlian auditor menggunakan teknik audit berbantuan komputer pengaruh faktor-faktor keunggulan produk baru kegunaan produk nilai pelanggan memori iklan keputusan adopsi (mahasiswa univesitas sebelas maret surakarta) pengaruh faktor-faktor kualitas jasa kepuasan nasabah (study kasus pt jamsostek persero cabang surakarta) pengaruh faktor-faktor kualitas pelayanan kepuasan pasien rawat inap rumah sakit ibu anak sarila husada sragen pengaruh faktor-faktor motivasi kinerja karyawan cv gion and rahayu kartasura pengaruh faktor-faktor pencarian informasi penilaian konsumen memori iklan keputusan adopsi produk baru extra joss strike (penduduk kecamatan karanganyar) pengaruh faktor-faktor pencarian informasi penilaian pelanggan memori iklan keputusan adopsi produk baru pengaruh fasilitas prosedur pelayanan pembuatan ktp kepuasan masyarakat kecamatan masaran kabupaten sragen pengaruh fasilitas prosedur pelayanan pembuatan ktp kepuasan masyarakat kecamatan masaran kabupaten sragen pengaruh financial leverage return on assets earning per share underpricing perusahaan melakukan initial public offering bursa efek indonesia tahun 2003 – 2007 pengaruh firm size financial factors mekanisme corporate governance pengungkapan tanggungjawab lingkungan perusahaan manufaktur indonesia pengaruh fraksi berat filler sampah kota variasi binder sifat fisik sifat mekanik komposit-sampah kota pengaruh fraksi berat sekam sifat mekanik fisik komposit unsaturated polyester resin (uprs)-sekam pengaruh fraksi volume serat serat mekanis komposit unsaturated polyester diperkuat serat kenaf pengaruh frekuensi pemberian air macam pupuk organik pertumbuhan hasil tanaman kumis kucing (orthosiphon aristatus bl miq) pengaruh frekuensi pemberian pakan hijauan kecernaan bahan kering bahan organik domba lokal jantan pengaruh frekuensi pemberian pakan hijauan performan domba lokan jantan pengaruh frekuensi perdagangan saham harga saham stock split pengaruh ga3 iaa pembesaran bonggol adenium (adenium obesum) pengaruh gaya hidup perilaku pemirsa televisi dimoderasi oleh faktor demografi (studi pemirsa ta tv solo) pengaruh gaya kepemimpinan pemberian kompensasi efektivitas kerja karyawan pt pabelan kartasura tahun 2006 pengaruh gaya kepemimpinan kharismatik non kharismatik kepuasan kerja karyawan dimoderasi oleh perbedaan unit kerja (pt indocement p - 12) pengaruh gaya kepemimpinan kinerja karyawan motivasi sebagai variabel permoderasi pengaruh gaya kepemimpinan kinerja manajer kepuasan kinerja komitmen organisasi sebagai intervening variable pengaruh gaya kepemimpinan komitmen organisasional (studi karyawan bank indonesia solo) pengaruh gaya kepemimpinan komitment organisasi (studi hotel novotel) pengaruh gaya kepemimpinan transformasional lingkungan kerja tingkat pendidikan kepuasan kerja karyawan studi karyawan asuransi jiwa adisarana wanaartha surakarta (wana artha life) pengaruh gelombang elektromagnetik frekuensi ekstrim rendah kadar low density lipoprotein-cholesterol (ldl-c) tikus putih (rattus norvegicus) pengaruh gelombang elektromagnetik frekuensi ekstrim rendah kadar trigliserida tikus putih (rattus norvegicus) pengaruh goal orientation karyawan innovative job performance leader – member exchange sebagai pemediasi (studi karyawan pt widya duta grafika surakarta) pengaruh harga fasilitas pelayanan lokasi frekuensi hunian hotel agas internasional surakarta (hotel agas internasional surakarta) pengaruh harga kepercayaan merek pelayanan kesetiaan merek (pengguna sepeda motor merek yamaha surakarta) pengaruh harga merek informasi toko evaluasi konsumen produk ponsel pengaruh health education pengetahuan sikap wanita dewasa tentang sadari upaya deteksi dini ca mammae kediri pengaruh herbisida pra tanam pogesan pertumbuhan hasil tanaman bawang merah (allium ascolonicum l) pengaruh hubungan fiskal pemerintah pusat – daerah pertumbuhan ekonomi daerah (kabupaten kudus tahun 1991 - 2006) pengaruh iaa ga3 pertumbuhan kandungan saponin tanaman purwaceng (pimpinella alpina molk) pengaruh iba kinetin pertumbuhan perkembangan eksplan bawang merah (allium ascalonicum l) secara in vitro pengaruh iklan untung beliung britama minat nasabah menabung tabungan britama bri (kanca bri klaten) pengaruh imbangan hijauan konsentrat berbahan baku limbah pengolahan hasil pertanian ransum kecernaan bahan kering bahan organik sapi pfh jantan pengaruh imbangan hijauan konsentrat berbahan baku limbah pengolahan hasil pertanian ransum penampilan sapi pfh jantan pengaruh imbangan jerami kacang tanah rumput raja ransum performan sapi peranakan friesian holstein (pfh) jantan pengaruh imbangan jerami kacang tanah rumput raja kecernaan bahan kering bahan organik ransum sapi pfh jantan pengaruh imbangan jerami padi fermentasi konsentrat kecernaan bahan organik bahan kering ransum domba lokal jantan pengaruh imbangan jerami padi permentasi konsentrat pertumbuhan domba jantan lokal pengaruh implantasi ion cerium (ce) material fenicrmo peningkatan ketahanan oksidasi suhu tinggi pengaruh implementasi kebijakan sdm komitmen afektif perubahan perceived implementation success (studi karyawan pt tiga pilar sejahtera tbk) pengaruh implementasi teknologi internet kapasitas produksi tenaga kerja pendapatan eksportir surakarta (periode tahun 2001-2002) pengaruh income smoothing keinformatifan laba pengaruh indikator makroekonomi indeks harga saham sektor keuangan bej pasca krisis moneter 1997 pengaruh industri kecil konveksi kehidupan sosial ekonomi masyarakat desa tangkisan kecamatan tawangsari kabupaten sukoharjo tahun 1985 - 2000 pengaruh industri pariwisata pendapatan wisata pantai kabupaten gunung kidul pengaruh informasi asimetri ketidakpastian lingkungan budgetary slack pengaruh informasi asimetri komitmen organisasi partisipasi anggaran kecenderungan bawahan menciptakan senjangan anggaran pengaruh informasi laporan keuangan memprediksi perubahan laba satu tahun mendatang perusahaan property real estate pengaruh informasi laporan keuangan pendapatan dividen tunai (perusahaan manufaktur terdaftar bej) pengaruh informasi metode ceramah diskusi perubahan perilaku kadar glukosa darah penderita diabetes melitus tipe 2 pengaruh informasi prospektus ipo abnormal return ketepatan ramalan laba sebagai variabel intervening pengaruh informasi prospektus ipo keputusan investasi investor bursa efek jakarta pengaruh informed consent kecemasan pengetahuan pasien pre operasi hernia rsud kabupaten sragen pengaruh inokulasi cendawan mikoriza arbuskula (cma) pertumbuhan bibit pule pandak (rauvolfia verticillata lour) pengaruh insektisida nabati ekstrak mahkota dewa pertumbuhan perkembangan hama croccidolomia binotalis zell tanaman caisin pengaruh insider ownership institutional investor dividen payments firm growth (perusahaan manufaktur terdaftar bursa efek jakarta) pengaruh integrasi internal logistik/markating integrasi eksternal kinerja perusahaan jasa perdagangan pengaruh integrasi manfaat relasional kualitas hubungan karyawan-pelanggan relationship marketing outcomes pt bank rakyat indonesia tbk unit sambi boyolali pengaruh intensitas kebisingan kelelahan tenaga kerja bagian welding 2b bagian p2 shipping cbu pt x plant ii jakarta utara pengaruh intensitas latihan beban status gizi penurunan persentase lemak tubuh (studi eksperimen perbedaan pengaruh intensitas latihan beban rendah sedang siswa putri sma mta surakarta tahun 2007) pengaruh intensitas pemanfaatan sumber belajar sikap profesi guru prestasi belajar profesi keguruan pengaruh intensitas radiasi karakteristik pengeringan gabah kualitas beras model pengering radiasi infra merah pengaruh investasi tenaga kerja output sektor industri kecil jawa tengah pengaruh investor cerdas persistensi akrual kelolaan perusahaan manufaktur publik bursa efek indonesia pengaruh iradiasi sinar-x produksi antibodi mencit galur balb/c pemberian vaksin toksoid tetanus pengaruh ivestment opportunity set mekanisme corporate governance kualitas laba nilai perusahaan pengaruh jejas biomekanik apoptosis kondrosit rawan sendi lutut kelinci melalui akumulasi ca2+ intraseluler pengaruh jenis cetakan variasi suhu artificial aging proses agehardening tingkat kekerasan paduan aluminium pengaruh jenis koil pengapian celah busi kadar karbon monoksida (co) gas buang sepeda motor honda karisma tahun 2003 pengaruh jenis opini auditor tingkat profitabilitas ukuran kap pergantian auditor lamanya audit perusahaan perbankan terdaftar bursa efek jakarta pengaruh jenis resin thermosetting kekuatan impak konduktivitas panas komposit agave cantula roxb pengaruh jenis sistem pengapian cdi jenis bensin kadar karbon monoksida (co) gas buang sepeda motor honda supra tahun 2003 pengaruh jenjang pendidikan motivasi kerja kinerja tenaga analis kesehatan laboratorium klinik kota surakarta pengaruh job insecurity kepuasan kerja komitmen organisasional turnover intention (studi rsu islam kustati surakarta pengaruh job insecurity komitmen organisasi kepuasan kerja turnover intention tenaga keperawatan rumah sakit umum daerah karanganyar pengaruh jumlah anggota praktikum pembelajaran fisika pendekatan keterampilan proses ditinjau dari sikap ilmiah prestasi belajar siswa pengaruh jumlah ruas macam media tanam pertumbuhan setek batang panili (vanilla planifolia andrews) pengaruh jumlah sudu impeler fenomena kavitasi pengaruh jumlah sudu impeler fenomena kavitasi pengaruh jumlah sudu impeler fenomena kavitasi pengaruh jumlah sudu impeler fenomena kavitasi pengaruh jumlah sudu swirling vane penggunaan jenis muffler daya motor suzuki shogun r fd 110 tahun 2003 pengaruh jumlah sudu swirling vane penggunaan jenis muffler daya motor suzuki shogun r fd 110 tahun 2003 pengaruh jus buah pepaya (carica papaya) kerusakan histologis lambung mencit diinduksi aspirin pengaruh kadar albumin serum morbiditas mortalitas maternal pasien preeklampsia/ eklampsia rsud dr moewardi surakarta pengaruh kandungan informasi kinerja keuangan perusahaan perubahan harga saham perusahaan manufaktur terdaftar bei pengaruh karakteristik dewan komisaris pengungkapan intellectual capital (studi perbankan syariah asia) pengaruh karakteristik informasi akuntansi keberhasilan usaha hotel-hotel berbintang wilayah surakarta daerah istimewa yogyakarta (diy) pengaruh karakteristik informasi sistem akuntansi manajemen kinrja manajerial desentralisasi budaya organisasi sebagai variabel pemoderasi (hotel berbintang surakarta) pengaruh karakteristik model iklan preferensi konsumen melaksanakan keputusan pembelian sabun mandi lux wilayah surakarta (studi penduduk kelurahan jebres) pengaruh karakteristik pekerjaan pertukaran pemimpin anggota kepuasan kerja pengaruh karakteristik pekerjaan turnover intentions kepuasan kerja sebagai variabel pemediasi (studi pt sukoharjo tex sukoharjo) pengaruh karakteristik pemilik perusahaan karakteristik perusahaan lingkungan kinerja perusahaan mediasi strategi inovasi perusahaan kecil menengah lingkungan industri furniture ngemplak surakarta pengaruh karakteristik perusahaan tingkat kelengkapan sukarela laporan tahunan pengaruh karakteristik tujuan anggaran kinerja aparat pemerintah daerah (studi empiris pemerintah kabupaten temanggung) pengaruh kascing pupuk anorganik efisiensi serapan p hasil jagung manis (zea mays saccharata sturt) alfisols jumantono pengaruh kascing pupuk anorganik ketersediaan nitrogen alfisols jumantono serapannya oleh tanaman jagung manis (zea mays l saccharata) pengaruh kascing pupuk anorganik serapan k hasil tanaman jagung manis (zea mays saccharata sturt) tanah alfisol jumantono pengaruh keadilan prosedural keadilan distributif kepuasan kerjadan komitmen organisasi organizational citizenship behavior {studi replikasi penelitian adam g alotaibi (2001) sekretariat daerah surakarta} pengaruh keahlian komunikasi pemakai-pengembang hubungan partisipasi kepuasan pemakai pengembangan sistem informasi pengaruh keaktifan siswa organisasi (ekstrakurikuler) sekolah motivasi belajar prestasi belajar siswa kelas ii sman i pulokulon purwodadi grobogan tahun ajaran 2006/2007 pengaruh keberadaan beteng trade centre (btc) pusat grosir solo (pgs) mobilitas perdagangan pasar batik klewer pengaruh keberadaan beteng trade centre (btc)dan pusat grosir solo (pgs) mobilitas perdagangan pasar batik klewer pengaruh kebiasaan merokok ph saliva pengaruh kebijakan dividen harga saham waktu ex-dividenday pengaruh kebijakan harga promosi distribusi penjualan pt sun motor jebres surakarta pengaruh kebijakan hutang kebijakan investasi kebijakan dividen nilai perusahaan manufaktur terdaftar bursa efek indonesia tahun 2003-2007 pengaruh kebijakan moneter pertumbuhan ekonomi pasca krisis indonesia (januari 1999-desember 2003) pengaruh kebijakan moneter pertumbuhan ekonomi pasca krisis indonesia (januari 1999-desember 2003) pengaruh kebijakan pemerintah kabupaten sukoharjo perkembangan pariwisata daerah pengaruh kebijakan penanaman jarak kehidupan penduduk masa penjajahan jepang surakarta pengaruh kebijakan perpajakan undang-undang perpajakan administrasi perpajakan motivasi manajemen perusahaan melakukan tax planning perusahaan tekstil eks karisidenan surakarta pengaruh kebisingan denyut nadi karyawan dinas perhubungan terminal tirtonadi surakarta pengaruh kecepatan suhu pembakaran sifat bahan baku genteng keramik desa kemiri kecamatan kebakkramat kabupaten karanganyar pengaruh kecepatan torch jenis nyala api kekerasan permukaan baja karbon proses automatic flame surface hardening pengaruh kecerdasan emosional kecerdasan sipiritual auditor kinerja auditor pengaruh kecerdasan emosional kompetensi motivasi kinerja dosen program studi ilmu keperawatan universitas sahid surakarta pengaruh keharmonisan pendapatan keluarga prestasi belajar akuntansi siswa kelas xi sma muhammadiyah 2 surakarta semester i tahun ajaran 2005-2006 pengaruh keharmonisan pendapatan keluarga prestasi belajar akuntansi siswa kelas xi sma muhammadiyah 2 surakarta semester i tahun ajaran 2005-2006 pengaruh keharmonisan keluarga prestasi belajar pkn siswa kelas vii sltp negeri 3 polokarto kabupaten sukoharjo tahun ajaran 2007/2008 pengaruh kekasaran permukaan bahan pemegang (holder) pahat tip kekuatan geser sambungan brazing pengaruh kekuasaan sosial kepuasan kerja keadilan prosedural sebagai pemediasi (studi quality hotel solo) pengaruh kemampuan diri (self-efficacy) hubungan antara kepemimpinan diri (self-leadership) kinerja peserta didik lembaga pendidikan tinggi militer tingkat akademi (studi akademi angkatan udara yogyakarta) pengaruh kemampuan inteligensi task commitment prestasi belajar matematika siswa kelas ii sltp n 1 gemolong pengaruh kemampuan numerik kemampuan logika abstrak aktivitas belajar matematika prestasi belajar matematika siswa kelas xi sma 1 jepon pengaruh kemampuan numerik kemampuan logika abstrak aktivitas belajar matematika prestasi belajar matematika siswa kelas xi sma 1 jepon pengaruh kemampuan sistem kepuasaan pemakai sistem informasi akademik fakultas ekonomi universitas sebelas maret surakarta pengaruh kematangan sampah produksi gas metana (ch4) tpa putri cempo mojosongo pengaruh kenaikan kadar kortisol adrenalin darah penurunan sel t cd8 cedera otak berat pengaruh kenyamanan dorongan kualitas pelayanan kualitas barang berdasarkan musik latar perilaku pembelian konsumen toko buku gramedia surakarta pengaruh kepemilikan institusional ukuran perusahaan kebijakan hutang nilai perusahaan (studi perusahaan manufaktur tercatat bei) pengaruh kepemilikan institusional corporate governance perception index ukuran perusahaan kualitas akrual pengaruh kepemilikan institusional likuiditas aset tangibility struktur modal perusahaan manufaktur bidang food and baverage terdaftar bursa efek indonesia tahun 2005-2007 ukuran perusahaan sebagai variabel kontrol pengaruh kepemilikan institusional profitabilitas free cash flow kebijakan hutang perusahaan perbankan terdaftar bursa efek indonesia tahun 2005-2007 pengaruh kepemilikan manajerial kepemilikan eksternal debt equity ratio (perusahaan manufaktur terdaftar bej tahun 2000-2004) pengaruh kepemilikan manajerial ukuran perusahaan kebijakan dividen profitabilitas leverage set kesempatan investasi (investment opportuniity set) perusahaan manufaktur terdaftar bursa efek indonesia (bei) pengaruh kepemimpimpinan transformasional organizational citizenship behaviour (ocb) meaning sebagai variabel pemediasi (studi pt air mancur surakarta pengaruh kepemimpinan diri kinerja keyakinan diri sebagai variabel pemediasi (studi mahasiswa s1 reguler angkatan 2003 fe uns) pengaruh kepemimpinan kepala sekolah sikap guru proses pembelajaran (sma negeri 4 surakarta) tahun 2008 pengaruh kepemimpinan paternalistik komitmen organisasi iklim etika sebagai pemediasi perusahaan dua berlian plastik surakarta pengaruh kepemimpinan perilaku chizenship (ocb) kepuasaan kerja komitmen organisasi (studi tenaga perawat rsu pku muhammadiyah yogyakarta) pengaruh kepemimpinan transformasional organizational citizenship behavior kecerdasan emosional sebagai variabel pemediasi (studi karyawan pt widya duta grafika) pengaruh kepemimpinan transformasional kinerja karyawan kepercayaan pemimpin sebagai variabel pemediasi (studi pt jamu air mancur palur karanganyar) pengaruh kepemimpinan transformasional kinerja karyawan kepercayaan pemimpin sebagai variabel pemoderasi (rumah sakit umum nirmala suri sukoharjo) pengaruh kepemimpinan transformasional komitmen organisasi kepercayaan sebagai variabel pemediasi pengaruh kepemimpinan komitmen organisasi motivasi kinerja karyawan lingkungan dinas perindustrian perdagangan kota surakarta pengaruh kepemimpinan komunikasi lingkungan fisik kinerja pegawai kantor dinas pendidikan kabupaten pekalongan pengaruh kepemimpinan komunikasi pendidikan kinerja karyawan kantor pos surakarta pengaruh kepercayaan konsumen atas mereik hubungannya loyalotas (studi konsumen sepeda motor merek honda kecamatan jebres surakarta) pengaruh kepercayaan loyalitas pendengar program radio (studi program konsultasi penyakit dalam) pengaruh kepercayaan loyalitas pendengar radio surakarta (studi program kesehatan bincang kesehatan solopos fm) pengaruh kepesertaan jpkm kelengkapan penggunaan pelayanan antenatal kabupaten purbalingga pengaruh kepramukaan bimbingan orang tua kepribadian siswa kelas i smk negeri 3 surakarta tahun ajaran 2005/2006 pengaruh kepramukaan bimbingan orang tua kepribadian siswa kelas i smk negeri 3 surakarta tahun ajaran 2005/2006 pengaruh kepribadian mampu bersepakat (agreebleness) kepribadian berhati-hati (concenstiousness) kepribadian ekstraversi (extravertion) kinerja motivasi sebagai variabel pemediasi (studi pegawai kantor sekretariat daerah surakarta) pengaruh kepribadian proaktif kesuksesan karir faktor demografi human capital sebagai variabel control (studi dosen fakultas ekonomi sebelas maret) pengaruh kepribadian work family conflict perawat rumah sakit islam surakarta pengaruh kepuasaan gaji kepuasaan kerja komitmen organisasi turnover intention (penelitian karyawan bagian produksi pt pabelan cerdas nusantara surakarta) pengaruh kepuasaan gaji kepuasan kerja komitmen organisasional turnover intention (studi karyawan bagian produksi pt kusumahadi santosa karanganyar) pengaruh kepuasaan kerja komitmen organisasional keinginan pindah pt asia marko surakarta pengaruh kepuasaan kerja organizational citizenship behavior karyawan bagian produksi pt sari warna asli pengaruh kepuasan kepercayaan loyalita konsumen switching cost sebagai variabel moderasi (pengguna kartu gsm im3 dari pt indosat wilayah surakarta) pengaruh kepuasan kerja komitmen organisasional usia masa kerja sebagai variabel pemoderasi (studi smk kristen 2 surakarta) pengaruh kepuasan konsumen trust switching barriers customer retention (mahasiswa universitas sebelas maret surakarta pengguna kartu telepon prabayar im3) pengaruh kepuasan pelanggan citra perusahaan komitmen pelanggan loyalitas pelanggan bisnis jasa warung internet (warnet surakarta) pengaruh kesadaran etis profesionalisme akuntan publik kode etik ikatan akuntan indonesia (studi kantor akuntan publik surakarta diy) pengaruh kesadaran etis profesionalisme akuntan publik kode etik ikatan akuntan indonesia (studi kantor akuntan publik surakarta) pengaruh keselamatan kerja kesehatan kerja produktivitas pt indatex kabupaten karanganyar tahun 2008 pengaruh kesesuaian antropometri tempat kerja komputer kelelahan fisik siswi sd alfirdaus surakarta pengaruh kesipan belajarpola asuh orang tua gaya belajar matematika prestasi belajar matematika siswa kelas iii semester i smp negeri 1 banjarnegara ajaran 2005/2006 pengaruh kesulitan manfaat akuntansi akrual pemilihan akuntansi akrual pelaporan keuangan daerah oleh pegawai bagian keuangan skpd pemerintah kabupaten sleman pengaruh keterampilan penalaran keterampilan menulis ditinjau dari status sosial ekonomi orang tua (studi ex post facto smp negeri 1 2 slogohimo) pengaruh ketidakadilan hubungan kerja feelings of resentment komitmen organisasi absenteeism turnover intention (studi pt intan pariwara klaten) pengaruh ketidakpastian lingkungan cohesiveness budgetary slack pengaruh ketidakpuasan konsumen iklan keputusan perpindahan merek minuman suplemen tubuh dimoderasi oleh kebutuhan mencari variasi (studi mahasiswa fakultas ekonomi uns surakarta) pengaruh ketinggian tunggak padi (oryza sativa l) dosis herbisida glifosat pertumbuhan hasil kedelai (glycine max [l] merrill) pengaruh ketinggian tunggak padi (oryza sativa l) saat aplikasi herbisida glifosat pertumbuhan hasil kedelai (glycine max (l) merrill) pengaruh ketrampilan kedisiplinan kerja produktivitas kerja karyawan ud ambar jati klaten pengaruh ketrampilan hitung prestasi belajar matematika siswa ditinjau dari interaksi edukatif siswa kelas xi sma muhammadiyah 1 karanganyar pengaruh kinerja keuangan kredit bermasalah tingkat perkembangan usaha pd bpr-bkk sawangan kabupaten magelang pengaruh kinerja keuangan perusahaan tingkat kemahalan harga saham stock split pengaruh kinerja keuangan perubahan harga saham memperhatikan ukuran perusahaan pengaruh kinerja keuangan return saham perusahaan manufaktur terdaftar bei pengaruh kinerja pegawai kualitas pelayanan tingkat kepuasan wajib pajak samsat kabupaten karanganyar periode 15 – 20 mei 2008 pengaruh kinerja perbankan diukur rasio camel pertumbuhan profit industri perbankan indonesia pengaruh kinerja perusahaan perubahan harga saham perusahaan manufaktur terdaftar bej (pengujian perusahaan besar kecil total asset) pengaruh kinerja sosial perusahaan kepemilikan institusional ukuran resiko bisnis aktivitas penelitian pengembangan perusahaan sebagai variabel moderating pengaruh kinerja sosial perusahaan kinerja keuanganukuran risiko bisnis aktivitas penelitian pengembangan perusahaan sebagai variabel moderating (perusahaan-perusahaan indonesia) pengaruh kinerja sosial perusahaan kinerja keuanganukuran risiko bisnis aktivitas penelitian pengembangan perusahaan sebagai variabel moderating (perusahaan-perusahaan indonesia) pengaruh kombinasi latihan kemampuan groundstroke forehand tenis lapangan (eksperimen kombinasi latihan volley-groundstroke half volley-groundstroke forehand mahasiswa putra penkepor angkatan 2006 jpokfkip uns tahun 2008) pengaruh komitmen organisasi kepuasan kerja keinginan berpindah kerja (studi empiris kantor akuntan publik wilayah surakarta diy) pengaruh komitmen organisasi kepuasan kerja tingkat turnover intention pengaruh komitmen organisasi kinerja karyawan etika kerja islami sebagai variabel moderator (studi karyawan cv arafah group sukoharjo) pengaruh komitmen organisasi intensi keluar karyawan pt sari warna asli industri iv karanganyar pengaruh komitmen organisasional komitmen profesional self efficacy kepuasaan kerja akuntan pendidikan (studi empiris perguruan tinggi surakarta) pengaruh kompensasi lingkungan kerja prestasi kerja karyawan pt kertas blabak magelang pengaruh kompensasi kas kepemilikan saham manajer performance perusahaan melakukan akuisisi pengaruh kompetensi motivasi kerja kinerja pegawai pdam surakarta pengaruh kompetensi motivasi pembimbing klinik kinerja pembimbing praktek klinik rsud kabupaten sragen pengaruh kompetensi guru minat belajar prestasi belajar siswa mata diklat surat menyurat indonesia siswa kelas ii program keahlian sekretaris smk negeri 6 surakarta tahun pelajaran 2003/2004 pengaruh kompetensi utama kecerdasan emosional efikasi diri kenyamanan manajer melakukan penilaian kinerja karyawan (bank rakyat indonesia kabupaten sragen) pengaruh kompetensi utama kecerdasan emosional self-efficacy kenyamanan supervisor melakukan penilaian kinerja (studi ptbank negara indonesia persero tbk kantor cabang karesidenan surakarta pengaruh komponen–komponen end-user satisfaction pembentukan kepuasan pemakai sistem informasi berbasis komputer pt pln (persero) p3b region jawa tengah diy pengaruh komposisi media lama waktu ekstrak pupuk kasting pertumbuhan hasil tanaman pakchoi (brassica chinensis l) secara hidroponik pengaruh komposisi media macam zat pengatur tumbuh pertumbuhan tanaman anthurium hookeri pengaruh komposisi nutrisi debit aliran pertumbuhan hasil tanaman sawi (brassica juncea l) secara hidroponik nft pengaruh komposisi nutrisi macam media pertumbuhan hasil tanaman sawi (brassica juncea l) menggunakan sistem nft pengaruh komunikasi administrasi pengalaman kerja prestasi kerja karyawan bagian administrasi pt widya duta surakarta tahun 2006 pengaruh komunikasi kantor semangat kerja efektivitas kerja pegawai kantor pelayanan pajak klaten tahun 2006 pengaruh komunikasi matematika motivasi berprestasi hasil belajar matematika siswa sma negeri wilayah tengah kabupaten grobogan tahun pelajaran 2009/2010 pengaruh kondisi iklim mikro rumah kaca evapotranspirasi hasil beberapa varietas tanaman tomat (lycopersicum esculentum mill) pengaruh kondisi internal usahan tani tunggakan kredit usaha tani (kut) kabupaten purworejo tahun 2003 pengaruh kondisi pekerjaan konsep profesionalisme diri kepuasan kerja studi profesi okupasi terapis jakarta (suatu studi replikasi) pengaruh kondisi pekerjaan konsep profesionalisme diri kepuasan kerja studi profesi okupasi terapis jakarta (suatu studi replikasi) pengaruh kondisi sosial ekonomi minat konsumen menggunakan jasa asuransi jiwa ajb bumiputera 1912 solo jebres tahun 2006 pengaruh konfigurasi kabel desain dek jembatan cable stayed pengaruh konflik stres kepuasan kerja karyawan pt bank rakyat indonesia cabang kebumen pengaruh konflik emosi tanggung jawab menyelesaikan tugas prestasi belajar menggambar teknik siswa kelas ii smk negeri 5 surakarta tahun pelajaran 2006/2007 pengaruh konflik partai persatuan pembangunan (ppp) partai kebangkitan bangsa (pkb) hubungan masyarakat desa kertijayan kecamatan bauran kabupaten pekalongan masa pemilu 1999 pengaruh konflik pekerjaan keluarga kepuasaan kerja kepuasaan keluarga dukungan sosial sebagai variabel moderator (study karyawan industri perbankan surakarta) pengaruh konflik peran stress kerja keinginan berpindah komitmen organisasi sebagai variabel intervening (studi akuntan publik joglosemar) pengaruh konseling tingkat kecemasan pasien seksio sesarea rsu pku muhammadiyah delanggu klaten pengaruh konsentrasi energi protein ransum berbeda karakteristik karkas itik turi umur dua bulan pengaruh konsentrasi auksin (iaa) giberelin (ga3) pertumbuhan awal anthurium gelombang cinta (anthurium plowmanii) pengaruh konsentrasi bap macam media pertumbuhan awal anthurium hookeri pengaruh konsentrasi cadmium tanah inceptisol vertisol kandungan cadmium beras (oryza sativa) pengaruh konsentrasi cadmium tanah inceptisol vertisol kandungan cadmium beras (oryza sativa) pengaruh konsentrasi aliran larutan natrium klorida laju korosi baja karbon medium hq 760 pengaruh konsentrasi bap multiplikasi tunas bawang merah (allium ascalonicum l) secara vitro pengaruh konsentrasi waktu pemberian gibberellin (ga3) pertumbuhan hasil tanaman melon (cucumis melo l) sistem tanam hidroponik irigasi tetes pengaruh konsentrasi iaa ba pertumbuhan eksplan bawang merah (allium ascalonicum l) secara in vitro pengaruh konsentrasi iaa bap medium ms tingkat multiplikasi tunas bawang putih (allium sativum l) secara in vitro pengaruh konsentrasi iaa kinetin tingkat multiplikasi tunas pisang (musa paradisiaca l) varietas raja batang secara in vitro pengaruh konsentrasi inhibitor asam askorbat (vitamin c) larutan natrium klorida (nacl) laju korosi baja hq 7210 pasca pelapisan chrom pengaruh konsentrasi inhibitor asam askorbat (vitamin c) larutan natrium klorida (nacl) laju korosi baja hq 7210 pasca pelapisan chrom pengaruh konsentrasi naa ba medium ms tingkat multiplikasi bawang putih (allium sativum l) secara in vitro pengaruh konsentrasi naa bap multiplikasi tunas pisang (musa paradisiaca l) varietas raja batang secara in vitro pengaruh konsentrasi paklobutrazol bap pembentukan umbi mikro kentang secara in vitro pengaruh konsentrasi sitokinin takaran pupuk organik pertumbuhan hasil pule pandak (rauvolfia serpentina (l) benth ex kurz) pengaruh konsep diri kemandirian prestasi belajar histologi mahasiswa fakultas kedokteran uki jakarta pengaruh konsep pemikiran politik soekarno tentang demokrasi terpimpin timbulnya konflik antar kelompok kepentingan tahun 1957-1960 pengaruh kontrasepsi kombinasi estrogen progesteron peningkatan tekanan darah pengaruh kortikosteroid dosis rendah hitung limfosit darah tepi mencit balb/c model sepsis paparan lipopolisakarida pengaruh kosentrasi ancymidol benzi ladenin pertumbuhan umbi mikro kentang (solanum tuberosum l) secara in vitro pengaruh kreatifitas belajar minat belajar prestasi belajar kompetensi bekerja sama kolega pelanggan siswa tahun i smk negeri 1 surakarta tahun pelajaran 2005/2006 pengaruh kreatifitas minat pemilihan program studi teknik sipil/ bangunan jiwa wirausaha mahasiswa pendidikan teknik sipil/ bangunan universitas sebelas maret tahun akademik 2006/2007 pengaruh kreatifitas siswa prestasi belajar mata diklat produktif minat berwiraswasta pengaruh kreatifitas siswa prestasi belajar mata diklat produktif minat berwiraswasta siswa kelas ii rumpun otomotif smk negeri 2 surakarta pengaruh kreativitas belajar lingkungan belajar siswa prestasi belajar siswa kelas i jurusan administrasi perkantoran smk batik i surakarta tahun ajaran 2006 2007 pengaruh kreativitas iklan mie sedaap loyalitas konsumen (studi konsumen program pendidikan ekonomi angkatan 2005-2006 fkip uns) pengaruh kredibilitas model iklan kredibilitas perusahaan minat pembelian pendekatan dual credibility model (penelitian survei iklan televisi shampoo pantene kota sragen) pengaruh krisis malaise pabrik gula kabupaten klaten sampai tahun 1942 pengaruh kualitas air kelancaran pengaliran air pelayanan administratif perusahaan kepuasan pelanggan pdam tirta dharma wilayah karanganyar pengaruh kualitas audit likuiditas profitabilitas auditor changes opini audit going concern perusahaan manufaktur non manufaktur bursa efek indonesia tahun 2007 pengaruh kualitas informasi dukungan manajemen puncak keterlibatan pengguna kinerja sia user ais satisfaction user ais use (survey beberapa bpkd) pengaruh kualitas jasa pelayanan kepuasaan konsumen pt telkom surakarta pengaruh kualitas jasa sistem informasi kepuasaan perilaku para pemakai pengembangan sistem informasi pengaruh kualitas jasa sistem kepuasan pemakai sistem informasi akademik fak ekonomi universitas sebelas maret surakarta pengaruh kualitas jasa terdahap kepuasan nasabah bank jateng cabang karanganyar pengaruh kualitas jasa kepuasan nasabah pengaruh kualitas jasa kepuasan pelanggan wedding organizer yogyakarta pengaruh kualitas jasa kepuasan pelanggan komitmen pelanggan loyalitas pelanggan bisnis retail pengaruh kualitas laba cost of equity capital informasi asimetri sebagai variabel intervening (studi empiris industri manufaktur terdaftar bei menggunakan path analysis) pengaruh kualitas layanan kepuasan konsumen warung internet sentra sarana internet surakarta pengaruh kualitas layanan kesetiaan pelanggan jasa transportasi darat (bus) pt tunggal dara indonesia kabupaten wonogiri tahun 2006 pengaruh kualitas pelayanan bank bri unit kota yogyakarta loyalitas konsumen (dengan variabel pemediasi kepuasan konsumen citra korporasi) pengaruh kualitas pelayanan jasa rumah sakit nur rohmah yogyakarta tingkat kepuasan pasien pengaruh kualitas pelayanan loyalitas dimediasi oleh persepsi nilai kepercayaan kepuasan (studi toko merah putih surakarta) pengaruh kualitas pelayanan pdam kepuasan pelanggan lingkungan masyarakat kota madiun pengaruh kualitas pelayanan program khusus sekolah dasar kepuasan orang tua/wali murid sekolah dasar unggulan yogyakarta pengaruh kualitas pelayanan kepuasan konsumen po ismo jurusan wonogiri – solo tahun 2007 pengaruh kualitas pelayanan kepuasan pelanggan perusahaan daerah badan perkreditan rakyat badan kredit kecamatan gondangrejo kabupaten karanganyar pengaruh kualitas pelayanan minat beli kembali konsumen (konsumen perusahaan jasa servis daihatsu astra international surakarta) pengaruh kualitas produk kualitas pelayanan barista kepuasan konsumen kedai kopi espresso bar solo tahun 2008 pengaruh kualitas produk telepon seluler siemens kepuasan pelanggan kabupaten boyolali sekitarnya (kawasan kota boyolali sekitarnya) pengaruh kualitas produk kepuasan pelanggan komitmen pelanggan loyalitas pelanggan (customer koran joglosemar surakarta) pengaruh kualitas produk kepuasan pelanggan komitmen pelanggan loyalitas pelanggan (customer koran joglosemar surakarta) pengaruh kualitas sumber daya manusia pdrb indonesia tahun 2003 pengaruh kualitas surat kabar kepuasaan konsumen (studi surat kabar solopos surakarta) pengaruh kualitas telepon seluler kepuasan konsumen telepon seluler merk siemens (studi kota surakarta) pengaruh lama paparan gas buang diesel berbahan bakar solar gangguan obstruksi paru karyawan po rosalia indah palur karanganyar pengaruh latihan double leg speed hops latihan squat peningkatan power otot tungkai atlit tae kwon do yunior putra dragon solo tahun 2007 pengaruh latihan double leg speed hops latihan squat peningkatan power otot tungkai atlit tae kwon do yunior putra dragon solo tahun 2007 pengaruh latihan hollow sprint kekuatan otot tungkai kecepatan lari 100 meter siswa putra smp islam al - hadi mojolaban tahun pelajaran 2008 2009 (eksperimen siswa putra smp islam al – hadi mojolaban tahun pelajaran 2008 2009) pengaruh letak pemasangan jumlah sudu swirling vane kadar karbon monoksida (co) gas buang mobil kijang tahun 2000 pengaruh letak pemasangan jumlah sudu swirling vane konsumsi bahan bakar sepeda motor suzuki shogun tahun 2003 pengaruh level energi protein ransum berbeda performan itik turi pengaruh level pemberian campuran pakan broiler starter dedak halus persentase karkas non karkas itik manila (cairina moschata) betina pengaruh level protein ransum disuplementasi probiotik kualitas telur ayam petelur pengaruh level wheat pollard level probiotik ransum berat karkas non karkas kimia daging ayam broiler pengaruh leverage manajemen laba variabel pemoderasi arus kas bebas perusahaan manufaktur publik terdaftar bursa efek indonesia pengaruh likuiditas struktur modal profitabilitas rasio saham publik tipe kepemilikan perusahaan pengungkapan sukarela laporan tahunan (studi perusahaan manufaktur terdaftar bei tahun 2007) pengaruh limbah cair industri alkohol bekonang produktivitas tanaman padi (oryza sativa l) pengaruh lingkungan kerja motivasi kerja produktivitas kerja karyawan housekeeping hotel quality solo pengaruh lingkungan kerja fisik pengawasan efektivitas kerja pegawai dinas pekerjaan umum lalu lintas angkutan jalan kab karanganyar tahun 2006 pengaruh lingkungan kerja fisik pengawasan efektivitas kerja pegawai dinas pekerjaan umum lalu lintas angkutan jalan kab karanganyar tahun 2006 pengaruh lingkungan komputerisasi praktek organisasi karakteristik pekerjaan kepuasan kerja gender sebagai variabel moderasi (studi pt pupuk kaltim-bontang) pengaruh lingkungan penguasaan kosakata bahasa indonesia anak-anak taman kanak-kanak kridowita klaten pengaruh locus of control need for achievement kepuasaan kerja kepemimpinan transformasional sebagai variabel pemoderasi pengaruh logoterapi hipertensi pasien lanjut usia pengaruh macam dosis lama waktu ekstrak pupuk kasting pertumbuhan hasil tanaman pakchoi (brasicca chinensis l) secara hidroponik pengaruh macam komposisi nutrisi pemberian buah pisang pertumbuhan plantlet anggrek dendrobium sp secara in vitro pengaruh macam media debit aliran pertumbuhan hasil tanaman sawi (brassica juncea l) secara hidroponik nft pengaruh macam media dosis pupuk kasting pertumbuhan hasil tanaman pakchoi (brassica chinensis l) secara hidroponik pengaruh macam media intensitas pemupukan pertumbuhan bibit tanaman anthurium gelombang cinta (anthurium plowmanii) pengaruh macam media konsentrasi iaa pertumbuhan setek adenium (adenium obesum) pengaruh macam media spesies tanaman pertumbuhan tanaman lidah mertua (sansevieria thunb) secara in vitro pengaruh macam media tanam pemberian air leri pertumbuhan hasil jamur tiram (pleurotus floridae [jacq ex fr] kummer) pengaruh macam persilangan hasil kemampuan silang buah naga jenis merah (hylocereus polyrhizus) pengaruh managerial ownership intellectual capital disclosurepada perusahaan asuransi syariah asia pengaruh managerial ownership institutional ownership growth debt ratio perusahaan jasa bej tahun 2000-2002 pengaruh manual flame hardening baja tempa pengaruh marketing mix keputusan konsumen membeli produk handycraft (pt suwastama solo) pengaruh marketing mix keputusan pembelian toserba swalayan mitra palur pengaruh marketing mix volume penjualan pt cokro super tirta klaten pengaruh masa trotzalter status gizi balita posyandu miren desa sidoharjo wilayah kerja puskesmas tanjunganom kabupaten nganjuk jawa timur pengaruh mata diklat kewirausahaan pelaksanaan pendidikan sistem ganda sikap berwirausaha siswa kelas 3 program keahlian tata boga smk negeri 4 surakarta tahun diklat 2005-2006 pengaruh medan elektromagnet frekuensi extrem rendah kadar high density lipoprotein-colesterol (hdl-c) kolesterol tikus putih (rattus norvegicus) pengaruh media cd komputer interaktif hasil belajar mata pelajaran fisika ditinjau dari minat belajar fisika (studi eksperimen siswa kelas x sma negeri 2 sma negeri 1 ngawi) pengaruh media cerita kata bergambar peningkatan penguasaan kosakata pandang siswa berkesulitan belajar membaca kelas ii sd negeri ponowaren 03 tahun ajaran 2008/2009 pengaruh media motivasi prestasi belajar mata pelajaran kebutuhan dasar manusia pengaruh media gambar verbalis kemampuan menulis ditinjau dari kemandirian belajar siswa kelas ii sekolah dasar negeri gugus sudirman kecamatan girimarto kabupaten wonogiri tahun 2009 alasan-alasan mempengaruhi konsumen melakukan pembelian warung makan es masuk pabelan surakarta alasan-alasan mempengaruhi konsumen melakukan pembelian warung makan es masuk pabelan surakarta analis faktor-faktor mempengaruhi kesetiaan konsumen merek rokok djarum super (mahasiswa universitas sebelas maret surakarta) analisa pengaruh faktor kepuasan kerja faktor komitmen organisasional intensi turnover divisi garment pt danliris kabupaten sukoharjo analisa pengaruh kepemilikan manajerial kepemilikan institusional kebijakan dividen kebijakan hutang analisis beberapa faktor mempengaruhi kepuasan konsumen pemakai jasa warnet (studi warnet net pluzz solo) analisis pengaruh bauran promosi volume penjualan perusahaan penerbit percetakan cv mutiara solo analisis pengaruh pelayanan tempat harga promosi kepuasan pasien rumah sakit umum brayat minulya (pasien rawat inap rsu brayat minulya) analisis beberapa faktor keahlian independensi auditor mempengaruhi kualitas audit analisis beberapa faktor mempengaruhi kepuasan konsumen pemakai jasa warnet (studi warnet nebula jaten karanganyar) analisis beberapa faktor mempengaruhi loyalitas konsumen produk rokok djarum super (study kecamatan pasar kliwon surakarta) analisis beberapa faktor mempengaruhi pelaksanaan perbaikan kualitas pelayanan berkesinambungan bagian rawat inap rumah sakit ortopedi prof dr r soeharso solo analisis beberapa variabel mempengaruhi keberhasilan pengusaha kecil brem madiun analisis beberapa variabel mempengaruhi price earning ratio perusahaan perbankan terdaftar bursa efek jakarta analisis deskriptif pengaruh pemberlakuan uu no 38 tahun 1999 pelaporan keuangan lembaga pengelola zakat (lembaga amil zakat yayasan solo peduli) analisis dimensi-dimensi motivasi kerja pengaruhnya kinerja pegawai fungsional dkkbc kabupaten sukoharjo tingkat pendidikan sebagai variabel pemoderasi analisis disparitas pendapatan kabupaten/kota pengaruhnya pdrb subosukawonosraten tahun 2000-2007 analisis faktor satisfaction habitual behavion commitment liking of the brand mempengaruhi brand loyalty konsumen rokok djarum super(survey wilayah kotamadya surakarta) analisis faktor berpengaruh regresi logistik polytomous metode best subset (pendapatan rata-rata keluarga masyarakat kota surakarta) analisis faktor mempengaruhi jam kerja para pekerja propinsi jawa tengah 2003 (analisis data sakernas 2003) analisis faktor mempengaruhi komitmen kerja karyawan pt solo fine furniture analisis faktor mempengaruhi pendapatan pekerja usaha kerajinan genteng kabupaten sukoharjo analisis faktor mempengaruhi permintaan konsumen mengambil kredit sepeda motor kecamatan jaten analisis faktor mempengaruhi tarif iklan radio swasta kota jogja solo (berbagai radio siaran swasta nasional kota jogja solo) analisis faktor – faktor mempengaruhi initial return setelah ipo bursa efek indonesia analisis faktor – faktor mempengaruhi keputusan menabung perbankan syariah (studi mahasiswa fakultas ekonomi universitas sebelas maret surakarta) analisis faktor – faktor mempengaruhi laju inflasi sebagai sasaran akhir kebijakan moneter indonesia setelah masa krisis 1997 analisis faktor – faktor mempengaruhi pendapatan pengusaha industri mebel surakarta analisis faktor-faktor mempengaruhi pendapatan pengusaha mebel desa serenan kecamatan juwiring analisis faktor-faktor bauran pemasaran mempengaruhi keputusan konsumen memilih perguruan tinggi swasta (mahasiswa balikpapan kuliah yogyakarta) analisis faktor-faktor fundamental mempengaruhi beta saham perusahaan manufaktur bursa efek jakarta periode 2002-2004 analisis faktor-faktor fundamental mempengaruhi risiko sistematik sebelum selama krisis moneter analisis faktor-faktor individu mempengaruhi perilaku karyawan berkomunikasi pt manunggal adipura surakarta analisis faktor-faktor loyalitas mempengaruhi retailer menyediakan menjual merek tertentu pasar legi solo (studi produk fast moving consumer goods) analisis faktor-faktor sosial ekonomi mempengaruhi fertilitas kecamatan polokarto kabupaten sukoharjo analisis faktor-faktor sosial ekonomi mempengaruhi penetapan tingkat upah provinsi jawa barat 2003 (analisis data sekernas 2003) analisis faktor-faktor sosial ekonomi mempengaruhi tingkat upah buruh batik kampung batik laweyan analisis faktor-faktor berpengaruh kepuasan kerja karyawan pt bank rakyat indonesia cabang slamet riyadi solo analisis faktor-faktor berpengaruh jumlah uang beredar indonesia periode 1996 1 2005 4 analisis faktor-faktor berpengaruh kapasitas fiskal daerah (tiga puluh provinsi indonesia periode 2001-2005) analisis faktor-faktor berpengaruh kinerja karyawan perusahaan daerah air minum kabupaten sukoharjo variabel pemoderasi kebutuhan berprestasi analisis faktor-faktor berpengaruh perilaku pembelian mobil bekas dealer kotamadya surakarta analisis faktor-faktor mempengaruhi kepatuhan karyawan perusahaan kewajiban memiliki npwp wilayah kpp pratama sukoharjo analisis faktor-faktor mempengaruhi keputusan pembelian minuman air mineral aqua (mahasiswa universitas sebelas maret surakarta) analisis faktor-faktor mempengaruhi tingkat pendapatan pedagang kaki lima kota surakarta tahun 2005 analisis faktor-faktor mempengaruhi brand loyalty merek produk peralatan makan ditingkat pedagang (pedagang peralatan makan sragen) analisis faktor-faktor mempengaruhi ekspor non migas indonesia ke jepang tahun 1980-2005 analisis faktor-faktor mempengaruhi ekspor pakaian jadi indonesia ke amerika serikat tahun 1978-2003 analisis faktor-faktor mempengaruhi evaluasi konsumen produk brand extension analisis faktor-faktor mempengaruhi frekuensi pembelian makanan oleh konsumen pedagang kaki lima solo baru (jalan raya solo baru) analisis faktor-faktor mempengaruhi hasil produksi industri pande besi kabupaten klaten analisis faktor-faktor mempengaruhi impor gula propinsi jawa tengah periode 1984-2003 analisis faktor-faktor mempengaruhi inflansi indonesia periode 1984-2002 4 analisis faktor-faktor mempengaruhi investasi penanaman modal negeri propinsi diy (periode 1983 s/d 2002) analisis faktor-faktor mempengaruhi investasi sektor properti kota surakarta tahun 2000 - 2007 analisis faktor-faktor mempengaruhi jumlah pemberian kredit usaha kecil (pt bank mandiri persero cabang solo sriwedari) analisis faktor-faktor mempengaruhi keberhasilan penerapan software enterprise resource planning (erp) (penerapan system application and product in data processing pt gmf aero asia jakarta) analisis faktor-faktor mempengaruhi keberhasilan usaha jasa letter kalilarangan surakarta tahun 2006 analisis faktor-faktor mempengaruhi keberhasilan usaha pedagang kaki lima pasar klewer tahun 2009 analisis faktor-faktor mempengaruhi keberhasilan usaha pedagang pasar analisis faktor-faktor mempengaruhi keberhasilan usaha pedagang pasar (pedagang pasar gede surakarta) analisis faktor-faktor mempengaruhi keberhasilan usaha pedagang pasar klewer surakarta analisis faktor-faktor mempengaruhi kepekaan pembeli harga toko garuda tiga wonogiri analisis faktor-faktor mempengaruhi kepuasaan konsumen menggunakan air perusahaan daerah air minum kabupaten boyolali analisis faktor-faktor mempengaruhi keputusan konsumen melakukan pembelian minimarket as gross ar royyan ngoresan jebres surakarta analisis faktor-faktor mempengaruhi keputusan konsumen melakukan pembelian minimarket as gross ar royyan ngoresan jebres surakarta analisis faktor-faktor mempengaruhi keputusan konsumen melakukan pembelian toko sports station malioboro mall yogyakarta analisis faktor-faktor mempengaruhi keputusan konsumen pembelian kartu perdana im3 (survei mahasiswa universitas sebelas maret) analisis faktor-faktor mempengaruhi keputusan konsumen membeli handphone nokia bekas (studi mahasiswa fakultas ekonomi uns surakarta analisis faktor-faktor mempengaruhi keputusan konsumen membeli handphone nokia bekas (studi mahasiswa fakultas ekonomi uns surakarta analisis faktor-faktor mempengaruhi keputusan pembelian kartu simpati (mahasiswa fkip uns tahun 2006) analisis faktor-faktor mempengaruhi keputusan perpindahan merek mi instan (studi masyarakat pelanggan mi instan kabupaten boyolali) analisis faktor-faktor mempengaruhi keputusan perpindahan merk produk shampo (studi mahasiswa universitas sebelas maret surakarta) analisis faktor-faktor mempengaruhi kesetiaan konsumen merek rokok djarum super (mahasiswa universitas sebelas maret) analisis faktor-faktor mempengaruhi kesiapan kerja siswa smk ma’arif nu kesesi kabupaten pekalongan analisis faktor-faktor mempengaruhi ketidakaktifan suatu klaster industri (klaster industri batik kecamatan laweyan) analisis faktor-faktor mempengaruhi keuntungan industri batik kecamatan laweyan surakarta (kampung batik laweyan surakarta) analisis faktor-faktor mempengaruhi keuntungan koperasi pegawai negeri wilayah kabupaten demak tahun 2008 analisis faktor-faktor mempengaruhi keuntungan pedagang kaki lima kota surakarta analisis faktor-faktor mempengaruhi keuntungan pedagang makanan minuman gladag langen bogan surakarta analisis faktor-faktor mempengaruhi keuntungan pengusaha tahu tempe (kecamatan nguter kabupaten sukoharjo jawa tengah) analisis faktor-faktor mempengaruhi konservatisme akuntansi analisis faktor-faktor mempengaruhi konsumen evaluasi keputusan pembelian jasa akomodasi perhotelan hotel sahid kusuma raya solo analisis faktor-faktor mempengaruhi konsumen evaluasi keputusan pembelian jasa akomodasi perhotelan hotel sahid kusumaraya solo analisis faktor-faktor mempengaruhi konsumsi masyarakat provinsi jawa tengah tahun 2003 – 2007 (kota semarang solo purwokerto tegal) analisis faktor-faktor mempengaruhi konsumsi rumah tangga polisi (do korps brimob kelapa dua depok jawa barat) analisis faktor-faktor mempengaruhi konsumsi tenaga listrik oleh konsumen rumah tangga pln kabupaten klaten analisis faktor-faktor mempengaruhi migrasi internasional tenaga kerja indonesia ke luar negeri tahun 2007 (tenaga kerja indonesia asal kabupaten majalengka propinsi jawa barat) analisis faktor-faktor mempengaruhi nilai kredit pegawai berpenghasilan tetap (kretap) bri cabang klaten analisis faktor-faktor mempengaruhi pad kabupaten karanganyar periode 1990-2002 analisis faktor-faktor mempengaruhi pemungutan retibusi pasar pasar klaten analisis faktor-faktor mempengaruhi penanaman modal negeri propinsi jawa tengah tahun 1985-2003 analisis faktor-faktor mempengaruhi penawaran kredit umkm indonesia tahun 1992-2007 analisis faktor-faktor mempengaruhi penawaran rokok kretek indonesia 1990-2000 analisis faktor-faktor mempengaruhi pendapatan asli daerah kabupaten boyolali th 1992-2002 analisis faktor-faktor mempengaruhi pendapatan usaha pengrajin batu mulia kecamatan donorojo kabupaten pacitan analisis faktor-faktor mempengaruhi pengambilan kredit oleh masyarakat perum pegadaian (perum pegadaian cabang klaten) analisis faktor-faktor mempengaruhi pengambilan kredit usaha rakyat (kur) bri kanca unit makam haji analisis faktor-faktor mempengaruhi pengrajin mebel memilih broker sebagai saluran distribusi desa serenan kleten analisis faktor-faktor mempengaruhi penyaluran kredit perbankan bank umum indonesia periode 19941-20034 analisis faktor-faktor mempengaruhi penyerapan tenaga kerja sentra industri kecil telah dibina kabupaten sukoharjo analisis faktor-faktor mempengaruhi perilaku perpindahan merek penyedia jasa salon kecantikan surakarta (studi mahasiswi universitas sebelas maret) analisis faktor-faktor mempengaruhi permintaan air minum oleh pelanggan pdam kabupaten boyolali (konsumen rumah tangga pedesaan) analisis faktor-faktor mempengaruhi permintaan daging ayam kabupaten karanganyar analisis faktor-faktor mempengaruhi permintaan ikan segar jawa tengah oleh singapura (tahun 1987-2003) analisis faktor-faktor mempengaruhi permintaan impor barang konsumsi indonesia tahun 1990i-2003iv analisis faktor-faktor mempengaruhi permintaan konsumen mengambil kredit sepeda motor kecamatan masaran kabupaten sragen tahun 2009 analisis faktor-faktor mempengaruhi permintaan kredit umkm perbankan (umkm program kkb bni 46 cabang surakarta) analisis faktor-faktor mempengaruhi permintaan pembiayaan lembaga keuangan syariah (bmt safinah klaten) analisis faktor-faktor mempengaruhi pilihan karir mahasiswa akuntansi sebagai akuntan publik analisis faktor-faktor mempengaruhi pilihan masyarakat beransuransi ansuransi syariah analisis faktor-faktor mempengaruhi praktik perataan laba (income smoothing) perusahaan go public indonesia analisis faktor-faktor mempengaruhi produk domestik regional bruto (pdrb) kabupaten banyumas tahun 1992-2002 analisis faktor-faktor mempengaruhi sikap konsumen atribut produk sepatu bata (survei toko sepatu bata jl coyudan 104 surakarta) analisis faktor-faktor mempengaruhi sikap perlindungan keselamatan kesehatan kerja karyawan pt aneka tambang ubpe pongkor analisis faktor-faktor mempengaruhi sikap program perlindungan keselamatan kesehatan kerja karyawan bagian produksi pt adetex boyolali analisis faktor-faktor mempengaruhi sisa hasil usaha koperasi pegawai negeri kota surakarta tahun 2007 analisis faktor-faktor mempengaruhi siswa memilih lembaga pendidikan bahasa inggris lbpp-lia surakarta analisis faktor-faktor mempengaruhi struktur modal perusahaan manufaktur bursa efek indonesia analisis faktor-faktor mempengaruhi struktur modal perusahaan manufaktur bursa efek indonesia periode 2003 – 2007 analisis faktor-faktor mempengaruhi tabungan masyarakat bank umum indonesia sebelum sesudah krisis ekonomi tahun 1984-2002 analisis faktor-faktor mempengaruhi tindakan perataan laba perusahaan manufaktur terdaftar bursa efek indonesia analisis faktor-faktor mempengaruhi tingkat investasi sektor properti jawa tengah tahun 1982-2001 analisis faktor-faktor mempengaruhi tingkat keberhasilan pedagang handphone kota solo(pedagang handphone kota solo) analisis faktor-faktor mempengaruhi tingkat keberhasilan usaha pedagang handphone kota solo kasus pedagang handphone kota solo analisis faktor-faktor mempengaruhi tingkat kredit diambil oleh nasabah bkk kabupaten kebumen analisis faktor-faktor mempengaruhi tingkat kredit diambil oleh nasabah bkk kabupaten kebumen analisis faktor-faktor mempengaruhi tingkat pendapatan pengusaha industri kecil kripik tempe (kabupaten ngawi) analisis faktor-faktor mempengaruhi tingkat pertumbuhan usaha kecil menengah (ukm) (debitur bank bri surakarta sudirman) analisis faktor-faktor mempengaruhi underpricing initial public offering (ipo) indonesia (perusahaan terdaftar bej periode 1999-2003) analisis faktor-faktor mempengaruhi underpricing penawaran umum perdana (studi perusahaan terdaftar bursa efek indonesia periode 2003-2007) analisis faktor-faktor mempengaruhi underpricing saham initial return bursa efek jakarta (tahun 1999 – 2002) analisis faktor-faktor mempengaruhi underpricing saham initial return bursa efek jakarta (tahun 1999–2002) analisis faktor-faktor mempengaruhi usaha pemupukan dana kebutuhan finansial perkreditan kpri kabupaten cilacap tahun 2003-2004 analisis faktor–faktor mempengaruhi volume penjualan industri kecil genteng kecamatan jaten kabupaten karanganyar analisis faktor¬-faktor mempengaruhi pengambilan kredit koperasi unit desa (kud) kabupaten boyolali analisis hubungan pengaruh leverage dividen laba return saham (kajian empiris perusahaan go publik indonesia 1992-2002) analisis hubungan kinerja pemasaran proses pengembangan produk pengaruhnya kinerja perusahaan (studi perusahaan manufaktur terdaftar bej) analisis input-output mengenai pengaruh ekspor sektor industri nonmigas output total nilai tambah permintaan tenaga kerja indonesia tahun 1985-1995 analisis kinerja keuangan pengaruh kinerja keuangan perusahaan sektor aneka industri sektor real estate-property return saham bei 2004-2006 analisis kualitatif faktor-faktor berpengaruh perilaku seksual mahasiswa (suatu pendidikan tinggi jawa timur) analisis mengenai eksistensi pidana mati indonesia (suatu kajian dari pengaruh psikologis bagi masyarakat) analisis model epidemen influensa a pengaruh vaksinasi menggunakan metode simulasi analisis partisipasi pemakai pengaruh pemakai proses pengembangan kualitas sistem (studi industri perbankan wilayah surakarta) analisis pengaruh afeksi fairness diskonfirmasi kepuasan konsumen (studi pengguna jasa bpurosalia indah karanganyar) analisis pengaruh aksesbilitas biaya ke obyek wisata serta kualitas obyek wisata kepuasan pengunjung ekowisata air terjun grojogan sewu analisis pengaruh aksesibilitas biaya ke obyek wisata serta kualitas obyek wisata kepuasaan pengunjung ekowisata telaga sarangan analisis pengaruh atribut harapan konsumen restoran niat pembelian ulang restoran ayam bakar wong solo cabang solo analisis pengaruh atribut jasa kepuasaan konsumen akademi desain surakarta analisis pengaruh atribut produk evaluasi pembelian dari para pengguna new corolla altis kotamadya surakarta analisis pengaruh bauran pemasaran (marketing mix) strategi pemasaran kinerja perusahaan ekspor kota surakarta analisis pengaruh bauran pemasaran keputusan pemilihan perguruan tinggi swasta oleh calon mahasiswa kodya surakarta analisis pengaruh bauran pemasaran tingkat kepuasan sdit nur hidayah surakarta analisis pengaruh bauran promosi (promotional mix) volume penjualan pt batik keris surakarta analisis pengaruh bauran promosi volume penjualan tiket pt tunggal dara wonogiri analisis pengaruh biaya distribusi promosi volume penjualan pt tupai adyamas indonesia boyolali analisis pengaruh biaya distribusi nilai penjualan cv sahabat klaten tahun 2004 analisis pengaruh biaya distribusi nilai penjualan pt tempo cabang solo analisis pengaruh biaya distribusi volume penjualan pt mutu gading tekstil karanganyar analisis pengaruh biaya keagenan risiko peluang investasi hutang kebijakan dividen perusahaan bursa efek jakarta analisis pengaruh biaya pemasaran volume perusahaan air minum mineral pt tirta investama boyolali analisis pengaruh biaya pemasaran volume penjualan perusahaan roti tri putri analisis pengaruh biaya pengembangan produk tingkat penjualan kamar hotel agas internasional solo analisis pengaruh biaya promosi hasil penjualan buku-buku budaya jawa cv cendrawasih sukoharjo analisis pengaruh biaya promosi peningkatan volume penjualan perusahaan timbangan sss surakarta analisis pengaruh biaya promotional mix volume penjualan pt tiga serangkai pustaka mandiri surakarta analisis pengaruh brand equity keputusan pembelian ulang konsumen pasta gigi merek pepsodent analisis pengaruh brand loyalty pengguna handphone merek nokia i surakarta analisis pengaruh brand predictability brand liking brand competence brand reputation trust in the company brand loyalty dimediasikan oleh trust in a brand seped motor merk honda analisis pengaruh budaya perusahaan kinerja karyawan pt kusuma hadi santosa analisis pengaruh budaya perusahaan prestasi kerja karyawan cv mutiara solo surakarta analisis pengaruh capital adequacy ratio operating efficiency ratio return on equity loan to deposits ratio real return saham bursa efek jakarta (studi empiris perusahaan perbankan periode 1997-2001) analisis pengaruh citra produk kosmetik sariayu martha tilaar keputusan pembelian (studi mahasiswa fakultas ekonomi universitas sebelas maret surakarta) analisis pengaruh citra supermarket loyalitas konsumen toko mitra kartasura sukoharjo analisis pengaruh citra supermarket loyalitas konsumen toko mitra palur karanganyar analisis pengaruh citra swalayan keputusan pembelian matahari department-store surakarta analisis pengaruh citra toko buku gramedia surakarta loyalitas konsumen (studi pengunjung toko buku gramedia surakarta) analisis pengaruh cognitive positive emotions satisfaction loyalitas mahasiswa (studi mahasiswa fakultas psikologi universitas muhammadiyah surakarta angkatan 2006) analisis pengaruh cognitive satisfaction emotional satisfaction loyalitas mahasiswa menempuh studi fakultas ekonomi universitas sebelas maret surakarta analisis pengaruh corporate image loyalitas pelanggan apotek padma surakarta analisis pengaruh currant ratio debt to equity ratio total assets turnover return on equity dividend payout ratio price earning ratio perusahaan manufaktur bursa efek jakarta tahun 2000-2002 analisis pengaruh current ratio return on investment earning per share perubahan harga saham perusahaan manufaktur bursa efek indonesia analisis pengaruh customer satisfaction intention to stay with incumbent provider switching costs sebagai variabel pemoderasi konsumen operator telepon seluler (studi segmen remaja kota surakarta) analisis pengaruh dimensi gaya kepemimpinan transformasional komitmen organisasi (studi staf pengajar/dosen fakultas ekonomi universitas sebelas maret surakarta) analisis pengaruh dimensi kecerdasan emosional career decision making self-efficacy career commitment and exploration gender sebagai variabel pemoderasi (studi mahasiswa s1 reguler fe uns angkatan 2003) analisis pengaruh dimensi kepuasan kerja komitmen organisasional persepsi kepuasan upah diterima karyawan sebagi moderator analisis pengaruh dimensi kualitas pelayanan jasa kepuasaan masalah permata bank cabang surakarta analisis pengaruh dimensi kualitas pelayanan kepuasan total flasher karanganyar analisis pengaruh dimensi kualitas pelayanan kepuasan toko mall luwes palur karanganyar analisis pengaruh dimensi – dimensi citra supermarket keputusan pembelian konsumen supermarket happy land yogyakarta analisis pengaruh dimensi-dimensi karakteristik pekerjaan inti kepuasan kerja karyawan growth need strength (gns) sebagai variabel pemoderat (penelitian pegawai administratif tingkatan pelaksana rsup dr soeradji tirtonegoro klaten) analisis pengaruh display signage in store media perilaku pembelian konsumen goro assalam pabelan surakarta analisis pengaruh dividend payout ratio kepemilikan manajerial profitabilitas ukuran perusahaan keputusan pendanaan (perusahaan manufaktur terdaftar bursa efek indonesia) analisis pengaruh earning per share (eps) return on asset (roa) leverage ratio (lev) price earning ratio (per) firm size return saham perusahaan indeks lq 45 bej 2005 analisis pengaruh economic value added operating income net income return saham perusahaan manufaktur bursa efek jakarta analisis pengaruh ekuitas merek air minum berkarbonasi merek fanta keputusan pembelian (survei mahasiswa fakultas ekonomi universitas sebelas maret surakarta) analisis pengaruh ekuitas merek keputusan pembelian konsumen handphone nokia (survei mahasiswa fakultas ekonomi uns surakarta) analisis pengaruh ekuitas merek preferensi merek intensi pembelian (studi hotel galuh prambanan hotel prambanan indah) analisis pengaruh evektivitas cara belajar kinerja mahasiswa (survei mahasiswa fakultas ekonomi jurusan akuntansi uns) analisis pengaruh experience brand name word of mouth information brand commitment dimediasi oleh brand trust acara berita radio surakarta (acara berita info info rri pro i fm surakarta) analisis pengaruh faktor pendidikan pelatihan prestasi kerja pegawai negeri sipil kantor pertanahan kabupaten karanganyar analisis pengaruh faktor demografis organisasional kepuasan kerja (studi karyawan uns) analisis pengaruh faktor demografis kepuasan kerja karyawan rumah sakit ibu anak sarila husada sragen analisis pengaruh faktor kepemimpinan kondisi kerja stress kerja kinerja karyawan bagian produksi pt baja kurnia klaten analisis pengaruh faktor percieved quality fit difficulty evaluasi konsumen produk brand extension analisis pengaruh faktor produk yaitu model kecanggihan teknologi kualitas serta harga keputusan konsumen membeli handphone nokia (survei matahari singosaren plasa) analisis pengaruh faktor sosial kepuasan kerja karyawan bagian produksi unit spinning pt surakarta sentosa sejahtera analisis pengaruh faktor-faktor bauran pemasaran loyalitas konsumen produk kopi nescafe (survey wilayah kota surakarta jawa tengah) analisis pengaruh faktor-faktor kualitas jasa kepuasan nasabah pd bpr djoko tingkir kabupaten sragen analisis pengaruh faktor-faktor pembangun kepercayaan keinginan konsumen melakukan hubungan pemasaran jangka panjang (bpu rosalia indah surakarta) analisis pengaruh faktor-faktor penilaian kinerja pengembangan karir karyawan pt bank negara indonesia (persero) tbk surakarta analisis pengaruh faktor-faktor penilaian kinerja pengembangan karir karyawan pt indocement tunggal prakarsa tbk kalimantan selatan pengawasan diri (self monitoring) sebagai variabel moderasi analisis pengaruh faktor-faktor persepsi adopsi teknologi sistem akademik terkomputerisasi [ penggunaan student self access terminal (ssat) fakultas ekonomi universitas sebelas maret surakarta] analisis pengaruh financial leverage liquidity asset growth asset size beta saham perusahaan manufaktur bej (perbandingan periode sebelum selama krisis moneter) analisis pengaruh gaya kepemimpinan organizational citizenship behavior situasi sebagai variabel pemoderasi pt batik keris surakarta analisis pengaruh harga produk keragaman produk promosi pelayanan lingkungan fisik loyalitas konsumen (studi makro hypermarket surakarta) analisis pengaruh harga saham price earning ratio perusahaan manufaktur terdaftar bursa efek jakarta (studi empiris periode 1995-2001) analisis pengaruh harga biaya distribusi biaya promosi omzet penjualan berita harian suara merdeka wonogiri analisis pengaruh hari perdagangan fenomena january effect return saham bursa efek jakarta analisis pengaruh iklan humor brand-advertising recall produk bateri abc kotamadya surakarta analisis pengaruh iklan pond’s white beauty melalui media cetak atribut produk perilaku konsumen (study mahasiswa fkip pendidikan ekonomi uns surakarta angkatan 2003/2004) analisis pengaruh iklan produk asabun cair sunlight televisi keputusan pembelian analisis pengaruh individual benefitsocial benefitphysical benefiteducation benefitdan relaxing benefit keputusan konsumen berkunjung kembali ke taman satwa taru jurug analisis pengaruh inflasi suku bunga sbi kurs rupiah indeks harga saham gabungan bursa efek jakarta tahun 2001-2005 analisis pengaruh inflasi tingkat suku bunga sbi nilai tukar indeks saham sektor keuangan bursa efek jakarta analisis pengaruh integrasi supply chain performa perusahaan (perusahaan konveksi home industry kabupaten klaten) analisis pengaruh investment opportunity kebijakan pendanaan kebijakan dividen perusahaan manufaktur bursa efek jakarta analisis pengaruh january effect return saham perusahaan manufaktur go public listed bursa efek indonesia (studi empiris saham manufaktur periode 2003-2007) analisis pengaruh jumlah uang beredar tingkat inflasi tingkat suku bunga sbi tingkat suku bunga nominal deposito semester ii th 2001 s/d semester i th 2005 analisis pengaruh jumlah uang beredar tingkat suku bunga sbi tingkat inflasi nilai tukar rupiah dollar as besarnya tingkat suku bunga pasar uang antar bank (puab) tahun 1998-2002 analisis pengaruh karakteristik bintang idola iklan (celebrity endorser) minat beli konsumen multivitamin fatigon (studi mahasiswa fakultas ekonomi uns) analisis pengaruh karakteristik individu karakteristik organisasi pengembangan karir pegawai (kantor badan pengawas pasar modal lembaga keuangan departemen keuangan) analisis pengaruh kebijakan deviden free cash flow tingkat leverage perusahaan moderasi set kesempatan investasi (ios) struktur kepemilikan perusahaan analisis pengaruh kebijakan inflation targeting perekonomian indonesia tahun 2000-2006 analisis pengaruh kebijakan moneter aliran modal masuk indonesia periode 1990 1-2004 4 analisis pengaruh kebijakan moneter aliran modal masuk indonesia periode 1990 1-2004 4 analisis pengaruh kebijakan penggunaan media periklanan nilai penjualan produk dagadu djokdja analisis pengaruh kebisingan temperatur pencahayaan produktivitas kerja pengeleman amplop secara manual analisis pengaruh kepercayaan atas merek ekuitas merek (air minum kemasan merek aqua mahasiswa fakultas ekonomi universitas sebelas maret analisis pengaruh kepercayaan atas merek ekuitas merek (pasta gigi merek pepsodent mahasiswa fakultas ekonomi uns) analisis pengaruh kepercayaan konsumen loyalitas rokok merek la lights (survei konsumen la lights eks karesidenan surakarta) analisis pengaruh kepercayaan merek loyalitas merek konsumen air mineral merek aqua (mahasiswa fakultas ekonomi uns) analisis pengaruh kepercayaan perusahaan hubungan jangka panjang antara pengecer minuman merk sosro pt sinar sosro kota surakarta analisis pengaruh kepribadian kesukaan gaya manajerial partisipatif analisis pengaruh kepuasan kerja komitmen organisasi semangat kerja karyawan pt agung intra surakarta analisis pengaruh kepuasan kerja komitmen organisasi semangat kerja pegawai stasiun solo-balapan pt kereta api (persero) daerah operasi vi yogyakarta analisis pengaruh kepuasan pelanggan niat berperilaku tamu hotel cakra surakarta analisis pengaruh keseimbangan lini efisiensi proses produksi pt dzakya tirta utama karangpandan analisis pengaruh kesesuaian citra diri kesukaan merek kepuasan para pengguna sepeda motor merek honda (study mahasiswa fakultas ekonomi universitas sebelas maret surakarta) analisis pengaruh kesesuaian citra diri kesukaan merek kepuasan para pengguna sepeda motor merek yamaha analisis pengaruh ketidakamanan kerja kepuasan kerja variabel moderator umur lama bekerjapada karyawan bagian pemasaran pt batik danar hadi surakarta analisis pengaruh ketidakpuasan konsumen iklan komparatif kebutuhan mencari variasi keputusan perpindahan merk produk deodorant (mahasiswa s1 non reguler fakultas ekonomi universitas sebelas maret surakarta) analisis pengaruh ketrampilan interpersonal kedewasaan emosi gaya kewirausahaan manajer bank (study replikasi model necmi avkiran (2000) pt bank negara indonesia persero tbk kantor cabang surakarta) analisis pengaruh kinerja finansial firm size return saham perusahaan indeks lq-45 bursa efek jakarta tahun 2003-2005 analisis pengaruh kinerja finansial karakteristik perusahaan abnormal return saham perusahaan tercantum indeks lq 45 bej tahun 1999-2002 analisis pengaruh kinerja keuangan abnormal return saham perusahaan properti bursa efek jakarta periode 2000 – 2005 analisis pengaruh kinerja keuangan perubahan harga saham perusahaan manufaktur terdaftar bursa efek jakarta analisis pengaruh kinerja keuangan return saham perusahaan peserta non peserta corporate governance perception index (cgpi) analisis pengaruh kolom udara nilai koefisien serapan bunyi dinding partisi menggunakan metode tabung impedansi dua mikrofon analisis pengaruh komitmen organisasional kinerja perawat pavilliun cendana rumah sakit dr moewardi surakarta analisis pengaruh kompensasi kondisi kerja kinerja karyawan motivasi sebagai variabel pemoderasi (studi karyawan bagian produksi pt karga bayu persada sukoharjo) analisis pengaruh kompensasi konflik prestasi kerja karyawan bagian produksi pt jamu air mancur palur karanganyar analisis pengaruh kompensasi kunjungan tenaga penjual volume penjualan distributor pt unilever indonesia ud cahaya agung iii ungaran tahun 2002 analisis pengaruh kompensasi kinerja perawat rumah sakit yayasan islam surakarta analisis pengaruh kompetensi kecerdasan emosional kenyamanan supervisor melakukan penilaian kinerja persepsi sistem penilaian kinerja sebagai variabel moderator (studi pt bni se karesidenan surakarta) analisis pengaruh komponen pembentuk brand equity purchase intentions (studi rumah makan ayam bakar wong solo kota surakarta) analisis pengaruh konsumsi pemerintah ekspor tabungan domestik penanaman modal asing pertumbuhan ekonomi indonesia (tahun 1976-2007) analisis pengaruh kredit tingkat pendapatan pengusaha batik kecamatan laweyan kotamadya surakarta analisis pengaruh kualitas jasa layanan kredit sepeda motor honda kepuasan konsumen ptfif (federal international finance) cabang solo analisis pengaruh kualitas layanan konsumen loyalitas konsumen coca–cola analisis pengaruh kualitas layanan konsumen loyalitas merek coca cola (studi area pemasaran kota salatiga school channel) analisis pengaruh kualitas layanan loyalitas kepuasan konsumen sebagai variabel pemediasi (survei nasabah tabungan britama bri cabang klaten) analisis pengaruh kualitas pelayanan persepsi harga kesetiaan pelanggan kepuasan pelanggan sebagai variabel mediasi warung makan es masuk mojolaban analisis pengaruh kualitas pelayanan kepuasan debitur modal kerja kepercayaan sebagai variabel intervening pt bank central asia kantor cabang solo tbk analisis pengaruh kualitas pelayanan jasa simpan pinjam kepuasan nasabah baitul maal wat-tamwil tumang cepogo boyolali analisis pengaruh kualitas pelayanan jasa kepuasan nasabah koperasi asta dana jaya baki sukoharjo analisis pengaruh kualitas pelayanan jasa pasien rsud banyudono(boyolali) analisis pengaruh kualitas pelayanan jasa tingkat kepuasan nasabah pd bpr bkd kabupaten karanganyar analisis pengaruh kualitas pelayanan perusahaan kepuasan pelanggan analisis pengaruh kualitas pelayanan kepuasan konsumen matahari supermarket singosaren solo analisis pengaruh kualitas pelayanan kepuasan konsumen klinik pengobatan tradisional surakarta analisis pengaruh kualitas pelayanan kepuasan konsumen pt pos indonesia cabang surakarta analisis pengaruh kualitas pelayanan kepuasan pasien rawat inap rumah sakit umum pandan arang boyolali analisis pengaruh kualitas pelayanan kepuasan pasien rawat inap rumah sakit islam surakarta analisis pengaruh kualitas pelayanan kepuasan pasien rawat jalan rumah umum daerah karanganyar analisis pengaruh kualitas pelayanan kepuasan penumpang jasa transportasi ka sancaka jurusan yogyakarta-surabaya stasiun solo balapan analisis pengaruh kualitas pelayanan kepuasan tamu hotel raddin ancol jakarta analisis pengaruh kualitas pelayanan loyalitas konsumen pengguna jasa transportasi po rosalia indah surakarta analisis pengaruh kualitas pelayanan loyalitas konsumen restoran kepuasan konsumen sebagai variabel mediator (restoran ayam tim bu better dewi sri sukoharjo) analisis pengaruh kualitas pelayanan perilaku nasabah purna penggunaan jasa bank syariah mandiri cabang solo analisis pengaruh kualitas pelayanan tingkat kepuasan upaya membangun komunitas pengunjung agrowisata sondokoro karanganyar analisis pengaruh kualitas telepon seluler kepuasan konsumen merk nokia (survey kota surakarta) analisis pengaruh kwalitas pelayanan kepuasaan konsumen hotel sahid raya surakarta analisis pengaruh laba usaha pendapatan lain usia calon debitur jumlah kredit modal kerja sektor perdagangan diberikan pt bpr trihasta prasodjo karanganyar analisis pengaruh leverage risiko sistematis (perusahaan-perusahaan manufaktur bursa efek jakarta) analisis pengaruh locus of control tipe perilaku pemenuhan harapan penggajian kepuasan kerja (studi penelitian dosen universitas sebelas maret surakarta) analisis pengaruh loyalitas merek gaya hidup keputusan pembelian konsumen jasa penerbangan pesawat garuda indonesia kota surakarta analisis pengaruh manajemen laba (earning management) kinerja perusahaan melakukan ipo (studi perusahaan go public bej) analisis pengaruh marketing mix kepuasan konsumen pembelian produk pelumas mesin sepeda motor merek top one yogyakarta analisis pengaruh mekanisme corporate governance nilai perusahaan kualitas laba sebagai variabel intervening perusahaan manufaktur terdaftar bursa efek indonesia periode 2004-2007 analisis pengaruh modal pinjaman dari tukang kredit harian karakteristik pedagang pendapatan pedagang pasar wilayah kecamatan banjarsari kota surakarta analisis pengaruh model merk kecanggihan teknologi harga keputusan konsumen membeli handphone (survei mahasiswa fakultas ekonomi universitas sebelas maret surakarta) analisis pengaruh motivasi kerja produktifitas kerja disertai disiplin kerja sebagai variabel antara (pt batik keris surakarta bagian produksi batik tulis) analisis pengaruh net income roa roe status kepemilikan bank probabilitas maksimalisasi car perusahaan perbankan bei analisis pengaruh orientasi wirausaha kinerja perusahaan strategi pemasaran sebagai variabel moderating (studi industri kecil batik kota surakarta) analisis pengaruh out standing credit tabungan deposito antar bank pasiva modal inti modal pinjaman rasio loan to deposit ratio (pt bpr kartasura makmur kartasura) analisis pengaruh past market valuation structur modal (kajian empiris perusahaan go public indonesia tahun 1992-2002) analisis pengaruh pelatihan promosi mutasi pegawai prestasi kerja kepala sekolah dasar kecamatan semarang barat analisis pengaruh pelatihan promosi mutasi pegawai prestasi kerja kepala sekolah dasar kecamatan semarang barat analisis pengaruh pemecahan saham (stock split-up) kegiatan perdagangan saham tingkat keuntungan saham suatu event study perusahaan terdaftar bursa efek jakarta analisis pengaruh penampilan fisik produk harga citra warung keputusan pembelian bakso pasca isu formalin (studi konsumen bakso kecamatan sukoharjo) analisis pengaruh penampilan fisik produk harga citra warung keputusan pembelian bakso pasca isu formalin (studi konsumen bakso kecamatan sukoharjo) analisis pengaruh pendapatan keluarga jumlah anggota keluarga tingkat pendidikan ibu tingkat pendidikan ayah status gizi balita kecamatan polokarto kabupaten sukoharjo anggota keluarga tingkat pendidikan ibu da analisis pengaruh pendapatan keluarga jumlah anggota keluarga tingkat pendidikan ibu tingkat pendidikan ayah status gizi balita kecamatan polokarto kabupaten sukoharjo analisis pengaruh pendapatan nasional tingkat bunga deposito tingkat inflasi total aktiva bank umum penghimpunan deposito berjangka bank umum indonesia tahun 1986-2000 analisis pengaruh pendidikan latihan motivasi kepuasan kerja kinerja perawat dr oen surakarta analisis pengaruh penerapan sistem perdagangan dua papan bursa efek jakarta perusahaan perbankan indikasi manajemen laba analisis pengaruh penerapan sistem perdagangan dua papan bursa efek jakarta perusahaan perbankan indikasi manajemen laba analisis pengaruh pengambilan kredit bkk kecamatan batangan kabupaten pati pendapatan penguasa kecil analisis pengaruh penggunaan leverage risiko sistematis perusahaan-perusahaan manufaktur non manufaktur analisis pengaruh pengumuman merger akuisisi abnormal return saham perusahaan target bursa efek jakarta analisis pengaruh pengumuman pemecahan saham (stock split) harga saham volume perdagangan saham likuiditas saham diukur bid-ask spread beberapa perusahaan go public jakarta analisis pengaruh penjualan kredit piutang laba usaha unit pertokoan kpri ikhlas surakarta analisis pengaruh perceptions brand commitment dimediasi oleh brand trust acara berita radio surakarta (studi acara berita kopi pagi solopos fm) analisis pengaruh pergerakan pesawat komersial pergerakan penumpang bandara internasional adi sumarmo (bias) solo analisis pengaruh periklanan promosi penjualan nilai penjualan produk pt bumi angkasa tekstil industri sragen analisis pengaruh periklanan promosi penjualan volume penjualan pusat pendidikan komputer akuntansi imka surakarta analisis pengaruh perilaku kepemimpinan kepuasan bawahan komitmen organisasi sebagai variabel pemoderasi analisis pengaruh perilaku kepemimpinan transformasional kepuasan kerja mediasi kepercayaan kepada pemimpin (studi karyawan hotel sahid raya solo) analisis pengaruh persepsi konsumen iklan sms banking mandiri sikap konsumen (studi bank mandiri cabang jakarta thamrin) analisis pengaruh persepsi kualitas produk loyalitas konsumen pasta gigi pepsodent kepuasan sebagai variabel pemediasi (studi mahasiswa fkip uns kentingan) analisis pengaruh persepsi upah kondisi kerja produktivitas kerja karyawan karyawan produksi pt panca bintang tunggal sejahtera sukoharjo analisis pengaruh persepsikualitas jasa pendidikan kepuasan konsumen lbpp-lia surakarta analisis pengaruh pertumbuhan firm size book to market ratio sales earnings perusahaan indeks lq-45 bursa efek jakarta analisis pengaruh perubahan consumer price deposit rate money kurs (study banding rupiah ringgit malaysia bath thailand peso philipina) analisis pengaruh perubahan hutang investasi laba perusahaan (kajian empirik perusahaan manufaktur go publik indonesia 1992-2002) analisis pengaruh perubahan struktur modal perubahan nilai perusahaan (kajian empiris perusahaan manufaktur go public indonesia 1992-2002) analisis pengaruh perubahan tata guna lahan peningkatan jumlah aliran permukaan (das kali gatak surakarta jawa tengah) analisis pengaruh pesan iklan rokok sampoerna a mild media cetak efektifitas komunikasi iklan analisis pengaruh pma pmdn laju inflasi tingkat kemiskinan jawa tengah tahun 1990 - 2003 analisis pengaruh praktik income smoothing (perataan laba) kinerja saham perusahaan-perusahaan publik bursa efek jakarta analisis pengaruh praktik manajemen laba koefisien respon laba analisis pengaruh produk domestik bruto (pdb) dana pihak ketiga (dpk) perbankan tingkat suku bunga sbi penyaluran kredit ukm indonesia tahun 2002-2006 analisis pengaruh produk domestik regional bruto (pdrb) pertumbuhan kesempatan kerja sektoral propinsi jawa tengah analisis pengaruh produk harga iklan keputusan pembelian sepeda motor honda bebek (survai kotamadya magelang) analisis pengaruh profitabilitas leverage harga saham cash dividend (perusahaan manufaktur terdaftar bursa efek jakarta periode 2005-2007) analisis pengaruh promosi volume penjualan pt analisis pengaruh publikasi laporan keuangan dilihat dari volume perdagangan tingkat keuntungan saham bursa efek jakarta analisis pengaruh relationship marketing mencapai kepuasan pelanggan bisnis jasa transportasi bpu rosalia indah analisis pengaruh retailer interest perilaku belanja konsumen toserba sami luwes surakarta analisis pengaruh return on assets volume perdagangan earning per share tingkat suku bunga harga saham perusahaan terdaftar jakarta islamic index bursa efek jakarta analisis pengaruh return on equity tingkat suku bunga deposito harga saham perusahaan bej periode 1999-2001 analisis pengaruh roce cse residual earnings (perusahaan manufaktur food and beverage bei) analisis pengaruh shopping emotions resource expenditure shopping experience (survei konsumen matahari department store singosaren solo tahun 2005) analisis pengaruh shopping emotions resource expenditure shopping experience analisis pengaruh sikap keyakinan niat pembelian diskon harga sebagai moderator (produk sepatu converse mahasiswa s1 fe uns) analisis pengaruh sikap norma subyektif minat konsumen pt telekomunikasi indonesia tbk surakarta memilih telkomflexi analisis pengaruh sikap norma subyektif minat konsumen membeli personal computer lokal (studi mahasiswa fakultas ekonomi uns) analisis pengaruh similarity reputation percieved risk innovativeness evaluasi konsumen atas produk brand extension (merk pepsodent mahasiswa uns) analisis pengaruh stock split abnormal return likuiditas saham bursa efek jakarta periode 1998-2002 analisis pengaruh store attributes customer satisfaction conative loyalty (studi empiris konsumen toko ratu luwes surakarta) analisis pengaruh struktur kepemilikan saham kebijakan dividen perusahaan terdaftar bursa efek indonesia 2004 -2007 analisis pengaruh suara pencahayaan produktivitas kenyamanan pengguna komputer analisis pengaruh suara pencahayaan produktivitas kenyamanan pengguna komputer analisis pengaruh suku bunga kredit dana pihak ketiga produk domestik bruto penyaluran kredit perbankan indonesia analisis pengaruh temperatur jarak cepat rambat bunyi medium udara analisis pengaruh temperatur kebisingan kerja sistem cardiovascular operator produksi (pt general electric lighting indonesia) analisis pengaruh tingkat inflasi nilai kurs rupiah suku bunga sbi cadangan devisa pelarian modal indonesia (1986i – 2004iv) analisis pengaruh tingkat inflasi nilai tukar rupiah dolar amerika produk domestik bruto suku bunga sertifikat bank indonesia jakarta islamic index (jii) bursa efek jakarta analisis pengaruh tingkat suku bunga deposito pendapatan nasional nilai tukar uang inti permintaan uang indonesia selama krisis ekonomi 19977-200112 analisis pengaruh tingkat suku bunga nilai tukar tingkat inflasi jumlah uang beredar indeks manufaktur bursa efek jakarta (1997 - 2001) analisis pengaruh ukuran perusahaan book to market ratio dividend yield return saham (perusahaan manufaktur terdaftar bej) analisis pengaruh ukuran perusahaan pertumbuhan profitabilitas leverage kualitas laba sebelum selama setelah krisis moneter analisis pengaruh ukuran perusahaan profitabilitas leverage perataan laba (income smoothing) industri perbankan terdaftar bursa efek indonesia periode 2005 – 2007 analisis pengaruh upah kondisi kerja stress kerja kinerja karyawan bagian produksi perusahaan mebel cv alisha gallery surakarta analisis pengaruh utang luar negeri penanaman modal asing (pma) kurs permintaan impor non migas indonesia tahun 1990-2002 analisis pengaruh variabel internal perusahaan variabel makroekonomi harga saham bank mandiri tahun 2003 - 2008 analisis pengaruh variabel leverage likuiditas price earning ratio dividend yield price book value pertumbuhan laba jenis industri pengukuran risiko sistematik (beta saham) analisis pengaruh variabel makro mikro risiko investasi saham (studi perusahaan non-lembaga keuangan terdaftar bursa efek jakarta tahun 2001-2004) analisis pengaruh variabel makroekonomi harga saham blue chip tahun 2001-2007 bej analisis pengaruh variabel-variabel finansial beta saham manufaktur terdaftar bursa efek jakarta analisis pengaruh variabel-variabel fundamental beta saham manufaktur bej tahun 1998-2002 (miscellaneous industry) analisis pengaruh variasi temperatur dinding tungku proses karbonasi karakteristik pembakaran kuat tekan briket kokas batu bara analisis perbandingan format penampilan potongan harga (format harga diskon format harga tetap) pengaruhnya persepsi pengorbanan persepsi kualitas persepsi nilai (mahasiswa fakultas ekonomi universitas sebelas mar analisis perbandingan format penampilan potongan harga(format harga)diskon format(harga tetap)dan pengaruhnya persepsi pengorbanan persepsi kualiatas persepsi nilai analisis perbandingan format potongan harga (format harga diskon format harga tetap) produk sepatu adidas pengaruhnya presepsi pengorbanan presepsi kualitas presepsi nilai (mahasiswa fe universitas sebelas maret analisis perkembangan industri pariwisata pengaruhnya pendapatan asli daerah kota surakarta analisis persepsi anggota dewan tentang pengaruh reformasi penyusunan anggaran kualitas apbd (studi empiris anggota dprd kabupaten/kota se-provinsi jawa tengah) analisis persepsi karyawan pemberian kompensasi pengaruhnya kinerja lama kerja sebagai variabel pemoderasi (studi karyawan bagian produksi pt usman jaya mekar pt industri sandang nusantara unit ii patal secang kabupa analisis perubahan struktur ekonomi faktor-faktor mempengaruhi pdrb propinsi daerah istimewa yogyakarta analisis rasio keuangan mempengaruhi probabilitas peringkat obligasi (studi perusahaan perbankan terdaftar bursa efek indonesia tahun 2003-2007) analisis strategi pemasaran warung apung obyek wisata rawa jombor klaten pengaruhnya peningkatan pendapatan masyarakat sekitarnya analisis faktor-faktor mempengaruhi kepuasan nasabah penabung britama perorangan (di bank bri cabang sidoarjo (pengaruh faktor lingkungan sosial faktor individu kepuasan nasabah penabung britama perorangan (di bank bri sidoarjo) analisis variabel mempengaruhi luas pengungkapan sukarela annual report analisis variabel-variabel ekuitas merk berbasis konsumen mempengaruhi intensitas pembelian produk molto bekonang antecedent kepercayaan atas merek pengaruh kepercayaan atas merek loyalitas merek (studi air minum kemasan merek aqua mahasiswa fakultas ekonomi universitas sebelas maret surakarta) apung obyek wisata rawa jombor klaten pengaruhnya peningkatan pendapatan masyarakat sekitarnya beberapa faktor mempengaruhi kebijakan dividen(studi perusahaan manufaktur terdaftar bursa efek indonesia tahun 2005 – 2007) beberapa variabel mempengaruhi produktivitas tenaga kerja pt sekar bengawan surakarta efektivitas implementasi anggaran berbasis kinerjaditinjau dari pengaruh sumber daya informasi orientasi tujuan pengukuran kinerja sebagai aspek rasional (survei pemerintah kota surakarta) efektivitas pembelajaran menggunakan media komputer hasil belajar kimia pokok bahasan laju reaksi faktor-faktor mempengaruhi siswa kelas xi semester iii sma negeri 2 wonogiri tahun pelajaran 2005/2006 esterifikasi asam lemak bebas minyak jelantah katalis tio2/montmorillonit pengaruhnya biodiesel dihasilkan evaluasi implementasi e-government (studi penelitian mengetahui faktor – faktor mempengaruhi keberhasilan implementasi e-government kabupaten sragen) evaluasi depresiasi aktiva tetap metode garis lurus pengaruhnya laba usaha cv sahabat klaten evaluasi efektivitas atas pajak penghasilan pasal 21 pengaruh pemotongan penerimaan kantor pelayanan pajak surakarta tahun anggaran 2002-2004 faktor marketing mix mempengaruhi konsumen melakukan keputusan pembelian (survai restoran istana makanan) faktor mempengaruhi mahasiswa membeli kemeja (studi mahasiswa d-3 fakultas ekonomi uns) faktor – faktor mempengaruhi penyelesaian penyajian laporan keuangan perusahaan terdaftar bursa efek indonesia faktor-faktor mempengaruhi independensi penampilan akuntan publik faktor-faktor eksternal memepengaruhi perilaku konsumen keputusan pembelian handphone faktor-faktor mempengaruhi pengembangan budaya korporasi perum pegadaian kantor wilayah surakarta faktor-faktor berpengaruh rendemen mutu minyak kayu putih pabrik minyak kayu putih krai kbm industri non kayu perum perhutani unit i jawa tengah faktor-faktor berpengaruh investasi sektor properti indonesia periode 1975-2004 faktor-faktor berpengaruh kepatuhan wajib pajak perseorangan melaksanakan kewajiban perpajakan pajak penghasilan faktor-faktor mempengaruhi penerimaan pajak bumi bangunan kabupaten boyolali faktor-faktor mempengaruhi suku bunga pinjaman perbankan indonesia tahun 1980 - 2007 faktor-faktor mempengaruhi angka kematian balita indonesia tahun 2003 faktor-faktor mempengaruhi brand switching sim card im3 (mahasiswa fakultas ekonomi program non regular universitas sebelas maret surakarta) faktor-faktor mempengaruhi efektivitas pelaksanaan keputusan kepala badan pertanahan nasional nomor 1 tahun 2005 tentang standar prosedur operasi pengaturan pelayanan (spopp) kantor pertanahan kota surakarta faktor-faktor mempengaruhi frekuensi pembelian makanan minuman oleh konsumen warung hik (survey jalan gunung kawi joglo solo) faktor-faktor mempengaruhi impor non migas indonesia dari jepang periode 19951 sd 20054 faktor-faktor mempengaruhi keberhasilan pedagang kaki lima pengging boyolali faktor-faktor mempengaruhi keberhasilan pengembangan sdm pertanian spp-spma tanjungsari jawa barat faktor-faktor mempengaruhi kemampuan bidan penerapan standar pelayanan antenatal (studi bidan wilayah kabupaten karanganyar) faktor-faktor mempengaruhi kepuasan konsumen toko laris kartasura faktor-faktor mempengaruhi kepuasan pemustaka unsur penunjang universitas perpustakaan pusat universitas gadjah mada yogyakarta faktor-faktor mempengaruhi keputusan pembelian obat generik apotik solo farma surakarta faktor-faktor mempengaruhi kesetiaan merek konsumen produk kosmetik pond's (dilakukan mahasiswa fakultas ekonomi uns) faktor-faktor mempengaruhi kesetiaan merek konsumen produk pokok sampoerna (studi mahasiswa fakultas ekonomi universitas sebelas maret surakarta) faktor-faktor mempengaruhi kesetiaan merk konsumen produk mie instan indomie (studi mahasiswa non reguler fakultas ekonomi universitas sebelas maret surakarta) faktor-faktor mempengaruhi ketepatan waktu penyampaian laporan keuangan perusahaan manufaktur terdaftar bej faktor-faktor mempengaruhi keuntungan bpr bkk kabupaten sragen faktor-faktor mempengaruhi kinerja sistem informasi akuntansi (sia) perusahaan jasa perhotelan joglosemar faktor-faktor mempengaruhi konsumen keputusan pembelian toko pemuda cepu jawa tengah faktor-faktor mempengaruhi konsumen memilih sabun mandi faktor-faktor mempengaruhi konsumen memilih sabun mandi faktor-faktor mempengaruhi konsumen pembelian wayang pengrajin wayang jl raya solo-sukoharjo telukan grogol faktor-faktor mempengaruhi konsumsi air perusahaan daerah air minum (pdam) kelompok pelanggan rumah tangga ii (r2) kota surakarta faktor-faktor mempengaruhi kredit usaha tani pengaruhnya pendapatan petani padi kabupaten karanganyar musim tanam (1999-2000) faktor-faktor mempengaruhi mahasiswa jurusan akuntansi memilih karir sebagai akuntan publik non akuntan publik (perguruan tinggi surakarta) faktor-faktor mempengaruhi minat mahasiswa jurusan akuntansi fe uns mengikuti pendidikan profesi akuntansi (ppa) faktor-faktor mempengaruhi minat nasabah mengambil kredit bri unit makam haji kartasura faktor-faktor mempengaruhi naik turunnya volume penjualan pt suara merdeka kantor perwakilan surakarta faktor-faktor mempengaruhi pembelian warung bakso daerah kalilarangan surakarta faktor-faktor mempengaruhi pemberian kredit pt mandala multifinance surakarta faktor-faktor mempengaruhi penerimaan pajak bumi bangunan kabupaten klaten faktor-faktor mempengaruhi pengambilan keputusan mahasiswa (pengaruh faktor internal individu lingkungan eksternal strategi komunikasi mahasiswa prodi pendidikan ekonomi pengambilan keputusan memilih bidang keahlian khusus pendidi faktor-faktor mempengaruhi pengambilan keputusan petani penerapan pertanian padi organik desa sukorejo kecamatan sambirejo kabupaten sragen faktor-faktor mempengaruhi penggunaan akses internet 3g menggunakan pendekatan tam (pengguna telkomflash surakarta) faktor-faktor mempengaruhi perataan laba (income smoothing) bukan perataan laba (non-income smoothing) (studi perusahaan terdaftar bursa efek indonesia tahun 2002-2006) faktor-faktor mempengaruhi permintaan daging ayam jawa tengah tahun 1986-2006 faktor-faktor mempengaruhi permintaan jagung pasar domestik tahun 1984-2008 faktor-faktor mempengaruhi pola perilaku konsumen beras organik (studi eksploratif mengenai faktor-faktor mempengaruhi pola perilaku konsumen beras organik surakarta) faktor-faktor mempengaruhi tingkat underpricing perusahaan go publik bursa efek jakarta (studiempiris perusahaan melakukan listing bej tahun 2001-2004) faktor-faktor mempengaruhi usaha kecil brem kabupaten madiun faktor-faktor mempengaruhi wajib pajak orang pribadi memilih metode penghitungan perseorangan bidang perdagangan wilayah eks karisidenan surakarta faktor-faktor mempengaruhi waktu pengambilan keputusan membeli polis asuransi jiwa pt wanaartha life surakarta fenomena underprincing faktor mempengaruhi penawaran umum perdana saham (bursa efek jakarta periode 1999-2003) identifikasi faktor – faktor mempengaruhi perilaku konsumtif mahasiswa (studi deskriptif kualitatif perilaku konsumtif hal fashion kalangan mahasiswa d iii fisip uns jurusan ma angkatan 2005 2006) identifikasi karakteristik mempengaruhi kesuksesan agen atribut asuransi mempengaruhi nasabah masuk ajb bumiputera 1912 cabang kediri identifikasi variabel paling berpengaruh kelelahan umum perawat ruang an-nisa rumah sakit islam surakarta industri kaca grafir pengaruhnya kehidupaan sosial ekonomi masyrakat desa bakipandeyan kecamatan baki kabupaten sukoharjo jawa tengah tahun 1993-2004 jumlah korpus luteum kadar progesteron tikus putih (rattus norvegicus l) strain sprague – dawley fase luteal setelah pemberian kurkumin sintetis dosis anti inflamasi secara oral bawah pengaruh pmsg kajain eksperimental pengaruh waktu sintering sifat fisik mekanik komposit plastik (hdpe pet) karet ban bekas kaji eksperimental pengaruh temperatur masukan oli jarak sekat performa alat penukar panas tipe selongsong tabung kaji eksperimental pengaruh temperatur masukan oli jarak sekat performa alat penukar panas tipe selongsong tabung kaji eksperimental pengaruh temperatur pengeringan ketebalan kayu karakteristik pengeringan kayu mahoni pengering konvensional kajian eksperimental pengaruh variasi sudut sudu impeler unjuk kerja pompa sentrifugal kajian faktor-faktor berpengaruh konsumen memilih bimbingan belajar kota surakarta kajian pengaruh berbagai kadar garam kandungan asam lemak esensial omega-3 ikan kembung (rastrelliger kanagurta) asin kering kajian pengaruh kebisingan temperatur pencahayaan performansi kerja operator produksi pendekatan desain eksperimen kajian pengaruh pengolahan jenis jagung kadar karbohidrat protein nasi jagung kajian pengaruh sudut variable stator vanes kajian pengaruh sudut variable stator vanes (vsv) bukaan variable bleed valves (vbv) stabilitas stall surge kompresor aksial mesin pesawat terbang kampanye pengaruh kekerasan video game pertumbuhan anak melalui media komunikasi visual surakarta kepemimpinan kepala sekolah kinerja guru budaya organisasi sekolah pengaruhnya produktivitas sekolah kepercayaan organisasi sebagai pemediasi pengaruh keadilan distributif keadilan prosedural work outcomes staf karyawan universitas muhammadiyah surakarta kepercayaan sebagai pemediasipengaruh keadilan distributif keadilan prosedural kepuasan kerja (studi rumah sakit islam surakarta) kepuasan kerja sebagai pemediasi pengaruh pengaturan emosi keinginan keluar (studi karyawan perusahaan air minum kemasan pt tirtamas megah temanggung) ketegasan perencanaan strategik sebagai pemediasi pengaruh ketidakpastian lingkungan kepuasaan perencanaan strategik komitmen afektif sebagai pemediasi pengaruh keadilan distribusif keadilan prosedural keadilan internasional bimbingan belajar primagama surakarta komitmen organisasi sebagai pemediasi pengaruh kepemimpinan transformasional perilaku citizenship (ocb) konflik pekerjaan-keluarga (work-familiy conflict) stres kerja pengaruh kinerja pelayanan konsumen (pt bank mandiri (persero) tbk wilayah surakarta) konflik ulama-uleebalang 1903-1946 pengaruhnya perubahan sosial aceh konflik ulama-uleebalang 1903-1946 pengaruhnya perubahan sosial aceh kualitas pelayanan pengaruhnya kepuasan peserta didik lembaga pendidikan alfabank surakarta kuarsa sebagai pengemban besi oksida kajian aktivasi kuarsa pengaruh ph konsetrasi ion fe proses pengembanan makalah analisis faktor berpengaruh regresi logistik polytomous metode best subset (pendapatan rata-rata keluarga masyarakat kota surakarta) menentukan pengaruh keterbatasan mangsa svl berat badan komodo menggunakan metode bootstrap model regresi linear sederhana error heteroskedastik motivasi intrinsik sebagai pemediasi pengaruh kepuasan penilaian kinerja employee outcomes (studi karyawan pt holcim indonesia tbk cilacap plant) motivasi sebagai variabel moderatig pengaruh antara partisipasi penyusunan anggaran kinerja manajerial hotel berbintang eks karesidenan surakarta pemahaman wajib pajak orang pribadi mengenai sistem self assessment pengaruhnya kepatuhan pemenuhan kewajiban perpajakan pemahaman wajib pungut hotel peraturan daerah nomor 9 tahun 2002 serta pengaruhnya ketaatan pemenuhan kewajiban perpajakan pemahaman wajib pungut panti pijat peraturan daerah nomor 3 tahun 1998 pengaruhnya kepatuhan memenuhi kewajiban perpajakan penerapan material requirement planning pengendalian persediaan bahan baku pengaruhnya minimasi biaya persediaan (studi pt tiga serangkai pustaka mandiri surakarta) pengaruh pembelajaran perhitungan kimia cara faktor-label cara rumus prestasi belajar memperhatikan kreativitas siswa kelas x semester gasal man gondangrejo pengaruh aseton per inhalasi gambaran struktur histologi ginjal mencit pengaruh gaji kondisi kerja program pelayanan bagi karyawan produktivitas kerja (studi karyawan bagian produksi pt royan sragen) pengaruh motivasi kecerdasan emosional prestasi belajar mata kuliah askeb i akbid mitra husada karanganyar pengaruh pembelajaran fisika pendekatan ketrampilan proses konsep usaha bagi siswa smp negeri 1 trucuk klaten 1 dampak informasi hasil pengembalian atas investasi (roi) laba bersih per saham (eps) perusahaan volume perdagangan saham suatu studi sekitar pengumuman laporan keuangan perusahaan go public bursa efek jakarta 1 no 46/1996 tgl 8 juli 1996 tentang pajak penghasilan atas penghasilan berupa bunga atau diskonto obligasi dijual bursa efek 10 analisis pengaruh publikasi laporan keuangan abnormal return saham perusahaan manufaktur bursa efek jakarta 10 no 139/2000 tgl 21 desember 2000 tentang pajak penghasilan atas penghasilan dari obligasi diperdagangkan bursa efek 100 analisis pengaruh roi roe opm prediksi laba masa depan perusahaan manufaktur bursa efek jakarta periode 2001-2005 1000 analisis kinerja jangka panjang emisi saham perdana (pengamatan bursa efek jakarta tahun 1993-1997 101 pengaruh merger akuisisi aktivitas volume perdagangan saham perusahaan pengakuisisi bursa efek indonesia (bei) 102 faktor-faktor mempengaruhi deviden payout ratio perusahaan terdaftar bursa efek jakarta 102 pengaruh informasi akuntansi prospektus ipo tingkat underpriced bursa efek indonesia 103 analisis faktor mempengaruhi harga saham industri perbankan bursa efek jakarta 103 pengaruh pendapatan perubahan hutang serta investasi laba perusahaan bursa efek indonesia tahun 2001-2005 104 faktor-faktor mempengaruhi perataan laba perusahaan manufaktur terdaftar bursa efek indonesia 104 pengaruh struktur modal profitabilitas perusahaan barang konsumsi terbuka bursa efek jakarta 105 analisa efisiensi pasar modal bentuk lemah bursa efek jakarta 105 penggunaan informasi laba arus kas operasi memprediksi laba masa depan (studi empiris perusahaan manufaktur terdaftar bursa efek indonesia) 106 analisis pengaruh perubahan modal kerja perubahan profitabilitas perusahaan manufaktur go public bursa efek indonesia 107 analisis pengaruh indeks bursa internasional dow jones tingkat suku bunga indeks harga saham gabungan bursa efek jakarta 107 analisis pengaruh tingkat inflasi suku bunga return on assets (roa) earning per share (ep harga saham pt unilever tbk bursa efek indonesia tahun 2004-2007 108 pengaruh rasio keuangan perubahan kinerja perusahaan perbankan telah terdaftar bursa efek jakarta 108 penilaian kinerja perusahaan sebelum sesudah go public bursa efek jakarta 109 analisis kinerja perusahaan manufaktur sektor consumer goods pendekatan eva (economic value added) bursa efek jakarta tahun 2000-2004 109 pengaruh kinerja keuangan perusahaan harga saham perusahaan manufaktur terdaftar bursa efek jakarta 11 pengaruh stock split likuiditas saham memperhatikan ukuran perusahaan bursa efek jakarta 11 perlakuan pajak penghasilan atas transaksi penjualan saham bursa efek 110 analisis faktor-faktor mempengaruhi praktik perataan laba (income smoothing) perusahaan go publik bursa efek indonesia (perusahaan manufaktur go publik bursa efek indonesia) 110 pengaruh laporan keuangan publikasian kinerja saham perusahaan listing bursa efek jakarta 111 analisis kinerja perusahaan manufaktur sebelum sesudah melakukan merger akuisisi bursa efek indonesia 111 analisis seasoned equity offerings kinerja perusahaan listing bursa efek jakarta 112 analisis pengaruh modal kerja profitabilitas perusahaan manufaktur terdaftar bursa efek jakarta 112 pengaruh economic value added profitabilitas perusahaan return pemegang saham perusahaan telekomunikasi (studi bursa efek indonesia) 113 analisa pengaruh likuiditas saham volume perdagangan perusahaan go public bursa efek jakarta 113 pengaruh rasio keuangan harga saham perusahaan perbankan terdaftar bursa efek jakarta 114 analisis rasio keuangan perubahan kinerja perusahaan manufaktur terdaftar bursa efek jakarta 114 pengaruh struktur kepemilikan manajerial struktur kepemilikan institusional ukuran perusahaan pengaturan laba (earnings management) (ditinjau dari perusahaan manufaktur terdaftar bursa efek indonesia) 115 analisis ketepatan prediksi kebangkrutan metode z-score altman perusahaan terdaftar bursa efek jakarta 115 pengaruh economic value added profitabilitas perusahaan return pemegang saham (studi empiris perusahaan manufaktur terdaftar bursa efek indonesia) 116 analisis kinerja perusahaan manufaktur sektor tobacco pendekatan eva (economic value added) bursa efek indonesia tahun 2002-2006 116 analisis pengaruh modal kerja profitabilitas perusahaan food and beverages bursa efek jakarta 117 pengaruh karakteristik perusahaan abnormal return saham perdana bursa efek jakarta 117 pengaruh pemilihan metode akuntansi merger akuisisi volume perdagangan saham perusahaan manufaktur terdaftar bursa efek indonesia (bei) 118 pengaruh rasio keuangan perubahan kinerja perusahaan manufaktur terdaftar bursa efek indonesia (bei) 118 perhitungan koreksi beta pasar atas saham terdaftar bursa efek jakarta 119 analisis faktor-faktor mempengaruhi tingkat underpricing perusahaan terdaftar bursa efek jakarta periode tahun 2001 - 2005 119 pengaruh kinerja keuangan harga saham perusahaan perbankan listing bursa efek jakarta 12 analisa kinerja obligasi corporate bursa efek surabaya sebagai bahan pertimbangan investasi 12 pengaruh pendapatan perubahan hutang serta investasi laba perusahaan bursa efek indonesia 120 faktor-faktor mempengaruhi return saham perusahaan food and beverages terdaftar bursa efek jakarta 120 pengaruh eva rasio profitabilitas perubahan harga saham perusahaan makanan minuman go public bursa efek jakarta periode 2000-2004 121 pengaruh price earning ratio volume penjualan produk tingkat suku bunga sbi return saham perusahaan bergerak bidang finansial bursa efek jakarta 121 pengaruh profitabilitas harga saham perusahaan manufaktur go public bursa efek jakarta 122 pengaruh corporate governance earnings management perusahaan ipo bursa efek jakarta 122 pengaruh perubahan laba perubahan dividen perusahaan (studi empiris perusahaan manufaktur terdaftar bursa efek indonesia) 123 pendekatan chance constrained data envelopment analysis penyusunan portofolio (bursa efek jakarta) 123 pengaruh stock split harga likuiditas saham bursa efek jakarta 124 pengaruh beta risiko sistematis tingkat keuntungan saham perbankan asuransi bursa efek jakarta 124 pengaruh variabel makroekonomi indonesia indeks harga saham luar negeri indeks harga saham gabungan (ihsg) bursa efek indonesia 125 pengaruh ratio fundamental harga saham perbankan lembaga keuangan lainnya bursa efek indonesia 125 variabel-variabel mempengaruhi struktur keuangan perusahaan makanan minuman go public bursa efek surabaya (bes) 126 analisis variabel-variabel berpengaruh spread harga saham perusahaan terdaftar bursa efek jakarta (2000-2005) 126 jaringan syaraf backpropagation algoritma genetika meramalkan indeks harga saham gabungan 127 pengaruh sebelum sesudah bentuknya komite autdut kualitas laba perusahaan manufaktur terdaftar bursa efek jakarta 127 pengaruh struktur modal return saham perusahaan manufaktur listing bej (bursa efek jakarta) periode 2004-2006 m choirul wujud 128 pengaruh informasi pengumuman stock split two for one abnormal return saham perusahaan-perusahaan listing bursa efek jakarta periode 1996-2001 128 pengaruh modal kerja profitabilitas perusahaan automotive and allied terdaftar bursa efek jakarta 129 analisis tingkat kebangkrutan perusahaan model altman sektor parmaceuticals bursa efek indonesia periode 2002 2006 129 pengaruh selisih kurs pengguna pola manajemen laba saat penerapan kebijakan multi papan bursa efek jakarta perusahaan terdaftar bursa efek jakarta 13 nalisis perbedaan kinerja keuangan perbankan perasuransian (studi empiris bursa efek indonesia tahun 2003-2007) 130 faktor-faktor penentu struktur modal serta dampaknya nilai perusahaan perusahaan manufaktur terdaftar bursa efek indonesia bursa efek malaysia 130 pengaruh manajemen laba biaya modal ekuitas perusahaan perbankan terdaftar bursa efek indonesia (studi perusahaan perbankan bei th 2002-2006) 131 perlindungan hukum investor pemegang obligasi rangka perjanjian perwaliamanatan bank pasar modal 131 prospek pasar modal indonesiasuatu tinjauan pengerahan dana 132 analisis proporsi penyertaan saham pemilik lama sebagai sinyal prospek perurahaan setelah pasar perdanaempiris bursa efek jakarta 132 perlindungan hukum investor pemegang obligasi rangka perjanjian perwaliamanatan pasar modal 133 analisa pola musiman bursa efek jakarta (periode 1992 - 1997) 133 analisis faktor-faktor mempengaruhi pelaporan keuangan melalui internet(internet financial reporting)dalam website perusahaan 134 analisis kewajaran harga saham perdana perusahaan go public bursa efek jakarta 134 return pasar saham kebijaksanaan moneter 135 diversivikasi investasi portfolio saham (sebuah bursa efek jakarta) 135 interaksi biaya sosial kinerja sosial kinerja keuangan luas pengungkapan sosial (praktik tanggungjawab sosial perusahaan go publik bursa efek indonesia 136 analisis pengaruh kepemilikan manajerial investment opportunity set return on asset debt to equity ratio dividend payout ratio (saham lq45 bursa efek jakarta) 136 pengamatan pola pengembalian (return) investasi bursa efek jakarta saat krisis moneter 137 pengaruh pengumuman dividen volume perdagangan saham bursa efek jakarta 137 profitabilitas strategi momentum bursa efek jakartatelaahan berdasarkan long-term momentum hypoyhesis 138 analisis fundamental saham pt indosat tbk menggunakan metode free cash flow to equity (fcfe) 138 analisis kinerja saham-saham listing bursa efek jakarta dibandingkan tabungan deposito 139 analisis beta saham (pt bursa efek jakarta) 139 dampak informasional pengumuman stock splitsanalisis shareholder wealth determinan abnormal return 14 analisis faktor-faktor mempengaruhi deviden perusahaan-perusahaan go public bursa efek indonesia (perusahaan manufaktur bei) 140 analisis size effect value effect model multi faktor fama french 140 portofolio optimal saham lq 45 periode 2000-2003 (studi pt bursa efek jakarta) 141 analisis pengaruh rasio-rasio keuangan bank go public harga sahamsuatu studi bank-bank go public bursa efek jakarta (bej) 141 penentuan harga saham beberapa emiten bursa efek jakarta 142 analisa harga saham perusahaan pertambangan (pertambangan bursa efek jakarta) 142 analisis size january effect bursa efek jakarta 143 analisis kinerja reksadana periode sebelum sesudah penggabungan bursa efek jakarta (bej) bursa efek surabaya (bes) menjadi bursa efek indonesia (bei) 143 penelitian anomali efek liburan imbal hasil indeks lq-45 bursa efek jakarta 144 analisis diskriminan model altman memprediksi kemungkinan kebangkrutan sepuluh perusahaan tekstil garmen bursa efek indonesia 144 analisis indikator-indikator perkembangan investasi portofolio bursa efek jakarta 145 analisis kinerja keuangan tiga sektor industri logam sejenisnya kimia plastik kemasan dari perusahaan - perusahaan go public bursa efek jakarta periode 1999-2002 145 penentuan portfolio optimal bursa efek jakarta 146 analisis investasi portfolio optimal metode goal programming 146 analisis pengaruh tingkat kesehatan perusahaan nilai tambah ekuitas pasar perusahaan rokok bursa efek indonesia periode 2004 - 2006 147 analisa pengaruh eksternal kinerja keuangan bank syariahkasus bank muamalat indonesia 147 analisis penilaian kinerja keuangan menggunakan metode economic value added market value added perusahaan makanan minuman terdaftar bursa efek jakarta 148 analisis pengaruh laba nilai buku penilaian ekuitas harga sahamsuatu penelitian empiris bursa efek jakarta 148 pengaruh perubahan bond rating return saham bursa efek jakarta analisis aspek legalitas transaksi efek short-selling masa krisis keuangan (penghentian sementara perdagangan bursa efek indonesia tanggal 8-10 oktober 2008 disebabkan penurunan harga secara tajam terkait indikasi short-selling) 149 integrasi pasar modal pasar valuta asing serta pengaruhnya saham individu bursa efek jakarta analisis pengaruh tingkat suku bunga inflasi nilai tukar harga saham pt sampoerna tbk bursa efek jakarta 15 january effect perusahaan lq 45 bursa efek indonesia (2003-2008) 150 analisis empiris economic value added (va) sebagai proksi market value added (mva)empiris perusahaan terdaftar bursa efek jakarta bursa efek surabaya periode 2002-2004 150 pengaruh kinerja keuangan perbankan return saham bursa efek surabaya analisis pengaruh risiko keuangan (beta) leverage keuangan price earning ratio return saham termasuk lq - 45 bursa efek jakarta 151 tinjauan azas keadilan kebijakan pengenaan pajak penghasilan atas penghasilan transaksi penjualan saham bursa efek 152 analisis pengaruh struktur kepemilikan kepemimpinan perwakilan keluarga perusahaan kinerja keuangan perusahaan 152 pengaruh pengumuman dividen volume perdagangan saham pt bursa efek jakarta 153 analisis penilaian harga saham perusahaan industri rokok bursa efek jakarta 153 dinamika intrahari hari pertama perdagangan saham bursa efek jakarta 154 analisis pengaruh firm size degree of total leverage cyclicality risiko bisnis 154 pengaruh suku bunga indeks harga saham gabungan (ihsg) bursa efek jakarta berdasarkan data bulanan (1990-2002) 155 analisis hubungan informasi keuangan market price suatu perusahaan-perusahaan asuransi bursa efek jakarta - indonesia 155 pengaruh kebijakan hutang kebijakan dividend nilai perusahaan perusahaan manufaktur terdaftar bei 156 pengaruh inflasi tingkat risiko saham tiga perusahaan termasuk indeks lq45 bursa efek jakarta 156 pengaruh likuiditas keputusan investasi aktiva tetap perusahaan dikelompokkan financiality constrained 157 penerapan metode fuzzy pengambilan keputusan pemilihan saham 157 pengaruh publikasi laporan keuangan perubahan harga saham transaksi perdagangan saham 158 analisis faktor-faktor mempengaruhi kelengkapan pengungkapan laporan keuangan (pada perusahaan manufaktur terdaftar bursa efek indonesia) 158 pembentukan portofolio optimal dari dua saham lq-45 capital asset price model bursa efek jakarta 159 pengaruh eps per roe harga saham perusahaan sektor pertambangan pt bursa efek jakarta periode 2000-2004 pengaruh ukuran perusahaan profitabilitas leverage perataan laba (income smoothing)(studi empiris perusahaan manufaktur bursa efek jakarta) 16 pengaruh imbal hasil pasar saham beberapa indikator makroekonomi tertentu imbal hasil saham perusahaan sektor barang konsumsisuatu penelitian empiris bursa efek jakarta 16 pengaruh rasio keuangan praktik perataan laba perusahaan manufaktur bertumbuh bursa efek jakarta (studi empiris bursa efek jakarta 2003-2005) analisis faktor-faktor fundamental mempengaruhi harga saham industri properti bursa efek jakarta manfaat rasio keuangan memprediksi kondisi financial distress perusahaan manufaktur terdaftar bursa efek indonesia analisis struktur modal harga saham perusahaan obat-obatan terbuka bursa efek jakarta analizing day of the week effect to return and volatility of listing stock in jakarta stock exchange pengaruh book value net income total equity earning per share sektor pertambangan bursa efek jakarta antara tahun 1999-2004 pengaruh indikator mekanisme corporate governance kinerja perusahaan publik indonesia analisis perbandingan kinerja kelompok obligasi syariah kelompok obligasi konvensional indonesia periode 2004-2006 pengaruh total debt to total assets ratio tingkat profitabilitas perusahaan whole sale retail trade go publik bursa efek indonesia 164 laporan praktek kerja lapangan pengaruh praktek tata kelola perusahaan kesulitan keuangan perusahaan (studi empiris) sektor manufaktur bursa efek indonesia 165 pengaruh struktur aktiva financial laverage struktur modal profitabilitas perusahaan mining (pertambangan) go public bursa efek jakarta (periode pengamatan tahun 2004-2005) perlindungan hukum investor jual beli obligasi negara ritel pasar sekunder melalui internet dihubungkan undang-undang nomor 8 tahun 166 pengaruh variabel-variabel keuangan harga pasar saham setelah initial public offering (ipo) bursa efek indonesia periodesasi 2000-2005 pengaruh rasio keuangan praktik perataan laba perusahaan manufaktur bursa efek indonesia (studi empiris bursa efek indonesia) 168 analisis pengaruh laju inflasi tingkat suku bunga jumlah uang beredar kurs valas volume rata-rata transaksi sibor indeks harga saham gabungan (ihsg) bursa efek jakarta (bej) (tahun 2002 - 2004) kesulitan mahasiswa belajar analisis butir soal mata kuliah evaluasi pembelajaran tata boga penerapan model learning cycle 5e meningkatkan hasil belajar siswa pembelajaran fisika penerapan model siklus belajar (learning cycle pengembangan model olah gerak peningkatan kecerdasan kinestetik anak usia dini penelitian tindakan kelas siswa kel pengembangan pembelajaran ilmu ukur tanah pembuatan peta berkontur menggunakan model permukaan digital penggunaan media kartu huruf keterampilan menulis kalimat sederhana bahasa perancis (studi eksperimen kuasi siswa sma negeri 4 cimahi tahun ajaran 2012/2013 penggunaan teknik matriks nilai tempat meningkatkan pemahaman perkalian bersusun kelas iv sdn gunungkuning kecamatan sindang kabupaten majalengka perbedaan peningkatan hasil belajar siswa mata pelajaran teknologi informasi komunikasi (tik persepsi orang tua tentang pendidikan anak usia dini (penelitian deskriptif orang tua murid tk chaerunnisa komplek puteraco desa jagabaya kecamatan cimaung kabupaten bandung studi komparatif hasil belajar siswa melalui penerapan model challenge inquiry model konvensional kompetensi mengoperasikan peralatan pengalih daya tegangan rendah (mp2dtr batandang sebagai wahana pembelajaran pembelajaran wanita nelayan wanita pendatang kelurahan pasir kandang kecamatan koto tangah kotamadia padang perilaku siswa wni keturunan cina pribumi melaksanakan program 5 kstudi deskriptif analitik tentang siswa-siswa sma swasta kotamadya palembang ’l'utilisation de la méthode dictogloss pour améliorer la compétence de la production écrite’’ ayo menari jaipong nyi iteung! (cerita bergambar pull-up flap-book sebagai pengenalan tari tradisional indonesia ¬penerapan model cooperative learning tipe jigsaw menggunakan media kartu tiket jahra materi persebaran flora fauna wilayah indonesia meningkatkan hasil belajar siswa kelas v sdn kadujajar iii kecamatan tanjung kerta kabupaten sumedang 4hubungan antara kemampuan matematika siswa penguasaan konsep genetika siswa kelas xii a case study of self-access center (sac a case study of the multicultural practices of two united states dance education implications for indonesian k-9 dance education a case study on peer feedback towards efl students in an international classroom a descriptive study of lab reports a portrait of teacher talk in efl classroom interaction a case study at the first grade of a senior high school in pekanbaru a process-genre based approach to teaching writing report text to senior high school students (a case study a profile of students’ skills in writing literary responses(a case study at english education department indonesia university of education a study on the nominalisations in polytechnic students’ texts a survey of teachers’ beliefs about english teaching and learning a systemic analysis of high school teachers’ argumentative writing a case study in bandar lampung a typology of language learning strategies used by efl students at junior high school a visual analysis of gender representation in buku sekolah elektronik/bse (electronic school book abstrak efektivitas pembelajaran permainan role-playing berbasis pengalaman meningkatkan keterampilan berbicara siswa sekolah dasar (studi eksperimen siswa kelas v sdn cilayang 3 siswa kelas v sdn cimaung 3 kabupaten serang abstrak pengaruh brain gym motorik kasar anak taman kanak - kanak abstraksi siswa smp belajar geometri melalui penerapan model van hiele geometers¡¯ sketchpad acara golémpang pikeun alternatif bahan pangajaran ngaregepkeun smatilikan aspék pragmatik jeung tindak komunikatif activities in teaching the speaking skill to the students with vision impairment adegan pupujian désa sirnasari kacamatan suradé kabupatén sukabumi pikeun bahan pangajaran ngaregepkeun smp (ulikan struktural adekuasi penyesuaian sosial siswa sekolah ditelaah dari kecerdasan kebutuhan berprestasi studi deskriptif para siswa kelas iii sma se-kotamadya banda aceh ajeg balipolitik identitas implementasinya berbagai agen sosialisasi desa pakraman ubud gianyar bali ajén atikan dina folklor aspék kapamalian anu aya désa tanjungwangi kecamatan cicaléngka kabupatén bandung ajen estetika dina arsitektur imah adat kampung naga desa neglasari kacamatan salawu kabupaten tasikmalaya pikeun bahan ajar maca artikel budaya kelas xii ajén éstétika dina kabudayaan hajat laut palabuanratu kabupatén sukabumi pikeun salasahiji alternatif bahan ajar maca sma ajen estetika dina seni raja dogar kacamatan cibatu kabupaten garut pikeun bahan pangajaran maca kelas xii ajén éstétis dina kasenian penca silat cakar kumbang kencana kampung nyingkir désa cihideung kacamatan parongpong kabupatén bandung barat pikeun bahan pangajaran maca sma kelas xii ajén éstétis kasenian gembyung kabupatén subang pikeun bahan pangajaran maca sma kelas xii ajén falsafah upacara sidekah tutulak désa karangtawang kecamatan kuningan kabupatén kuningan pikeun bahan pangajaran maca sma ajén kaagamaan dina novél masyitoh karangan ajip rosidi pikeun bahan pangajaran sastra sma ajén moral jeung psikologi perkembangan rumaja dina novelét jamparing karya chye retty isnendes pikeun bahan pangajaran nyarita smp kelas ix ajén-ajén étnopédagogi dina dongéng kota tasikmalaya ulikan struktural jeung hermeneutik ajén-inajén sosial politik mangsa réformasi masarakat sunda dina carita pondok majalah manglé jeung cupumanik aktifitas pengembangan motorik halus bagi anak tunagrahita sedang aktivitas eksplorasi taktil meningkatkan konsep tubuh anak tunanetra usia 6 7 tahun penelitian eksperimen subyek tunggal meningkatkan konsep tubuh anak tunanetra akuntabilitas kinerja pengawasan fungsional pendidikanstudi deskriptif kontribusi kapasitas kepemimpinan motivasi kerja kompetensi auditor efektivitas organisasi akuntabilitas kinerja pengawasan pendidikan inspektorat jenderal kementerian pendidikan kebudayaan akuntabilitas manajemen kinerja satuan pendidikan kecakapan hidup berbasis budaya lokal studi tentang pengaruh perencanaan kepemimpinan iklim organisasi kinerja satuan pendidikan pelaksana program pendidikan kecakapan hidup provinsi jambi akuntansi forensik praktik kepailitan pengadilan niaga alat peraga torso meningkatkan hasil belajar ipa sd negeri binawarga cianjur alat sensor bahaya mendukung kemampuan keselamatan diri siswa tunanetra alih kode campur kode ceramah para ustadzkajian sosiolinguistik para ustadz kawasan perbatasan bandung-sumedang alternatif pembelajaran matematika pendekatan metakognitif meningkatkan kemampuan berpikir kritis mahasiswa pgsd an analysis of anomalous exchange in young learners’ classroom interactiona case study at an elementary school in bandung an analysis of elementary school english textbooks learning by doing and english have a go a case study of fifth grade english textbooks published in bandung an analysis of english-indonesian translation procedures on twitter web pages an analysis of materials and students’ needs in learning english a case study at an institute of higher education of economics in bandung an analysis of students’ ability and difficulties in writing descriptive texts a case study of tenth graders in a senior high school in bandung an analysis of students’ ability in writing narrative texts a case study at one public junior high schools in bandung an analysis of syllabus and material and their relevance to the students' need an analysis of thematic progression in high school students’ exposition texts an analysis of themes in the magicand its indonesian translation an efl syllabus for vocational high schoolsits relevance to the school-based curriculum and the teachers’ perceptions of the syllabus a case study at a state vocational high school in cimahi an investigation of english for spesific purposes program at a state islamic university an investigation of english pre-service teachers’ performance a case study in one senior high school in bandung an investigation of teacher’s strategies in teaching listening an investigation of the construction of the english final tests and the tests’ compliance with the objectives of the program a case study at three primary schools in purworejo an investigation of the english teaching in a tertiary institution a case study an investigation of the students’ methods strategies and difficulties in translating english texts into indonesian a case study at one madrasah aliyah in bandung an investigation of the teaching of reading a case study at three level classesacceleration international and regular class at an international standard state senior high school in sumedang regency an investigation of the use of english as a mean of communication in science and math classes of pilot international standard school (rsbi analilis pengaruh kualitas pelayanan kualitas produk keputusan pembelian konsumen food court mall kota bandung analisa korelasi mata pelajaran gambar teknik praktik pemesinan analisa performa siswa pembelajaran pembenihan ikan lele analisis adjektiva taisetsu na daiji na jyuuyou na jyuudai na sebagai sinonim analisis aktivitas rekreasi penurunan tingkat stres mahasiswa ilmu keolahragaan analisis alat penilaian ulangan kenaikan kelas mata pelajaran produktif kompetensi keahlian nautika kapal penangkapan ikan smk negeri 2 subang analisis alat penilaian ulangan kenaikan kelas mata pelajaran produktif kompetensi keahlian nautika kapal penangkapan ikan smk negeri 2 subang analisis aspek verba terdapat bahan ajar bahasa jepang tingkat menengah analisis aspektualitas bahan ajar bunpou digunakan jurusan pendidikan bahasa jepang fpbs upi analisis bentuk makna kria kemasan daun pisang sajian makanan kampung naga kabupaten tasikmalaya analisis bentuk ungkapan menyatakan alasan terdapat buku ajar bahasa jepang jpbj fpbs upi analisis buku ajar fisika sma kelas x kota bandung berdasarkan kategori literasi sains analisis buku ajar fisika sma kelas x kota bandung berdasarkan kategori literasi sains analisis buku teks pelajaran bahasa inggris sekolah dasar berdasarkan standar penulisan buku teks pelajaran penelitian deskriptif kelas iii sd negeri layungsari kecamatan cihideung kota tasikmalaya analisis buku teks sakura refleksi konsep pendekatan komunikatif analisis buku teks seni karawitan sd kelas iv karangan tisno sutrisno sebagai bahan ajar bidang studi kesenian daerah analisis butir soal cambridge international examination (cie analisis butir soal ujian akhir semester ganjil tahun ajaran 2012-2013 mata pelajaran produktif budidaya unggas petelur smk peternakan negeri lembang analisis celebrity endorser faktor psikologis keputusan penggunaan aplikasi pesan singkat smartphone analisis penyusunan model buku teks bahasa indonesia smk berbasis pendidikan kecakapan hidup analisis daya dukung pariwisata sebagai dasar pengelolaan pengunjung kampung naga kabupaten tasikmalaya analisis daya saing bandung sebagai destinasi wisata melalui memorable tourist experience (mte analisis daya saing industri jaket kulit sukaregang kabupaten garut analisis daya terima konsumen kelayakan bisnis produk mousses berdasarkan proses berbahan dasar jagung manis analisis dékonstruksi dina kumpulan carpon serat sarwasatwa karya godi suwarna analisis deskriptif butir soal tes membaca pemahaman bahasa inggris kelas v sdi al-azhar 33 tasikmalaya analisis deskriptif gaya kognitif field dependent-field independent siswa sekolah menengah pembelajaran fisika levels of inquiry model analisis deskriptif multimedia interaktif pembelajaran bahasa perancis transparent language learn french now! v9 analisis deskriptif preferensi masyarakat berbelanja kebutuhan pokok pasar tradisional pasar modern analisis deskriptif shouryaku hyougen iklan toyota doraemon 1-9 softbank triendle reina 1-6 toyota reborn oda nobunaga 1-11 analisis domain kognitif siswa sma kelas xi subpokok bahasan sifat koloid melalui praktikum kimia skala kecil analisis efek kualifikasi guru kompetensi guru evaluasi diri guru kualitas belajar ipa siswa smp kota samarinda analisis efektivitas pajak penerangan jalan kontribusinya peningkatan pad menunjang kemandirian daerah analisis efektivitas pajak penerangan jalan kontribusinya peningkatan pad menunjang kemandirian daerah analisis efektivitas penerimaan pajak reklame kontribusinya pendapatan asli daerah kota bekasi tahun 2007-2011 analisis efisiensi operasional profitabilitas pt analisis faktor – faktor bauran pemasaran pengaruhnya keputusan pembelian konsumen surabi la viva café bandung analisis faktor – faktor mempengaruhi kinerja guru ekonomi sma negeri kota bandung analisis faktor faktor ketidakpuasan konsumen menu kategori dog (unpopuler unprofitable analisis faktor fundamental harga saham pt analisis faktor internal eksternal mengembangkan program bimbingan belajar bagi siswa berbakatstudi deskriptif siswa akselerasi smp negeri 1 sumedangtahun 2012/2013 analisis faktor-faktor meal experience mempengaruhi kepuasan konsumen speciality restaurant okoh japanese resto bandung analisis faktor-faktor motivasi wisatawan mempengaruhi keputusan berkunjung ke daya tarik wisata alam cibulan kuningan survei kunjungan wisatawan nusantara daya tarik wisata alam cibulan analisis faktor-faktor mempengaruhi kinerja pegawai kemenenag kabupaten sukabumi analisis faktor-faktor mempengaruhi minat berwirausaha survei mahasiswa universitas pendidikan indonesia angkatan 2009 2010 analisis faktor-faktor mempengaruhi minat wisatawan nusantara jajanan populer khas kota bandung wilayah karees bandung analisis faktor-faktor mempengaruhi pendapatan pedagang sembako suatu kasus pedagang sembako pasar pananjung kecamatan pangandaran analisis faktor-faktor mempengaruhi pendapatan pengusaha tas dompet desa cibolerang blok ransel babakan mulya analisis faktor-faktor mempengaruhi perilaku konsumen menggunakan jasa warung internet game online studi kecamatan sukasari kota bandung analisis faktor-faktor mempengaruhi permintaan rumah makan sari sunda se-kota bandung survei konsumen rumah makan sari sunda analisis faktor-faktor mempengaruhi permintaan pendidikan sebagai salah satu bahan pertimbangan penentuan prioritas jenis sekolah studi tentang permintaan pendidikan sckolah menengah tingkat atas (smta analisis faktor-faktor mempengaruhi siswa memilih smk bidang keahlian teknik bangunan sebagai sekolah lanjutannya kabupaten garut analisis faktor-faktor menarik minat wisatawan mancanegara produk wisata kuliner unggulan bandung wilayah cibeunying survey wisatawan mancanegara berkunjung ke kota bandung analisis faktor-faktor menimbulkan mismatch kerja bagian plant enginering rangka mencari bentuk lembaga pelatihan sesuai pt analisis fasilitas pariwisata olahraga kampus universitas pendidikan indonesia (upi analisis fenetik sembilan kultivar kentang (solanum tuberosum l analisis frekuensi gerak teknik menggunakan motion notational analysis methods permainan bulutangkis studi banding antara sistem rally point 15 poin analisis fungsi produksi penggunaan faktor-faktor produksi industri tahu cibuntu kota bandung survey sentra industri tahu cibuntu kecamatan bandung kulon kota bandung analisis gambar anak berkebutuhan khusus (autis analisis gaya bahasa pengimajian lirik-lirik lagu pop berbahasa indonesia sebagai alternatif bahan ajar apresiasi sastra sekolah menengah atas/madrasah aliyah studi deskriptif analitis lagu-lagu grup musik letto analisis geografis pelayanan sosial kecamatan martapura dampak pemekaran kabupaten ogan komering ulu timur analisis implementasi strategi perkuliahan kolaboratif berbasis masalah mengembangkan kemampuan pemecahan masalah matematiskemampuan komunikasi matematis analisis implementasi strategi perkuliahan kolaboratif berbasis masalah mengembangkan kemampuan pemecahan masalah matematis kemampuan komunikasi matematisdan keyakinan pembelajaran matematika analisis implementasi supervisi akademik pengawas sekolah menengah kejuruan tiga orang pengawas sekolah sekolah menengah kejuruan kabupaten bandung analisis interaksi siswa smp pembelajaran partikel materi menggunakan media model analisis karakteristik berdasarkan struktur karangan narasi menggunakan pengamatan lingkungan siswa kelas vii mts nahdlatul wathan tanak beak barat analisis karakteristik wisatawan persepsi wisatawan mengenai fasilitas wisata dikampung batu malakasarikabupaten bandung analisis kasalahan éjahan dina karangan déskripsi siswa kelas xii man jonggol taun ajaran 2012/2013 analisis kata serapan bahasa thai bahasa melayu patani kampung hutan berangan patani thailand analisis kebijaksanaan tentang program diploma iii guru kejuruan teknologi meningkatkan kualitas guru teknologisuatu kajian pusat pengembangan penataran guru teknologi bandung analisis kebutuhan akan guru sekolah dasar kemampuan penyediaannya oleh spg daerah kalimantan timur periode tahun 1982/1983 sampai tahun 1991/1992 analisis kebutuhan guru mengembangkan kurikulum pembelajaran ipa sekolah dasar analisis kebutuhan pelatihan berbasis kompetensi rangka meningkatkan profesionalisme guru sd kab analisis kebutuhan pelatihan menunjang efektivitas pelatihan ppptmgb lemigas analisis kebutuhan pengembangan tenaga edukatif fakultas kedokteran gigi - universitas padjadjaran analisis kebutuhan ruang parkir rumah sakit mata cicendo bandung analisis kebutuhan sarana prasarana taman wisata alam curug cilengkrang kabupaten bandung analisis kebutuhan stakeholder tentang keberadaan jurusan pendidikan teknik kriya universitas negeri gorontalo analisis kebutuhan tenaga administrasi sekolah berdasarkan kerangka kualifikasi nasional indonesia (kkni analisis kebutuhan tenaga administratif universitas tanjungpura pontianak periode 1982/1983 -1986/1987 analisis kebutuhan pengadaan pengembangan kepala sekolah dasar negeri propinsi daerah istimewa aceh analisis kecukupan modal profitabilitas ( laporan keuangan pt analisis kelayakan isi buku teks matematika kelas v sekolah dasar analisis kelayakan multimedia interaktif biologi sma materi metabolisme substansi genetik sintesis protein pembelahan sel analisis kelayakan multimedia interaktif biologi sma materi sel jaringan tumbuhan jaringan hewan sistem gerak manusia sistem peredaran darah analisis kelayakan multimedia interaktif biologi sma materi virus monera fungi analisis kemampuan berpikir kreatif matematis siswa kelas v sekolah dasar pembelajaran matematikastudi kualitatif analisis kemampuan berpikir kreatif matematis siswa kelas v sekolah dasar pembelajaran matematika analisis kemampuan berpikir kritis siswa smp melalui pembelajaran berbasis masalah konsep pencemaran lingkungan analisis kemampuan guru mengembangkan keterampilan berpikir kreatif siswa sekolah dasar kelas v pembelajaran ilmu pengetahuan alam studi komparatif guru sekolah dasar kelas v beberapa sekolah dasar kota bandung tahun ajaran 2010-2011 analisis kemampuan guru sd memunculkan aspek inkuiri rencana pembelajaran ipa kesesuaiannya pelaksanaan pembelajaran lima guru sd kota banda aceh analisis kemampuan inkuiri guru madrasah ibtidaiyah negeri pembelajaran ipa hubungannya keterampilan proses sains siswa 4 guru kelas v min kota banda aceh analisis kemampuan inkuiri guru sudah tersertifikasi belum tersertifikasi pembelajaran sains sd analisis kemampuan inkuiri siswa smp melalui pembelajaran levels of inquiry model topik gerak bumi analisis kemampuan inkuiri siswa smp melalui pembelajaran levels of inquiry model topik gerak bumi analisis kemampuan komunikasi matematis siswa sekolah dasar studi kualitatif siswa kelas iv sekolah dasar labortorium upi kampus cibiru kecamatan cileunyi kabupaten bandung analisis kemampuan literasi sains siswa smp pembelajaran ipa terpadu tema cuaca ekstrim analisis kemampuan membaca cepat teks berbahasa jepang penelitiandeskriptifpadamahasiswatingkat 3 jurusanpendidikanbahasajepang fpbs upi tahunajaran 2012/2013 analisis kemampuan membaca menggambar representasi submikroskopik siswa sma topik larutan elektrolit nonelektrolit analisis kemampuan membaca teks berbahasa jerman siswa sma negeri 1 cibeber cianjur analisis kemampuan mengemas materi mengembangkan lks inkuiri guru biologi sma kota bandung analisis kemampuan merencanakan pembelajaran berbasis inkuiri guru-guru biologi sma kota bandung analisis kemampuan pembelajar bahasa jepang pelafalan bunyi konsonan nasal n (hatsu’on analisis kemampuan pembelajar bahasa jepang penggunaan kakujoshi no studi deskriptif mahasiswa tingkat iii jurusan pendidikan bahasa jepang upi tahun ajaran 2012/2013 analisis kemampuan pemecahan masalahn multistep materi soal cerita perbandingan skala siswa kelas v sekolah dasar analisis kemampuan proses sains sikap ilmiah pembelajaran sains taman kanak-kanak analisis kemampuan representasi siswa menyelesaikan masalah tes uraian terstruktur tes uraian bebas materi kelistrikan analisis kemampuan siswa mengubah kata kerja bentuk kamus (jisho-kei analisis kemampuan siswa smk pertanian pembangunan negeri tanjungsari melakukan pembenihan ikan lele analisis kepuasan pengunjung interpretasi non-personal museum negeri sri baduga kota bandung analisis kerajinan golok galonggong desa cilangkap kecamatan manonjaya kabupaten tasikmalaya analisis kerentanan bencana letusan gunungapi ceremai kecamatan cilimus kabupaten kuningan analisis kerusakan mangroveakibat aktivitas penduduk pesisir kota cirebon analisis kesalahan berbahasa tuturan bahasa inggris efek konteks inferensi analisis kesalahan mahasiswa menggunakan shourai mirai sebagai sinonim mahasiswa tingkat iii jpbj upi tahun ajaran 2013/2014 analisis kesalahan mahasiswa tingkat iii jurusan pendidikan bahasa jepang upi tahun akademik 2012/2013 penggunaan setsuzokushi demo keredomo ga shikashi analisis kesalahan mahasiswa tingkat iii jurusan pendidikan bahasa jepang upi tahun akademik 2012/2013 penggunaan setsuzokushi demo keredomo ga shikashi analisis kesalahan mahasiswa tingkat iv jurusan pendidikan bahasa jepang upi tahun akademik 2012/2013 penggunaan verba nozomu negau kibou suru analisis kesalahan pembentukan kalimat bentuk perfekt karangan narasi mahasiswa analisis kesalahan penggunaan ~ tame ni ~you ni kalimat bahasa jepang studi deskriptif mahasiswa tingkat iii iv pendidikan bahasa jepang fakultas bahasa seni upi tahun ajaran 2013/ 2014 analisis kesalahan penggunaan kata penghubung conjonction mahasiswa jurusan pendidikan bahasa perancis upi semester vi tahun akademik 2012/2013 analisis kesalahan penggunaan partikel karangan mahasiswa analisis kesalahan penggunaan verba ditinjau dari kala hasil terjemahan indonesia-perancis mahasiswastudi deskriptif mahasiswa semester vii jurusan pendidikan bahasa perancis universitas pendidikan indonesia tahun akademik 2012/2013 analisis kesesuaian rencana pembelajaran dibuat guru sd pelaksanaan pembelajaran sains study kasus sepuluh orang guru sains kelas iv sekolah dasar bandung ciamis tahun pelajaran 2008/2009 analisis kesulitan belajar siswa sekolah menengah atas analisis kesulitan menggambar perspektif mata pelajaran gambar teknik analisis kesulitan siswa melalui tahap-tahap pemecahan masalah materi stoikiometri analisis ketepatan instruksi kegiatan praktikum lembar kerja siswa mata pelajaran sains kelas 1-6 sekolah dasar analisis keterampilan guru memberikan penguatan pembelajaran ips analisis deskriptif guru sekolah dasar kelas v kecamatan cireunghas kabupaten sukabumi analisis keterampilan metakognitif siswa dikembangkan melalui pembelajaran berbasis masalah materi kelarutan hasil kali kelarutan analisis keterampilan proses siswa sd melalui penerapan skenario pembelajaran berbasis pck tentang gaya gravitasi analisis kewajaran terjemahan wacana formal netral informal literer analisis kinerja customer relationship management (crm analisis kinerja ruas jalan cipto mangunkusumo kota cirebon setelah adanya cirebon super block analisis kinerja sekolah berdasarkan pendekatan manajemen mutu terpadu (tqm analisis kinerja sekolah berdasarkan pendekatan manajemen mutu terpadu (tqm analisis kinerja viral marketing brand equity smartphone nokia survei komunitas smartphone nokia jejaring sosial facebook analisis kohesi koherensi wacana tajuk rencana serta pemanfaatannya sebagai alternatif bahan ajar mata kuliah analisis wacana program studi pendidikan bahasa sastra indonesia universitas negeri medan analisis komparatif transposisi novel la symphonie pastorale karya andré gide novel terjemahan simfoni pastoral oleh apsanti djokosujatno analisis kompetensi caretaker berdasarkan skkni program pelatihan perawat lanjut usia analisis kompetensi mahasiswa jurusan pendidikan teknik mesin pelaksanaan program pengalaman lapangan (ppl analisis kompetensi profesional guru pembelajaran ips sekolah dasar sekolah dasar negeri 2 awiluar kecamatan lumbung kabupaten ciamis analisis kompetensi profesional guru pembelajaran ips sekolah dasar sekolah dasar negeri 2 awiluar kecamatan lumbung kabupaten ciamis analisis kondisi fisik teknik dasar sepakbola ekstrakurikuler sepakbola sman 2 ciamis analisis konsistensi konsepsi siswa menggunakan model analysis berdasarkan pengalaman belajar fisika materi gelombang analisis kontrastif kanyouku ki bahasa jepang idiom hati bahasa indonesia analisis kontrastif tindak tutur ucapan selamat bahasa jerman bahasa indonesia analisis kreativitas siswa memecahkan masalah matematika berdasarkan tingkat kemampuan matematika kelas penelitian deskriptif kualitatif siswa kelas vi sd negeri angkasa i kecamatan kalijati kabupaten subang analisis kredit bermasalah profitabilitas pt analisis kualitas hasil praktek budidaya ternak ruminansia peserta didik smk negeri 2 subang analisis kualitas hasil praktek busana pesta wanita mata pelajaran menjahit analisis kualitas hasil praktik adibusana mata kuliah adibusana analisis kualitas hasil praktik busana pesta anak perempuan mata pelajaran membuat busana anak analisis kualitas produk busana kerja mata pelajaran menjahit analisis kualitas produk citra merek kepuasan konsumen rumah makan sunda ampera kota bandung analisis kualitas produk kuallitas pelayanan keputusan pembelian lisung the dago boutique resto bandung analisis kualitas produk surabi berbasis organoleptik pedagang surabi kota bandung analisis kualitas soal evaluasi ujian akhir semester sman bekasi analisis latihan kalimat perfekt tema reisen buku kontakte deutsch extra analisis latihan-latihan buku ajar deutsch analisis likuiditas rentabilitas keuangan bank menilai kinerja bank syariah mandiri analisis literasi ekonomi perilaku konsumen (survey guru sma kota bandung analisis literasi hakikat sains guru biologi sma kabupaten bandung analisis literasi kuantitatif siswa sma konsep pertumbuhan perkembangan tumbuhan analisis literasi sains siswa smp pembelajaran ipa terpadu tema efek rumah kaca analisis lokasi sekolah kecamatan parongpong kab analisis makna fukugodoushi ~komu kalimat bahasa jepang analisis makna fukugoudoushi ~au kalimat bahasa jepang analisis makna kanyouku bahasa jepang menggunakan anggota tubuh mimi analisis makna verba omou (思{58; analisis marketing public relations citra politeknik pos indonesia serta dampaknya keputusan studi mahasiswa survei mahasiswa politeknik pos indonesia analisis materi pembelajaran bahasa perancis situs www analisis materi pembelajaran bahasa perancis buku complete french volume i analisis materi pembelajaran seni budaya pokok bahasan seni rupa berbasis nilai islam smp almuttaqin kota tasikmalaya tahun ajaran 2009 - 2010 analisis minat siswa smk pertanian pembangunan negeri tanjungsari menjadi penyuluh pertanian analisis miskonsepsi kesulitan belajar konsep osmosis difusi instrumen osmosis and diffusion conceptual assessment (odca analisis model kinerja bauran pemasaran jasa terpadu berbasis kearifan lokal proses keputusan pembelian rumah makan kedai mangga bandung survey pengunjung rumah makan kedai mangga jalan pelajar pejuang 45 analisis nilai kepahlawanan film « un long dimanche de fiançailles » karya jean-pierre jeunet analisis nilai-nilai humanis cerpen majalah horison pendekatan psikologi sastra sebagai bahan pembelajaran apresiasi sastra sma analisis outcomes dari blended learning bidang kompetensi tik analisis overlay pembuatan peta tingkat bahaya erosi wilayah das cimandiri kabupaten sukabumi analisis pedagogis proses belajar mengajar pendidikan jasmani sekolah menengah atas negeri se kota cimahi analisis pelaksanaan audit internal kinerja dosenstudi deskriptif analitik universitas pendidikan indonesia analisis pelatihan kompetensi pedagogik profesional guru serta dampaknya prestasi belajar siswastudi guru matematika smp kota makassar analisis pemahaman konsep siswa sma pembelajaran pencemaran lingkungan menggunakan connected teaching analisis pembelajaran berbasis produksi mata pelajaran pengelolaan induk ikan minat berwirausaha siswa smk negeri 2 subang analisis pemberdayaan masyarakat kegiatan wisata arung jeram sungai cikapundung kota bandung analisis penampilan praktek micro teaching mahasiswa program studi pendidikan tata boga penelitian terbatas mahasiswa program studi pendidikan tata boga angkatan 2009 analisis pendidikan karakter pembelajaran ipa kelas 4 sekolah dasar laboratorium percontohan upi analisis penerapan bagi hasil baitul maal wat tamwil berdasarkan manfaatnya bagi nasabah analisis penerapan bagi hasil baitul maal wat tamwil berdasarkan manfaatnya bagi nasabah analisis penerapan pembelajaran inquiry pelajaran budidaya ayam broiler smk negeri 2 subang analisis pengaruh budaya sosial psikologis pengambilan keputusan pembelian produk wisata kuliner wilayah bojonagara kota bandung survey wisatawan domestik analisis pengaruh ketersediaan sarana prasarana pendidik implementasi penjaminan mutu pendidikan dampaknya mutu hasil pendidikan kasus sekolah menengah pertama kota singkawang provinsi kalimantan barat analisis pengaruh komunikasi pemasaran terpadu citra universitas implikasinya keputusan menjadi mahasiswa survey mahasiswa universitas singaperbangsa karawang analisis pengaruh kualitas produk kepuasan konsumen lima (5 analisis pengaruh kualitas sumber daya manusia standar resep peralatan kualitas produk surabi warung colenak kota bandung analisis pengaruh minat kemampuan mahasiswa sekolah tinggi pariwisata bandung analisis pengaruh pengadaan bahan baku tenaga kerja produksi implikasinya laba suatu kasus home industry anyaman mendong kec analisis pengaruh pengetahuan gizi siswa smp keputusan pembelian makanan jajanan sekolah wilayah kecamatan banjaran kabupaten bandung analisis pengaruh servicescape keputusan pembelian etcetera café and resto bandung survei konsumen etcetera café and resto bandung analisis pengaruh sumber daya manusia peralatan varian produk bakery the amaroossa hotel bandung analisis pengaruh terapan kit praktikum skala kecil aspek psikomotor siswa kelas x sma pembelajaran larutan elektrolit larutan non elektrolit analisis pengaruh value equity brand equity brownies vannisa keputusan pembelian wisatawan domestik kota bandung analisis pengeluaran orang tua biaya sekolah peserta didik sekolah dasar sekolah dasar negeri lengkong kecamatan bojongsoang kabupaten bandung analisis pengembangan karakter siswa melalui pembelajaran inkuiri terbimbing topik kelarutan hasil kali kelarutan analisis pengembangan potensi dapur hawu sebagai daya tarik wisatadi kampoeng ladang kabupaten sumedang analisis penggunaan bahasa indonesia soal ebtanas slta studi deskriptif-analitis penggunaan bahasa indonesia soal ebtanas slta tingkat keterpahamannya bagi siswa kelas iii sma provinsi daeah istimewa aceh analisis penggunaan kakujoshi no ga sebagai penanda subjek anak kalimat menerangkan nomina analisis penggunaan mamonaku sugu sassoku tadachini sebagai sinonim analisis penggunaan verbpartikel hin und her roman das herz des piraten karya pludra analisis penguasaan hakikat sains guru biologi sma penerapannya pengembangan lks analisis peningkatan kemampuan siswa melalui kegiatan unit produksi program studi keahlian tata boga kompetensi keahlian jasa boga smk negeri 9 bandung analisis peranan guru pendidikan karakter pembelajaran ips sekolah dasar kelas 5 segugus 4 uptd pendidikan kecamatan batujajar kabupaten bandung barat analisis perbaikan menu unpopular restoran dapur sunda kota jakarta analisis perbandingan kondisi fisik pemain sepak bola pemain futsal studi deskriptif kuantitatif komparatif ssb saswco maestro futsal analisis perbandingan pertumbuhan investasi sebelum sesudah penerapan flat rate penerimaan pajak penghasilan studi wajib pajak badan provinsi banten analisis perbandingan produk minuman kemasan teh hitam melati analisis perbandingan sistem tradisional sistem activity based costing perhitungan harga pokok produksi pt analisis perencanaan strategik mutu sekolah sekolah menengah pertama negeri kota bandung analisis persepsi pengunjung daya tarik coca cola plant tour pt analisis persepsi siswa smk industri mengenai tingkat kepentingan indikator employability skills analisis personality lifestyle socially responsible consumption survei konsumen the face shop paris van java bandung analisis pertumbuhan murid pelaksanaan wajib belajar pendidikan dasar 9 tahun implikasinya kebutuhan tenaga guru sarana prasarana pendidikan kotamadya banda aceh analisis perubahan ajektiva menjadi nomina analisis phet ph scale membangun konsep larutan asam basa keterampilan proses sains siswa sma analisis place branding meningkatkan citra kabupaten purwakarta serta implikasinya keputusan mengunjungi destinasi pariwisatasurvei wisatawan nusantara berkunjung ke kabupaten purwakarta analisis potensi kesenian sebagai daya tarik wisata desa nagrak kabupaten subang analisis potensi pariwisata pulau karimun provinsi kepulauan riau analisis potensi seni tari sebagai daya tarik wisata kabupaten indramayu analisis potensi visual sebagai dayatarik wisata universitas pendidikan indonesia analisis potensi wisata paralayang sebagai pengembangan wisata minat khusus gunung panten kabupaten majalengka analisis produk kriya kap lampu anyam desa cisayong kecamatan cisayong kabupaten tasikmalaya analisis profesionalisme auditor dilihat dari tipe kap hirarki jabatan kap wilayah bandung survei 10 kantor akuntan publik analisis profil kemampuan multirepresentasi siswa berdasarkan hasil tes uraian terbatas tes uraian terstruktur materi bunyi smp analisis profil kemampuan multirepresentasi siswa berdasarkan hasil tes uraian terbatas tes uraian terstruktur materi bunyi smp analisis profil kompetensi guru pertama smk teknik otomotif ditinjau dari profesionalisme guru analisis profil model mental siswa sma faktor-faktor mempengaruhinya topik larutan penyangga analisis program akselerasi bagi siswa cerdas istimewa dilihat dari prestasi akademik kecerdasan emosional kreativitas siswa analisis program pelatihan kinerja karyawan departemen front office hotel lido lakes resort & conference bogor analisis proses produksi bubur ayam mg analisis proses produksi produk unggulan pengaruhnya kepuasan konsumen rumah makan sunda khas cibiuk se-kota bandung analisis ragam gerak tari wayang karya raden ono lesmana kartadikusumah padepokan sekar pusaka kabupaten sumedang analisis rekayasa nilai pembangunan struktur mall st analisis resolusi konflik antar umat beragama perspektif pendidikan kewarganegaraan berbasis masyarakat analisis respon aktivitas belajar siswa sma pembelajaran fisika berbasis hypothetical learning trajectory analisis retail service quality (rsq analisis right issue perubahan harga saham analisis semantik bahasa argot dialog film jeux d’enfants karya yann samuell analisis semantik bahasa argot novel une seconde chance karya patrick cauvin analisis semiotik vcd pembelajaran menggambar kreatif bersama oistein kristiasen faber-castell seri 4 analisis semiotis kumpulan cerpen berhala karya danarto sebuah studi deskriptif sebagai upaya memilih model pengajaran cerpen lptk analisis seni grafis karya seniman hidayat periode berkarya tahun 1991 - 1995 biografi karyanya analisis 'shorai' 'mirai' sebagai sinonim analisis sistem power window toyota tgn 40 tipe v tahun 2004 analisis siswa berkesulitan belajar jurusan teknik audio video smk negeri 6 bandung analisis sosiopragmatik l’impératif film les enfants de timpelbach karya nicolas bary analisis stilistika nilai-nilai moral nyanyian rakyat bugis kumpulan teks elong ugi serta implikasinya perangkat pembelajaran sastra smp negeri 2 sinjai analisis struktur makna cerita rakyat dayak kanayatn analisis struktur makna cerita rakyat dayak kanayatn analisis struktur nilai moral pantun rubrik bujang besaot surat kabar bangka pos pemanfaatannya sebagai alternatif bahan ajar sastra sma analisis struktur materi proses pembelajaran sains kelas iv sekolah dasar analisis struktur penyajian materi cahaya guru sudah tersertifikasi belum tersertifikasi pembelajaran ipa sd analisis struktur wawacan surya ningrum pikeun bahan pangajaran maca carita buhun sma kelas xii1 analisis struktural jeung semiotik dina novél sudagar batik karangan ahmad bakri pikeun bahan pangajaran aprésiasi sastra sma analisis struktural puisi karya anakanak usia 7-11 tahun sebagai bahan pembelajaran bahasa sastra indonesia sekolah dasar analisis tanggapan wisatawan mengenai benda koleksi keputusan berkunjung ke museum sri baduga analisis tentang penggunaan keterampilan dasar mengajar bervariasi pembelajaran ips sekolah dasar penelitian deskriptif sdn sirnasari kecamatan sariwangi kabupaten tasikmalaya analisis tingkat bahaya longsor keberadaan permukiman kecamatan parongpong kabupaten bandung barat analisis tingkat kepuasan pengunjung kualitas pelayanan pemandu museum konperensi asia afrika bandung analisis tingkat pemahaman aparatur pemerintah mengenai psap no analisis tingkat penguasaan siswa pelajaran praktikum smk negeri 6 bandung proses pembelajaran mata pelajaran praktikum mesin kayu smk negeri 6 bandung analisis tingkat penguasaan siswa pelajaran praktikum smk negeri 6 bandung proses pembelajaran mata pelajaran praktikum mesin kayu smk negeri 6 bandung analisis tokoh antagonis sastra anak jenis dongeng karya charles perrault analisis tuturan pembelajaran berbicara melalui metode timbal balik (reciprocal teaching analisis ungkapan sambung –nagara -tsutsu -kuseni sebagai pengungkap makna pertentangan novel sannenme no irisu karya genchi akira analisis unsur intrinsik fiksimini basa sunda karangan hadi aks dina grup facebook fiksimini basa sunda analisis unsur naturalisme novel l’inondation karya émile zola melalui pendekatan strukturalisme genetik analisis validitas jeung réliabilitas dina soal ujian ahir semester 1 basa sunda mts analisis validitas jeung réliabilitas dina soal ujian ahir semester 1 basa sunda mts analisis visual kriya rotan desa leuwilaja kecamatan sindangwangi kabupaten majalengka analisis visual masjid baiturrahmah (dermayu analisis visual poster pertunjukan teater sunda kiwari tahun 1979-1995 analisis volume perdagangan saham abnormal return saham sebelum sesudah stock split perusahaan melakukan stock split tahun 2010-2012 bei analisis wacana kritis tentang pemberitaan perempuan teks berita tabloid realita analisis wacana sistem ekskresi buku pelajaran ipa terpadu smp buku pelajaran biologi sma analyse der anwendung von gemeinsamen europäischen referenzrahmen beim deutschlernen an den oberschulen in bandung analyse des strategies d’apprentissage de langue chez les apprenants du français langue étrangere (fle analysis of teacher involvement in kkg and improvement of pedagogic competence and its impact on teaching performance quality survey of primary school teachers in the district of west metro analysis of translation strategies and meaning transfer in translating the four bilingual children storybooks indonesia - english animasi 3 dimensi meningkatkan pemahaman materi sistem fungsi organ pernapasan manusia anak tunarungu kelas v sdlb aplikasi badminton mini pembelajaran keterampilan dasar lob bertahan permainan bulutangkis aplikasi hasil pelatihan pamong belajar pengembangan program pendidikan luar sekolah bpkb jayagiri bandung jawa barat aplikasi lesson study berbasis sekolah kepemimpinan kepada sekolah peningkatan kinerja mengajar guru aplikasi metode proyek berkebun mengembangkan kreativitas anak usia dini anak usia 5-6 tahun tk terpadu tunas krida nusantara bandung aplikasi model pembelajaran direct instruction meningkatkan proses pembelajaran sepak sila permainan sepak takraw kelas v sd negeri conggeang i kecamatan conggeang kabupaten sumedang aplikasi model sinektik pembelajaran tari meningkatkan interaksi sosial kreativitas siswa sd inklusif aplikasi pembelajaran olah tubuh keterampilan menari siswa kelas x smk negeri 10 bandung aplikasi pembelajaran sains berbasis budaya lokal meningkatkan minat pemahaman konsep siswa sd aplikasi pendekatan inkuiri pengembangan nilai kemanusiaan kepedulian sosial pembelajaran pengetahuan sosial topik hak azasi manusia aplikasi pengenalan suara pembicara menggunakan hidden markov model (hmm aplikasi penggunaan pendekatan reward and punishment pembelajaran berbicara bahasa jepang siswa sma penelitian eksperimen semu siswa kelas x-6 sma negeri 1 rancaekek tahun ajaran 2012/2013 application de la méthode word square dans l’apprentissage du vocabulaire français pour augmenter la competénce de la production écrite application de la méthode word square dans l’apprentissage du vocabulaire français pour augmenter la competénce de la production écrite application of model empirical inductive learning cycle to increase student knowledge and ability mathematical reasoning in junior high school approval sheet teachers’ questions and students’ responses in efl classroom a case study in a public senior high school in bandung apresiasi tari badaya seni tarawangsa siswa paud ananda putra bungur sumedang asesmen aspek emosi mengetahui hambatan perkembangan emosi anak prasekolah asimilasi nilai kekeluargaan lintas etnis studi analisis tentang transformasi nilai kekeluargaan dayak melayu transmigran jawa timur desa rasau jaya kabupaten kubu raya kalimantan barat aspék psikolinguistik sosial dina babasan jeung paribasa sundaulikan gambaran watek urang sunda atribut produk pensil 2b staedtler serta pengaruhnya keputusan pembelian atribut produk pensil 2b staedtler serta pengaruhnya keputusan pembelian survei siswa kelas 3 sma negeri 23 bandung pengguna pensil 2b staedtler babandingan kamampuh maca pedaran (basa sunda bahan ajar sastra apresiatif ekspresif kontekstual siswa kelas v sd basa sunda dialék brebes kacamatan salem pikeun bahan pangajaran maca smp beberapa faktor mempengaruhi keberhasilan program imunisasi kecamatan banjaran kabupaten bandungditinjau dari dimensi pendidikan luar sekolah belajar menggunakan media balok meningkatkan kreativitas kemampuan berhitung permulaan anak usia dinistudi eksperimen kuasi kelompok b taman kanak-kanak tunas bangsa desa kramat mulya kecamatan kramat mulya kabupaten kuningan tahun ajaran 2010/2011 berjudul efektivitas teknik praktek berpasangan (practice rehearsal pairs biaya pengelolaan sekolah produktivitas kerja guru bimbingan belajar berbasis teknik mind map meningkatkan daya ingat peserta didik underachiever studi eksperimen kuasi peserta didik underachever kelas xi sman 1 palimanan kabupaten cirebon tahun pelajaran 2012/2013 bimbingan belajar meningkatkan motivasi belajar siswa studi quasi eksepriment siswa kelas viii smp negeri 1 gas kabupaten indragiri hilir propinsi riau tahun ajaran 2012/2013 bimbingan pendekatan ekologisuntuk mengembangkan karakter islami anak usia dini kegiatan pembelajaran tk khas daarut tauhiid bandung bimbingan guru mengoptimalkan perkembangan kognitif anak usia dinistudi deskriptif tk se- kecamatan jatinangor kabupaten sumedang bimbingan kelompok pendekatan analisis transaksional mengembangkan konsep diri siswa studi eksperimen semu kelas x sma negeri 6 bandung tahun ajaran 2011/2012 bimbingan mereduksi kecemasan akademik peserta didik melalui teknik self affirmation bimbingan mereduksi kecemasan akademik peserta didik melalui teknik self affirmation penelitian pra-eksperimen peserta didik kelas x sma lab-school upi bandung tahun ajaran 2011/2012 bimbingan pengembangan konsep diri siswa tunanetra tingkat lanjutan pertama dislbn a bandung bimbingan pribadi sosial mengembangkan empati budaya siswa sma studi pra eksperimen siswa kelas xi sma bpi 1 bandung tahun ajaran 2012-2013 bimbingan pribadi sosial mengembangkan kemandirian perilaku siswa studi deskriptif siswa kelas xi sma pasundan 8 bandung tahun ajaran 2013/2014 bimbingan pribadi sosial mengembangkan kesadaran gender siswa studi pra eksperimen siswa kelas iii sd laboratorium percontohan upi bandung tahun ajaran 2013/2014 bimbingan pribadi sosial meningkatkan penyesuaian diri anak berbakat akademik studi pengembangan program siswa kelas akselerasi sman 3 bandung tahun ajaran 2013/2014 bimbingan pribadi meningkatkan penerimaan diri siswa studideskriptifterhadapsiswakelasviii smpnegeri 19 bandung tahunajaran 2012/2013 blackmetal culture grafis cetak saring blokade ekonomi napoleon bonaparte dampaknya perekonomian inggris tahun 1806-1814 bola leungeun seuneu (boles brand image kawasan maribaya sebagai objek wisata berwawasan lingkungan (ekowisata brand image kawasan maribaya sebagai objek wisata berwawasan lingkungan (ekowisata budaya organisasi peningkatan mutu pendidikan persekolahan swasta studi kohesivitas kelenturan daya dukung budaya organisasi peningkatan mutu proses pendidikan persekolahan aj-irsyad al-islamiyyah kotamadya tegal budaya pesta laut nadran sebagai upaya melestarikan kearifan lokal mengembangkan civic culture budaya politik mahasiswa tudi deskriptif aktivis mahasiswa universitas pendidikan indonesia budaya politik masyarakat adat kampung naga ( masyarakat adat kampung naga kabupaten tasikmalaya pemilihan gubernur jawa barat tahun 2013 budaya upacara adat mermule sebagai implementasi kepatuhan nilai-nilai adat studi deskriptif masyarakat desa jatibarang kabupaten indramayu budidaya ikan air tawar desa selajambe kecamatan cisaat kabupaten sukabumi budidaya ikan air tawar desa selajambe kecamatan cisaat kabupaten sukabumi buku teks pelajaran sejarah smaanalisis isi wacana nasionalisme campur kode menulis karangan esai siswa kelas xii smk negeri 15 bandung taun ajaran 2012/2013 campur kode dina nulis surat pribadi siswa kelas viii smpn 1 lembang carios babad awak saliraedisi teks telaah kandungan isi carita maung padjajaran kecamatan suradestruktur proses penciptaan konteks penuturan fungsi makna carita pantun bujang pangalasan ulikan struktural sémiotik jeung étnopédagogi cd interaktif pengenalan sejarah sahabat nabi berbasis games anak-anak citra diri perempuan perokok aktif berfokus self-idea tiga perempuan perokok aktif kota bandung citra diri perempuan perokok aktif berfokus self-idea tiga orang perempuan perokok aktif kota bandung citra perempuan papua novel tanah tabu karya anindita s citra perempuan papua novel tanah tabu karya anindita s civil engeneering of education students perceptions of learning infrastructure maintenance classroom interaction patterns in team teaching model in an efl classroom a qualitative study at an integrated islamic elementary school classroom interactionan analysis of teacher talk and student talk in english for young learners (eyl collaborative learning through feedback in efl writing class an action research collaborative ranking tasks (crt conformity in district location minimarket babakan ciparay bandung content analysis of an english textbook rangka peningkatan kesadaran hukum lembaga pemasyarakatan klas ii a ambon dampak aktivitas bersepeda kemampuan short term memory long term memory komunitas bike to work bandung dampak aktivitas bersepeda kesehatan mental emosional komunitas pekerja bersepeda bike to work bandung dampak aktivitas industri pengolahan kayu putih lingkungan desa jatimunggul kecamatan terisi kabupaten indramayu dampak aktivitas senam aerobik tari zumba tari jaipong perubahan kadar lemak tubuh dampak alih fungsi lahan pertanian perubahan orientasi mata pencaharian kecamatan cikarang timur kabupaten bekasi perubahan mata pencaharian petani padi sawah ke sektor informal dampak darwinisme sosial perkembangan nazisme jerman tahun 1921-1945 dampak gaya kepemimpinan pelatih perilaku sosial atlet cabang olahraga bola volistudi deskriftif atlet bola voli klub bahana bina pakuan bandung dampak industri pengolahan batu andesit kondisi lingkungan kecamatan bantarujeg kabupaten majalengka dampak industri sepatu pt dampak kawasan wisata masyarakat lokal menangani wisatawan emte highland resort dampak keberadaan tempat pembuangan akhir (tpa dampak kecemasan siswa hasil belajar renang dampak kegiatan ekstrakurikuler olahraga perolehan hasil belajar siswaacademic achievement dampak kegiatan olahraga fungsi sosial siswa dampak kegiatan wisata kampung cikidang kondisi sosial ekonomi masyarakat desa langensari kecamatan lembang kabupaten bandung barat dampak keterlibatan orang tua program paud kesinambungan pola asuh keluarga dampak latihan speed agility quickness keterampilan teknik dasar dribbling futsal (study eksperimen tim futsal man 1 kota bandung dampak metode latihan medicine ball release push-up with partner metode latihan 8-point star drill kecepatan reaksi penjaga gawang sepakbolastudi eksperimen siswa sekolah sepak bola psbum dampak metode story telling media boneka penguasaan kosa kata dasar kemampuan berbicara anak lstudi eksperimen kuasi anak kelompok b taman kanak-kanak kencana mulya kecamatan margahayu kabupaten bandung dampak pelatihan budidaya jamur peningkatan kehidupan masyarakatstudi efektivitas pelatihan budidayajamur desa cihanjuang kecamatan parongpong kabupaten dt ii bandung dampak pelatihan kecakapan hidup home industry pengolahan hasil perikanan meningkatkan pendapatan warga belajar kelompok belajar binaan uptd sanggar kegiatan belajar (skb dampak pelatihan kejar usaha pengembangan berwiraswasta percetakan sablon skb kendal dampak pelatihan kewirausahaan kinerja pengusaha kecil dampak pelatihan kewirausahaan kinerja pengusaha kecil diselenggarakan oleh pt dampak pelatihan pemeliharaan terumbu karang meningkatkan usaha budi daya ikan laut kecamatan pulau tiga kabupaten natuna dampak pembelajaran ekstrakurikuler penjas hasil belajar kognitif afektif psikomotor siswa sman 1 wanayasa kab dampak pembelajaran hoki perkembangan karakter kebugaran jasmani siswa sma negeri 26 bandung dampak pendekatan bermain pembelajaran pendidikan jasmani kebugaran jasmani perkembangan sosial dampak penerapan bermain media gambar seri mengembangkan keterampilan berbicara penguasaan kosa kata anak usia dinistudi eksperimen kuasi anak taman kanak-kanak kartika siliwangi 33 kabupaten majalengka dampak penerapan latihan lari assisted sprinting latihan lari resisted srinting metode repetisi peningkatan kemampuan akselerasi sprint dampak penerapan metode participatory rural apraisal (pra dampak penerapan metode pemecahan masalah kemampuan berpikir siswa pengajaran matematika tentang pembelajaran konsep fungsi turunannya sekolah menengah umum negeri 5 bandung dampak penerapan pembelajaran group investigation berbasis inquiri topik keanekaragaman tumbuhan penalaran sikap siswa kelas x dampak penerapan prinsip individualisasi program latihan fisik peningkatan kecepatan gerak (speed & agility dampak pengembangan pembelajaran inkuiri laboratorium kemampuan inkuiri berpikir kreatif penguasaan konsep siswa materi sifat koligatif larutan dampak penggunaan alat permainan playdough pengembangan motorik halus kreativitas anak usia dini studi kuasi eksperimen anak kelas b taman kanak-kanak armia kota bandung dampak peristiwa 11 september 2001 kehidupan pemeluk agama islam amerika serikat (2001-2011 dampak perkembangan pariwisata kondisi ekonomi sosial desa cihideung dampak permainan kartu toyyibah penguasaan kosa kata perilaku keagamaan anak usia dinistudi eksperimen kuasi kelompok b taman kanak-kanak negeri pembina sumedang dampak pola pelatihan model korea prestasi atlet atletik jawa barat persiapan pon xviii riau 2012 dampak program belajar pendidikan ketrampilan keliling peningkatan kehidupan warga belajar kejar paket asuatu warga belajar kejar paket a kecamatan lembang bandung dampak sertifikasi kinerja guru pendidikan kewarganegaraan kota bandung dampak tingkat pemahaman dekan tentang fungsi utama lingkungan kerja eksekutif pembinaan tenaga edukatif tetap serta dampak kelanjutannya penampilan kerjasuatu studi universitas/institut swasta lingkup kopertis wilayah iii dari dwi tunggal sampai dwi tanggal kajian historis mengenai dinamika hubungan politik ir dari sarekat islam sampai salah asuhan jejak langkah abdul muis masa pergerakan nasional 1912-1928 deixis uses and reasons of their using in opera van java desain implementasikurikulum tingkat satuan pendidikan mata pelajaran bahasa inggris kelas vii smp negeri kabupaten majalengka desain pengembangan modul berbasis multimedia pembelajaran dasar teknik telekomunikasi desain uji keterbacaan buku ajar kimia materi senyawa benzena turunannya serta makromolekul lipid melalui konteks batik desain dedaktis konsep limit fungsi trigonometri pembelajaran matematika sma desain didaktis konsep faktorisasi aljabar pembelajaran matematika smp desain didaktis konsep fungsi pembelajaran matematika smpsuatu penelitian kualitatif siswa kelas viii suatu smp bandung desain didaktis konsep garis singgung lingkaran pembelajaran matematika sekolah menengah pertama (smp desain didaktis konsep gaya gravitasi pembelajaran ipa kelas v sekolah dasar didactical design research sdn gugus v uptd pendidikan kecamatan panawangan desain didaktis konsep komposisi fungsi pembelajaran matematika sma desain didaktis konsep layang-layang belah ketupat siswa smp desain didaktis konsep limit fungsi aljabar pembelajaran matematika sma desain didaktis konsep luas daerah jajargenjang pembelajaran matematika sekolah menengah pertama (smp desain didaktis konsep luas permukaan prisma pembelajaran matematika smp berdasarkan learning obstacle learning trajectory desain didaktis konsep perbandingan senilai perbandingan berbalik nilai pembelajaran matematika smp meningkatkan kompetensi matematika desain didaktis konsep perbandingan trigonometri pembelajaran matematika sma kelas x desain didaktis konsep teorema sisa pembelajaran matematika sekolah menengah atas (sma desain didaktis model problem solving konsep luas daerah segitiga segiempat meningkatkan kompetensi strategi matematis siswa smp desain didaktis model problem solving mengatasi learning obstacle pokok bahasan teorema pythagoras meningkatkan sikap matematis siswa smp desain didaktis pembelajaran ipa materi cahaya sekolah dasar desain didaktis pesawat sederhana pembelajaran ipa kelas v sekolah dasar desain didaktis sifat-sifat segiempat pembelajaran matematika sekolah menengah pertama berdasarkan learning obstacle learning trajectory desain pelatihan perencanaan pembelajaran berbasis inkuiri bagi guru kimia sma konsep larutan elektrolit non elektrolit desain pembelajaran kimia bermuatan nilai pokok bahasan peran kimia kehidupan desain pembelajaran kimia bermuatan nilai subtopik golongan periode desain pembelajaran kimia bermuatan nilai subtopik pembentukan ikatan ion ikatan kovalen desain pembelajaran kimia bermuatan nilai subtopik sifat-sifat keperiodikan unsur desain pembelajaran kimia bermuatan nilai topik hukum-hukum dasar kimia desain pembelajaran kimia bermuatan nilai topik larutan elektrolit non elektrolit deteksi dini masalah perkembangan anak taman kanak-kanak menggunakan kpsp (kuisioner pra skrining perkembangan determinasi madrasah efektif pencapaian keunggulan madrasah aliyah negeri insan cendekia serpong developing an english subject syllabus for chemistry students a survey at a state university in bandung developing materials of an efl reading courseware prototype for 8th grade students of junior high school developing students’ speaking ability through genre-based teaching action research with the first year students in a senior high school developpement du module du français de la restauration en approche communicative a akademi pariwisata makassar diagnosis miskonsepsi siswa materi kalor menggunakan three-tier test die effektivität des einsatzes des kreuzworträtsels zur erweiterung des deutschen wortschatzes dilema perkembangan masyarakat ternate menghadapi tarikan tradisi medernitas studi tentang orientasi nilai bangsawan ternate dilema perkembangan masyarakat ternate menghadapi tarikan tradisi modernitas (studi tentang orientasi nilai bangsawan ternate dimensi kreativitas four p’s anak usia 12-14 tahun skaci (sekolah komputer aku cinta indonesia dinamika kesenian tanjidor kabupaten bekasisuatu tinjauan sosial budaya tahun 1970-1995 dinamika keuompok kelompok pengajian sebagai satuan pendidikan luar sekolahstudi komparatif dua kelompok pengajian ibu-ibu kecamatan gading cempaka kotamadya bengkulu dinamika masyarakat konversi lahan pertanian serta pengruhnya pengetahuan tentang lingkungan kbu dinamika multikulturalisme kanada (1968-2006 dinamika partai masyumi jawa barat periode tahun 1950-1960 dinamika partai masyumi jawa barat periode tahun 1950-1960 dinamika psikologis waria proses penerimaan diri presentasi diri waria ‘sani’ desa tanjung ratu ilir kabupaten lampung tengah provinsi lampung diversifikasi pangan bahan dasar terigu melalui program roti masuk desa balai pendidikan latihan pariwisata bandung rangka meningkatkan keterampilan ibu-ibu pkk kecamatan sukasari kelurahan sukabungah kecamatan sukajadi kotamadya bandung dukungan kemampuan agility keterampilan poomsae basic satu ekstrakurikuler taekwondo sman 1 lembang dukungan kurikulum muatan lokal kurikulum inti program studi pendidikan agama islam sekolah tinggi agama islam negeri pontianak dukungan kurikulum politeknik kebutuhan industri studi evaluaiif kurikulum program studi teknik produksi jurusan teknik mesin politeknik institut teknologi bandung dukungannya kebutuhan tenaga kerja p dukungan sosial penderita kanker nasofaring berdasarkan gender studi multi-kasus empat orang pasien kanker nasofaring rsup dr education and microfinance as a combined empowerment approach for the microfinance clientsa multiple cases study of two local microcredit organizations in bandung city in indonesia efek model pembelajaran konstruktivis kognitif-sosial non-konstruktivis konvensional hasil belajar fisika dasar mahasiswa program s1 pmipa lptk-fkip universitas efeketivitas pembelajaran aktif model l efektifitas media animasi flip book peningkatan hasil belajar siswa ranah kognitif mata pelajaran ips smpn 40 kota bandung efektifitas media gambar hasil belajar ipa pokok bahasan sistem pernapasan manusia penelitian eksperimen siswa kelas v sdn se-gugus iii desa galanggang kecamatan batujajar kabupaten bandung barat efektifitas media tali pas meningkatkan kemampuan kosakata bahasa jepang siswa kelas ekstrakulikuler japanese club sma labschool upi bandung efektifitas media tali pas meningkatkan kemampuan kosakata bahasa jepang siswa kelas ekstrakulikuler japanese club sma labschool upi bandung efektifitas media tali pas meningkatkan kemampuan kosakata bahasa jepang siswa kelas ekstrakulikuler japanese club sma labschool upi bandung efektifitas metode active learning pembelajaran insya studi eksperimen kuasi siswa kelas x madrasah aliyah al-ihsan baleendah bandung efektifitas model blended learning moodle meningkatkan hasil belajar siswa mata pelajaran fisika studi pemanfaatan e-learning kelas x sma cakra buana kota depok efektifitas model pembelajaran konstruktivisme menggunakan media simulasi virtual pembelajaran sifat mekanik bahan meningkatkan kemampuan kognitif dikaitkan gaya berpikir siswa smk efektifitas model pembelajaran tutor sebaya meningkatkan hasil belajar siswa kelas x kompetensi dasar menggambar sketsa smkn 12 bandung efektifitas pembelajaran berbasis web meningkatkan hasil belajar peserta didik mata pelajaran teknologi informasi komunikasi (tik efektifitas pendidikan pelatihan (diklat efektifitas penerapan model cooperative learning tipe stad standar kompetensi mengidentifikasi hama penyakit ikan kelas xi api smkn 1 karangtengah efektifitas penerapan teknik pembelajaran probing-prompting meningkatkan hasil belajar siswa mata pelajaran ips sekolah dasar penelitian tindakan kelas mata pelajaran peninggalan sejarah indonesia kelas iv sdn wancimekar i kecamatan kotabaru kabupaten karawang tahun pelajaran 2012/2013 efektifitas penggunaan cnc simulator meningkatkan hasil belajar mata pelajaran cnc dasar smkn 6 bandung efektifitas penggunaan game pembelajaran konsep rpg (role playing game efektifitas penggunaan media audiovisual pembelajaran kosakata bahasa arab efektifitas penggunaan media lagu berbahasa jepang motivasi belajar bahasa jepang bagi pembelajar bahasa jepang kelas xi sma lab school upi bandung efektifitas penggunaan servis pertandingan bola voli putri kompetisi livoli divisi utama 2013 efektifitas perda nomor 11 tahun 2005 bagi perokok menjadi warga negara baik perbandingan ruang publik pemerintah ruang publik swasta kecamatan sukasari kota bandung efektifitas permainan kartu bergambar kemampuan memecahkan masalah penguasaan kosa kata anak usia dini studi eksperimen kuasi kelompok b taman kanak-kanak santa ursula bandung tahun ajaran 2009 - 2010 efektifitas pola pendidikan kemandirian bagi masyarakat golongan ekonomi lemahidentifikasi karakteristik proses hasil pendidikan nanny and governess dikembangkan oleh lembaga pendidikan keterampilan citra bunda jakarta efektifitas sistem pelatihan kewirausahaan latar belakang instruktur pembentukan sikap motivasi berwirausaha mahasiswa suatu studi jurusan manajemen fakultas ekonomi universitas al-ghifari bandung efektifitas strategi predict- observe- explain bermuatan nilai meningkatkan pemahaman sikap nilai siswa konsep struktur fungsi jaringan tumbuhan efektifitas team games tournament meningkatkan penguasaan kosakata bahasa jepang efektifitas team games tournament meningkatkan penguasaan kosakata bahasa jepang efektifitas teknik story retelling meningkatkan kemampuan choukai penelitian eksperimen mahasiswa jurusan pendidikan bahasa jepang universitas pendidikan indonesia tingkat ii tahun ajaran 2012/2013 efektipitas model pelatihan konsep mentoring meningkatkan kompetensi kepala sekolah guru berkaitan implementasi pendidikan inklusif sdn x kabupaten bandung efektivitas assertive training menangani korban cyberbullying penelitian eksperimen kuasi siswa kelas viii smp negeri 5 bandung tahun pelajaran 2013/2014 efektivitas bahan ajar mandiri siswa sma materi ikatan kimia melalui empat tahap pengolahan bahan ajar efektivitas bahan ajar mandiri siswa sma materi sifat-sifat periodik unsur melalui empat tahap pengolahan bahan ajar efektivitas biji jayanti (sesbania sesban efektivitas bimbingan kelompk teknik modeling meningkatkan self effiacay akademik siswa studi eksperimen kuasi kelas x sekolah menengah atas laboratorium unversitas pendidikan indonesia bandung efektivitas bimbingan kelompok teknik latihan mnemonic meningkatkan daya ingat siswa sma studi experiment siswa kelas xi sma negeri 24 bandung tahun ajaran 2011-212 efektivitas bimbingan kelompok teknik permainan mengurangi perilaku menyimpang siswa efektivitas bimbingan kelompok teknik storytelling meningkatkan self efficacy siswa efektivitas bimbingan kelompok melalui metode permainan meningkatkan fungsi otak kanan siswastudi quasi-eksperiment siswa kelas viii madrasah tsanawiyah persis tarogong garut efektivitas bimbingan kelompok melalui permainan tradisional meningkatkan keterampilan sosial siswa efektivitas bimbingan kelompok melalui teknik bercerita mengembangkan karakter siswa efektivitas bimbingan kelompok melalui teknik bercerita mengembangkan karakter siswa efektivitas bimbingan kelompok melalui teknik permainan meningkatkan perilaku prososial siswastudi kuasi eksperimen siswa kelas x sma laboratorium percontohan upi bandung tahun pelajaran 2010-2011 efektivitas bimbingan kelompok melalui teknik role playing menangani perilaku bullying studi kuasi eksperimen siswa sekolah dasar laboratorium percontohan upi bandung efektivitas bimbingan kelompok meningkatkan kecerdasan emosional siswa studi kuasi eksperimen siswa kelas vii sekolah menengah pertama negeri 2 cicalengka-bandung tahun ajaran 2010/2011 efektivitas bimbingan kelompok meningkatkan kompetensi intrapersonal siswa studi pra eksperimen siswa kelas viii smpn 4 purwadadi kabupaten subang tahun ajaran 2013/2014 efektivitas bimbingan melalui teknik role playing menanggulangi perilaku bullying siswa studi kuasi eksperimen siswa kelas xi sma perguruan kristen methodist indonesia 1 (pkmi 1 efektivitas bimbingan pranikah mengembangkan sikap positif remaja pernikahan studi pra-eksperimen siswa kelas xi sma pgri 1 bandung tahun ajaran 2013/2014 efektivitas bimbingan teman sebaya meningkatkan kemampuan komunikasi interpersonal siswa efektivitas bimbingan teman sebaya meningkatkan motivasi belajar siswa penelitian eksperimen kuasi siswa kelas vii smp negeri 1 lembang tahun ajaran 2013/2014 efektivitas brain gym meningkatkan keterampilan belajar siswa kelas x sman 99 jakarta timur efektivitas hasil latihan footwork berpola tetap footwork berpola tidak tetap kelincahan kaki atlet bulutangkis studi eksperimen siswa ekstra kurikuler bulutangkis sdn 3 serang cirebon efektivitas implementasi dampak akreditasi mutu layanan sekolah menengah kejuruan studi tentang efektivitas implementasi dampak akreditasi sekolah mutu layanan pendidikan sekolah menengah kejuruan kabupaten ciamis jawa barat efektivitas implementasi kebijakan pendidikan pelatihan kepemimpinan tingkat iv meningkatkan kinerja pejabat struktural eselon-4 lingkungan pemerintah kabupaten sukabumi efektivitas implementasi kebijakan pendidikan pelatihan kepemimpinan tingkat iv meningkatkan kinerja pejabat struktural eselon-4 lingkungan pemerintah kabupaten sukabumi efektivitas implementasi kebijakan pendidikan pelatihan kepemimpinan tingkat iv meningkatkan kinerja pejabat struktural eselon-4 lingkungan pemerintah kabupaten sukabumi efektivitas implementasi kebijakan wajar dikda 9 tahun bagi anak dari keluarga miskin studi evaluasi kinerja kebijakan kabupaten cianjur efektivitas implementasi manajemen sekolah bermutu sub judul studi tentang hubungan antar komponen sekolah bermutu mutu kinerja smpn rsbi wilayah jawa barat efektivitas implementasi model pembelajaran direct instruction hasil belajar siswa penelitian kuasi eksperimen mata pelajaran akuntansi efektivitas implementasi model pembelajaran direct instruction hasil belajar siswa penelitian kuasi eksperimen mata pelajaran ekonomi akuntansi sma n kota bukittinggi tahun ajaran 2010/2011 efektivitas implementasi model pembelajaran pendidikan kewarganegaraan berbasis portofolio efektivitas implementasi praktek laboratorium komputer prestasi belajar siswa smk negeri 1 sukabumi efektivitas implementasi sistem manajemen mutu (smm efektivitas kegiatan information gap pemahaman siswa perubahan kata kerja ke bentuk te efektivitas kegiatan persatuan orang tua murid (pom efektivitas kepemimpinan lembaga swadaya masyarakat pembinaan olahraga prestasi efektivitas kepemimpinan lembaga swadaya masyarakat pembinaan olahraga prestasi efektivitas konseling analisis transaksional meningkatkan karakter keberanian siswa smp efektivitas konseling behavioral teknik desensitisasi sistematis mereduksi kecemasan menghadapi ujianstudi eksperimen siswa kelas x sma negeri 2 singaraja tahun ajaran 2010/2011 efektivitas konseling kelompok menggunakan media clay meningkatkan perilaku altruisme siswa efektivitas konseling kelompok teman sebaya mereduksi perilaku agresif siswa efektivitas konseling kognitif perilaku teknik restrukturisasi kognitif mereduksi kejenuhan belajar peserta didik penelitian eksperimen kuasi peserta didik kelas xii ma al-inayah bandung tahun ajaran 2013/2014 efektivitas konseling rebt pendekatan naratif meningkatkan kecerdasan emosional efektivitas konseling spiritual teistik meningkatkan kesadaran beragama mahasiswastudi kuasi eksperimen mahasiswa jurusan bimbingan konseling unnes tahun akademik 2011/2012 efektivitas kurikulum lembaga pengajaran tata busana susan budihardjo lembaga pengajaran tata busana susan budihardjo tingkat dasar lpp ariyanti - bandung periode februari 2001- agustus 2001 efektivitas layanan bimbingan kelompok teknik permainan meningkatkan konsep diri siswa studi eksperimen siswa kelas xi sma negeri 24 bandung tahun ajaran 2012/2013 efektivitas layanan bimbingan kelompok meningkatkan kematangan karier siswa sma studi quasi eksperiment siswa kelas x sekolah menengah atas negeri 14 garut efektivitas layanan dasar bimbingan mengembangkan keterampilan pengambilan keputusan siswa melalui model optimalisasi penelitian kuasi eksperimen siswa kelas xi smk bina budi purwakarta tahun ajaran 2011/2012 efektivitas manajemen pembelajaran pendidikan calon guru penjas orkes fakultas pendidikan olahraga kesehatan fpok universitas pendidikan indonesia upi bandung efektivitas manajemen pengembangan kinerja dosenstudi kualitatif manajemen kinerja dosen lingkungan iain sulthan thaha saifuddin jambi efektivitas manajemen program pemberian makanan tambahan anak sekolah (pmt-as efektivitas manajemen sistem pendidikan pelatihan prajabatan aparatur pemerintah golongan iii studi kontribusi komponen-komponen proses belajar mengajar efektivitas sistem pembelajaran dampaknya kinerja lulusan wilayah provinsi jawa barat efektivitas manajemen sistem pendidikan pelatihan sdm keperawatan tentang manajemen sistem pelatihan tenaga perawat hemodialisis rskg ny efektivitas media audio visual meningkatkan kemampuan membaca teks bahasa arab efektivitas media audio visual pembelajaran pendidikan agama islām (pai efektivitas media audio-visual situs www éféktivitas média audio-visual pikeun ngaronjatkeun kamampuh ngaregepkeun paguneman studi kuasi ékspérimén ka siswa kelas vii smp kartika xix-2 bandung taun ajaran 2012/2013 efektivitas media bande-annonce des contes meningkatkan keterampilan berbicara efektivitas media dadu huruf meningkatkan kemampuan membaca anak taman kanak-kanak kuasi eksperimen kelompok b tk negeri centeh bandung efektivitas media dadu huruf dalameningkatkan kemampuan membaca anak taman akanak-kanak efektivitas media flash card meningkatkan keterampilan menulis bahasa perancis siswa sma negeri 1 cicalengka efektivitas media flashcard peningkatan kemampuan kosakata bahasa arab efektivitas media gambar animasi peningkatan kemampuan kosakata bahasa arab penelitian quasi-eksperimen siswa kelas iv mi nurul huda rancaekek tahun ajaran 2011/2012 éféktivitas média gambar séri pikeun ngaronjatkeun kamampuh ngadongéng éféktivitas média gambar séri pikeun ngaronjatkeun kamampuh ngadongéng studi ékspérimén ka siswa kelas x sma pasundan 2 bandung taun ajaran 2013/2014 efektivitas media lagu wajib nasional pembelajaran goi (kosakata efektivitas media pembelajaran cd interaktif meningkatkan kemampuan gerak tari pembelajaran seni tari efektivitas media pembelajaran menggunakan modul berbasis web meningkatkan motivasi belajar kompetensi siswa mata pelajaran teknik jaringan smk informatika pelita nusantara efektivitas media pembelajaran menggunakan model e-learning berbasis moodle meningkatkan hasil belajar siswa mata pelajaran dasar-dasar elektronika smk negeri 2 kota cimahi efektivitas media permainan buchstabendiktat pembelajaran kosakata bahasa jerman efektivitas media permainan dice word pembelajaran kosakata bahasa jepang tingkat dasar studikuasieksperiment siswa kelas xi smk pgri lembang tahun ajara 2012/2013 éféktivitas média photostory pikeun ngaronjatkeun kamampuh nulis carpon efektivitas media wordwall pembelajaran kosakata bahasa arab efektivitas membaca pemahaman melalui model interaktif latihan menjawab pertanyaan meringkas sman @ serui papua efektivitas membaca pemahaman melalui model interaktif latihan menjawab pertanyaan meringkas sman @ serui papua efektivitas metode al-barqy meningkatkan kemampuan membaca menulis alquran anak usia 4 – 5 tahun nomor panggil efektivitas metode amśāl/analogi pembelajaran pendidikan agama islam (pai efektivitas metode asyarah meningkatkan kemampuan membaca alquran anak usia dini efektivitas metode asyarah meningkatkan kemampuan membaca al-quran anak usia dini efektivitas metode cooperative learning teknik concept sentence meningkatkan kemampuan menulis siswa éféktivitas métode kolaborasi dina pangajaran nulis aksara sunda studi ékspérimén murni ka siswa kelas x sman 1 warungkiara taun ajaran 2013/2014 efektivitas metode mind mapping peningkatan kemampuan menulis laporan pengamatan kemampuan berpikir kritis siswa mata pelajaran bahasa indonesia efektivitas metode online collaborative learning meningkatkan hasil belajar mahasiswa mata kuliah kurikulum pembelajaran efektivitas metode pembalajaran kooperatif meningkatkan keterampilan berbicara keterampilan sosial anak usia dini efektivitas metode pembelajaran invitation into inquiry berbantu multimedia meningkatkan kemampuan interpretasi siswa mata pelajaran keterampilan komputer pengelolaan informasi efektivitas metode pembelajaran ki hajar dewantara meningkatkan kesadaran ibadah harta bagi siswa sma pgii 2 bandung efektivitas metode pembelajaran kooperatif tipe stad (student teams achievement divisions efektivitas metode pembelajaran kooperatif tipe teams games tournament (tgt efektivitas metode pembelajaran role playing meningkatkan kesantunan berbahasa siswa studi kuasi eksperimen mata pelajaran budaya alam minangkabau sekolah menengah pertama 11 padang efektivitas metode pembelajaran snowball drilling meningkatkan penguasaan kosakata bahasa arab efektivitas metode praktek langsung dalammeningkatkan kemampuan gerakan penguasaan bacaan shalat anak usia dini studi kuasi eksperimen anak kelompok b tk al-khairaat kalumata kota ternate provinsi maluku utara tahun pelajaran 2011/2012 efektivitas metode quantum memory flow meningkatkan keterampilan menulis bahasa perancis siswa kelas xi bahasa sma negeri 1 cicalengka tahun ajaran 2012/2013 efektivitas metode reward proses pembelajaran bahasa jerman meningkatkan penguasaan kosakata siswa efektivitas metode targīb-tarhīb peningkatan disiplin salat studi quasi eksperimen mata pelajaran pai siswa kelas v sd laboratorium percontohan upi bandung tahun ajaran 2011/2012 efektivitas metode teams-games-tournaments (tgt efektivitas mewarnai gambar bentuk geometri mengurangi perilaku mengisap jaripenelitian eksperimen single subject research peserta didik cerebral palsy athetoid slb-d ypac bandung efektivitas model instructional games aplikasi gcompris peningkatkan hasil belajar siswa mata pelajaran matematika sekolah dasar penelitian kuasi ekperimen kelas iii sekolah dasar lab efektivitas model pembelajaran bahasa jepang sma negeri cisarua menggunakan teknik information gap efektivitas model pembelajaran berbasis pengalaman hasil belajar siswa mata pelajaran ips studi eksperimen sd segugus 03 teluknaga tangerang efektivitas model pembelajaran berorientasi kompetensi berbasis interaksi afeksionat (mabkbia efektivitas model pembelajaran circle of learning (cl efektivitas model pembelajaran cooperative integrated reading and composition (circ efektivitas model pembelajaran cooperative integrated reading and composition (circ efektivitas model pembelajaran metode dongeng menggunakan media wayang golek mengembangkan karakter persahabatan anak usia dini penelitian eksperimen semu tk islam terpadu at-taqwa kpad geger kalong bandung efektivitas model pembelajaran metode dongeng menggunakan media wayang golek mengembangkan karakter persahabatan anak usia dini penelitian eksperimen semu tk islam terpadu at-taqwa kpad geger kalong bandung efektivitas model pembelajaran heuristik vee meningkatkan penguasaan konsep kemampuan berpikir kritis siswa sma konsep sistem saraf efektivitas model pembelajaran kooperatif metode sq3r meningkatkan kemampuan siswa membaca pemahaman mata pelajaran bahasa indonesiastudi eksperimen kuasi siswa kelas vii mts al inayah kota bandung efektivitas model pembelajaran kooperatif learning tipe two stay two stray meningkatkan kemampuan berbicara bahasa arab eksperimen kuasi siswa kelas viii mts nahdhatul ulama tasikmalaya efektivitas model pembelajaran kooperatif student teams achievement divisions (stad efektivitas model pembelajaran kooperatif teknik find someone who meningkatkan penguasaan kosakata bahasa jepang tingkat dasar efektivitas model pembelajaran kooperatif tipe broken triangle/square/heart meningkatkan pemahaman konsep mata pelajaran pkn kuasi eksperimen siswa kelas viii smpn 1 binong subang efektivitas model pembelajaran kooperatif tipe investigasi kelompok prestasi belajar siswa efektivitas model pembelajaran kooperatif tipe picture and picture pembeljaran bahasa jepang sma efektivitas model pembelajaran learning cycle 5e pendekatan quantum teaching berbantuan multimedia pembelajaran meningkatkan hasil belajar siswa ranah kognitif efektivitas model pembelajaran membaca prosa fiksi pendekatan estetika resepsi efektivitas model pembelajaran pkn berbasis portofolio menumbuhkan sikap demokratis kesadaran hukum siswa smk negeri 13 bandung efektivitas model pembelajaran predict-observe-explain meningkatkan keterampilan berpikir kritis memfasilitasi perubahan konseptual siswa sekolah dasar efektivitas model pembelajaran problem solving meningkatkan hasil belajar siswa mata pelajaran matematika (quasi eksperimental kelas v sd negeri petir 1 serang efektivitas model pembelajaran search solve create and share (sscs efektivitas model pembelajaran time token pembelajaran menanggapi pembacaan cerpenpenelitian eksperimen kuasi siswa kelas vii smpn 1 bandung semester 2 tahun ajaran 2012/2013 efektivitas model proyek respons kreatif meningkatkan keterampilan menulis karangan bahasa jepang efektivitas model service quality meningkatkan kualitas layanan bimbingan konseling penelitian quasi experiment sman 18 bandung tahun ajaran 2010/2011 efektivitas model sinektik berorientasi berpikir kritis meningkatkan kemampuan apresiasi karakter tokoh novel remaja 24 hour stay at school karya esa khairina huseinstudi eksperimen siswa kelas viii smp n 3 pangalengan kabupaten bandung tahun ajaran 2012/2013 éféktivitas modél writing workshop dina pangajaran nulis karangan déskripsi efektivitas modelconcept attainment berbantu multimedia meningkatkan pemahaman konsep siswasekolah menengah kejuruan (smk efektivitas modifikasi alat permainan bola besar meningkatkan hasil belajarpendidikan jasmani olahraga kesehatansiswa man 2 serang efektivitas outdoor learning meningkatkan kecerdasan interpersonal anakpenelitian eksperimen kuasi sebuah taman kanak-kanak kota bandung efektivitas peer guidance meningkatkan self esteem siswa penelitian pra-eksperimen siswa kelas ix smp negeri 45 bandung tahun ajaran 2013/2014 efektivitas pelaksanaan akreditasi sekolah menengah atas (studi tentang efektivitas pelaksanaan dampak akreditasi sekolah upaya penjaminan mutu pendidikan sma jawa barat efektivitas pelaksanaan pelatihan tenaga perawat rumah sakit tentang pelaksanaan pelatihan tenaga perawat rsup dr hasan sadikin bandung efektivitas pelatihan tata rias pengantin sunda putri rangka pemberdayaan perempuan lembaga pendidikan keterampilan tisaga caterias kota cimahi efektivitas pembekalan kemampuan asesmen pembelajaran bagi mahasiswa calon guru kimia efektivitas pembelajaran aspek perkembangan kemandirian taman kanak-kanak sahabat pelangi studi kualitatif tk sahabat pelangi kabupaten bandung efektivitas pembelajaran baca tulis qur’an melalui metode lihat baca tulis (libat efektivitas pembelajaran berbasis masalah meningkatkan kemampuan membaca pemahaman studi eksperimen kuasi mata pelajaran bahasa indonesia siswa kelas v sekolah dasar negeri kecamatan kampar kiri kabupaten kampar efektivitas pembelajaran kepuasan mahasiswa perguruan tinggi analisis pengaruh efektivitas penerimaan mahasiswa baru registrasi mahasiswa efektivitas bimbingan akademik suasana akademik komitmen institusi efektivitas pembelajaran kepuasan mahasiswa tiga perguruan tinggi negeri kota bandung efektivitas pembelajaran jasmani melalui metode kooperatif metode eksplorasi meningkatkan kecerdasan kinestetik interpersonal anak taman kanak-kanak studi eksperimen kuasi anak kelas b tk bhayangkari 43 kecamatan jatinangor kabupaten sumedang tahun ajaran 2012/2013 efektivitas pembelajaran kooperatif model student achievement divisions (stad efektivitas pembelajaran kooperatif tipe jigsaw meningkatkan aktivitas belajar penguasaan konsep ekosistem mata pelajaran ipa smp efektivitas pembelajaran kosakata bahasa jepang menggunakan media permainan domikado penelitian siswa kelas x sman 2 bandung tahun ajaran 2011/2012 efektivitas pembelajaran melalui media alam sekitar pembelajaran insya efektivitas pembelajaran menggunakan media berbasis teknologi informasi dilihat dari respon hasil belajar siswa efektivitas pembelajaran menggunakan media berbasis teknologi informasi dilihat dari respon hasil belajar siswa studi siswa kelas x tgb mata pelajaran ilmu bahan bangunan smk negeri 1 cilaku cianjur efektivitas pembelajaran metode tartila meningkatkan kompetensi siswa membaca al-qur’an sekolah dasar efektivitas pembinaan pengembangan tim seleksi peserta diklat menunjang keberhasilan pendidikan pelatihan pns kantor pendidikan pegawai deppen (ppd efektivitas pembinaan oleh kepala sekolah dilihat dari kualitas kinerja guru sekolah dasar sekolah dasar negeri kotamadya bandung efektivitas pendekatan konseling islami meningkatkan kecerdasan interpersonal siswastudi kuasi eksperimen siswa kelas x ma ummul qura kota tangerang selatan tahun pelajaran 2012/2013 efektivitas pendekatan metakognisi strategi kwl (know want learned efektivitas pendidikan ekonomi pembentukan nilai-nilai perilaku ekonomi efektivitas pendidikan kewirausahaan mengembangkan intensi kewirausahaan mahasiswa studi tentang faktor-faktor mempengaruhi intensi kewirausahaan mahasiswa berdasarkan pendekatan entrepreneurial intention-based models mahasiswa perguruan tinggi wilayah cirebon efektivitas penerapan media jejaring sosial edmodo meningkatkan hasil belajar siswa mata diklat sistem komputer efektivitas penerapan media musikalisasi puisi pembelajaran apresiasi puisi eksperimen kuasi siswa kelas x sman 6 bandung tahun ajaran 2011/2012 efektivitas penerapan metode bbq-99 meningkatkan kemampuan membaca menulis al-quran anak usia dini efektivitas penerapan metode pembelajaran kerja kelompok hasil belajar siswa kompetensi dasar melakukan prosedur pengadaan peralatan kantor studi quasi eksperimen siswa kelas x administrasi perkantoran smk negeri 1 cipanas kab efektivitas penerapan model cooperative learning pembelajaran membaca teks bahasa jepang siswa sma efektivitas penerapan model pembelajaran kooperatif murder pembelajaran pola kalimat dasar bahasa jepang eksperimen siswa kelas xi sman 15 bandung efektivitas penerapan model pembelajaran kooperatif tipe make a match meningkatkan penguasaan kosakata bahasa jerman efektivitas penerapan permainan tradisional gagarudaan meningkatkan penguasaan kosakata bahasa jepang efektivitas penerapan strategi relating experiencing applying cooperating transferring (react efektivitas pengelolaan pembelajaran kelompok berlatih olahraga sepakbola sanggar kegiatan belajar kota salatiga efektivitas pengelolaan praktek kerja industri rangka penyelenggaraan program pendidikan sistem ganda tentang pengelolaan prakerin smk negeri 1 bandung efektivitas pengelolaan program penyetaraan si jabatan fkip universitas bengkulu efektivitas pengelolaan sistem informasi personil sd oleh dinas p k kota madya dati ii pekanbaru efektivitas pengelolaan workshop pelaksanaan program pembelajaran mata diklat praktik kejuruan sekolah menengah kejuruan kelompok teknologi industri studi deskriptif-analitik smk negeri i cilegon-banten tahun 2002 efektivitas penggunaan bahan ajar interaktif berbasis terjemah arab sunda penguasaan kosa kata bahasa arab efektivitas penggunaan bahan ajar modul digital berbasis e-learning xhtml editor peningkatan hasil belajar siswa mata pelajaran teknologi informasi komunikasi kuasi ekperimen siswa kelas x sma negeri 5 bandung efektivitas penggunaan cooperative script meningkatkan kemampuan membaca teks berbahasa jerman siswa efektivitas penggunaan drills berbasis hot potatoes peningkatan ranah kognitif siswa mata pelajaran teknologi informasi komunikasi sma negeri 10 pekanbaru efektivitas penggunaan film bisu kemampuan menulis (sakubun efektivitas penggunaan informasi proses perencanaan sub bagian bina program dinas pendidikan kabupaten ciamis efektivitas penggunaan kartu kwartet pembentukan adjektivdeklination efektivitas penggunaan kolaborasi teknik round robin two stay two stray meningkatkan keterampilan berbicara bahasa jepang siswa kelas xi sma negeri 15 bandung efektivitas penggunaan konseling model sequentially planned integrative counseling for children (spicc efektivitas penggunaan media animasi 3d model simulasi peningkatan hasil belajar siswa mata pelajaran ipa sekolah dasar kuasi eksperimen siswa kelas v sdn cikaret ippor sukabumi efektivitas penggunaan media audio format drama peningkatan kemampuan siswa menyimak studi kuasi eksperimen siswa kelas v sekolah dasar negeri isola 2 kota bandung mata pelajaran bahasa indonesia efektivitas penggunaan media audio visual aids meningkatkan minat siswa pembelajaran pai kuasi eksperimen kelas viii smp pasundan 6 bandung efektivitas penggunaan media edmodo sebagai kegiatan penunjang pembelajaran dasar kompetensi kejuruan smk negeri 1 majalengka efektivitas penggunaan media film pembelajaran menulis permulaan sekolah dasar penelitianeksperimenkuasimata pelajaranbahasa indonesia dilakukan kelas 2 sdit al-bina kecamatanpurwakartakabupatenpurwakartatahunajaran 2012/2013 efektivitas penggunaan media film pendidikan meningkatkan hasil belajar siswa mata pelajaran sosiologi efektivitas penggunaan media film youtube meningkatkan penguasaan listening skills mata pelajaran bahasa inggris efektivitas penggunaan media flash flip book peningkatan hasil belajar siswa domain kognitif mata pelajaran tik efektivitas penggunaan media flash flip book peningkatan hasil belajar siswa domain kognitif mata pelajaran tikstudi eksperimen kuasi siswa kelas viii smp muhammadiyah 6 bandung efektivitas penggunaan media foto kemampuan siswa menulis puisi studi kuasi eksperimen mata pelajaran bahasa sastra indonesia siswa kelas viii smp negeri 29 bandung efektivitas penggunaan media ipad utalk japanese pembelajaran kosakata bahasa jepang studi eksperimen siswa kelas xii sman 1 cileunyi efektivitas penggunaan media logico piccolo pembelajaran kosakata bahasa jerman efektivitas penggunaan media monopoli meningkatkan kemampuan siswa membentuk w- fragen efektivitas penggunaan media pembelajaran berbasis ict prestasi belajar kompetensi dasar melaksanakan prosedur keselamatan kesehatan keamanan kerja (k3 efektivitas penggunaan media permainan dadu pembentukan w-fragen (wer wo wann wie was woher efektivitas penggunaan media permainan komputer wortsuche meningkatkan penguasaan kosakata efektivitas penggunaan media software read write hiragana penguasaan huruf hiragana penelitian kuasi eksperimen siswa kelas x sman 1 ciamis efektivitas penggunaan media spiel tabu meningkatkan kualitas pembelajaran berbicara efektivitas penggunaan media stellarium hasil belajar siswa mata pelajaran geografi kuasi eksperimen mata pelajaran geografi ma insan mandiri bandung efektivitas penggunaan media video peningkatan hasil belajar ips siswa smplb negeri cicendo kota bandung efektivitas penggunaan media video tutorial adobe premiere pro cs3 peningkatan hasil belajar siswa mata pelajaran audio video efektivitas penggunaan metode diskusi teknik conference writing kemampuan menulis bahasa inggris siswa penelitian mts efektivitas penggunaan metode enam tahapan berpikir (six thingking hats efektivitas penggunaan metode jarimatika metode sempoa upaya meningkatkan psikomotor siswa efektivitas penggunaan metode memory bank system (mbs efektivitas penggunaan metode memory bank system (mbs efektivitas penggunaan metode somatis audio visual intelektual (savi efektivitas penggunaan model role playing story telling pembelajaran pkn mengembangkan sikap nasionalisme siswa studi komparatif siswa kelas ix smp negeri 12 tambun selatan efektivitas penggunaan multimedia presentasi hasil belajar siswa mata pelajaran teknologi informasi komunikasi studi kuasi eksperimen siswa kelas xi sekolah menengah atas negeri 18 bandung efektivitas penggunaan panduan pedoman kerja pengelolaan program penyetaraan guru sltp setara d- kantor inspeksi departemen pendidikan nasional kabupaten bandung efektivitas penggunaan papan monopoli meningkatkan penguasaan kosakata bahasa jepang studi eksperimen siswa kelas xi sman 1 pangalengan efektivitas penggunaan pembelajaran berbasis komputer model tutorial peningkatan hasil belajar siswa mata pelajaran ilmu pengetahuan alamkuasi eksperimen siswa kelas v sd negeri gegerkalong kpad bandung efektivitas penggunaan pendidikan teknologi dasar pembelajaran listrik dinamis melalui modeling instruction meningkatan kemampuan kognitif keterampilan berpikir kritis siswa efektivitas penggunaan peta konsep sebagai strategi pembelajaran alat evaluasi meningkatkan penguasaan konsep siswa smp materi sistem ekskresi efektivitas penggunaan software mind map metode quantum learning meningkatkan kemampuan menyimak cerita pendek (studi kuasi eksperimen mata pelajaran bahasa indonesia media pembanding microsoft powerpoint siswa kelas vi sdn 6 cikidang kecamatan lembang kabupaten bandung barat efektivitas penggunaan teknik mnemonik penguasaan nomina bahasa jerman efektivitas penggunaan teknik permainan alphabet race meningkatkan penguasaan kosakata bahasa jepang kuasi eksperimen siswa kelas xi sma negeri 2 bandung tahun ajaran 2013/2014 efektivitas penggunaan teknik permainan bimbingan kelompok meningkatkan percaya diri siswa smapenelitian quasi eksperimen siswa kelas xi sekolah menengah atas laboratorium (percontohan efektivitas penggunaan teknik permainan missing letter meningkatkan penguasaan kosakata bahasa jepang penelitian kuasi eksperimen siswa kelas x sman 2 bandung tahun ajaran 2012/2013 efektivitas penggunaan teknik permainan tradisional ular naga meningkatkan penguasaan kosakata bahasa jepang studi eksperimen siswa kelas xii sma negeri 8 bandung tahun ajaran 2013-2014 efektivitas penggunaan teknik qaidaty penguasaan struktur kalimat bahasa arab siswa efektivitas penggunaan teknik qaidaty penguasaan struktur kalimat bahasa arab siswa efektivitas penggunaan teknik tanya jawab pembelajaran menulis karangan bahasa jerman efektivitas penggunaan teknik uji rumpang meningkatkan pemahaman membaca siswa smk efektivitas penggunaan trainer wireless microphone sebagai media pembelajaran kompetensi dasar menganalisis sistem radio pemancar fm meningkatkan hasil belajar siswa efektivitas penggunaan video based laboratory pembelajaran konseptual interaktif meningkatkan pemahaman konsep pemahaman grafik keterampilan berpikir logis efektivitas penggunaan wortschatzliste kemampuan memahami teks bahasa jerman efektivitas penggunaan wortschatzliste kemampuan memahami teks bahasa jerman efektivitas penyelenggaraan ujian negara perguruan tinggi swasta efektivitas penyuluhan pendidikan keamanan lalu lintas (ppkll efektivitas permainan kelompok mengembangkan penyesuaian diri siswa efektivitas permainan kelompok mengembangkan penyesuaian diri siswa efektivitas permainan kelompok mengembangkan penyesuaian sosial siswa efektivitas permainan orff percussion kecerdasan musikal anak usia dini efektivitas permainan sprachbaukasten meningkatkan pemahaman penggunaan artikel bahasa jerman efektivitas play therapy bagi siswa mengalami ptsd (post trauma stress disorder efektivitas program bimbingan konseling pernikhan meningkatkan keterampilan komunikasi interpersonal suami-istri studi pra-eksperimen paroki santa melaria bandung efektivitas program bimbingan konseling spiritual meningkatkan kemandirian remaja studi quasi-eksperimen siswa kelas vii madrasah tsanawiyah kifayatul akhyar bandung tahun ajaran 2011/ 2012 efektivitas program bimbingan keterampilan sosial meningkatkan empati disability awareness peserta didik non abk (anak berkebutuhan khusus efektivitas program bimbingan perencanaan karir bagi siswa sma kelas xi efektivitas program bimbingan pribadi meningkatkan penalaran moral peserta didik efektivitas program konseling spritual teistik meningkatkan sifat-sifat kerosulan diri siswa studi kuasi eksperimen siswa kelas x sman 1 tambun selatan kabupaten bekasi jawa barat tahun pelajaran 2010/2011 efektivitas program konseling spritual teistik meningkatkan sifat-sifat kerosulan diri siswa studi kuasi eksperimen siswa kelas x sman 1 tambun selatan kabupaten bekasi jawa barat tahun pelajaran 2010/2011 efektivitas program pelatihan mengembangkan locus of control siswa sekolah menengah atas pembelajaranstudi eksperimen siswa kelas xi ipa sma negeri 1 kadupandak kabupaten cianjur tahun pelajaran 2012/2013 efektivitas program pembelajaran kompetensi lulusan pendidikan kesetaraan paket c warga belajar kawasan industri pkbm sumber arum desa cangkuang kecamatan dayeuhkolot kabupaten bandung efektivitas program pendampingan kelompok kerja guru pola lesson study peningkatan kompetensi pedagogis guru penjasorkes efektivitas proses pembelajaran ips meningkatkan keterampilan sosial peserta didik smk jawa barat studi peserta didik smk rsbi jawa barat efektivitas remedial teaching pendidikan agama islam (pai efektivitas sistem pendayagunaan sarjana ilmu keperawatan propinsi jawa barat kajian khusus lulusan program b propinsi jawa barat tahun 1997-2001 efektivitas software pembelajaran ipa terpadu model connected meningkatkan literasi sains siswa kelas viii tema rokok kesehatan efektivitas special event bersifat edutainment meningkatkan proses keputusan berkunjung ke museum sri baduga bandung survei wisatawan berkunjung ke museum sri baduga bandung efektivitas strategi metakognitif pengajaran dokkai efektivitas strategi pembelajaran mind map berbasis media video upaya meningkatkan keterampilan menulis paragraf deskriptif studi pra eksperimen siswa kelas xii program ips sman 1 rancaekek tahun ajaran 2012/2013 efektivitas strategi pembelajaran mind map berbasis media video upaya meningkatkan keterampilan menulis paragraf deskriptif studi pra eksperimen siswa kelas xii program ips sman 1 rancaekek tahun ajaran 2012/2013 efektivitas strategi pembelajaran tandur berbantuan multimedia interaktif meningkatkan kemampuan aplikatif siswa smk mata pelajaran keterampilan komputer pengelolaan informasi (kkpi efektivitas strategi pengembangan self regulation learning meningkatkan motif berprestasi siswa pra eksperimen siswa kelas viii smp negeri 28 bandung tahun ajaran 2013/2014 efektivitas strategi peta konsep meningkatkan pengetahuan prosedural daya nalar siswa menata dokumen studi eksperimen kuasi siswa kelas xi administrasi perkantoran smkn 1 bandung efektivitas strategi react upaya peningkatan kemampuan komunikasi pemecahan masalah matematis siswa sekolah menengah pertama efektivitas team games tournament (tgt efektivitas teknik 「permainan lompat jingkat」 meningkatkan penguasaan kata bantu bilanganpenelitian eksperimen siswa kelas xii sman 24 bandung efektivitas teknik assertive training (at efektivitas teknik brainwriting meningkatkan keterampilan menulis karangan naratif bahasa perancis efektivitas teknik konseling keluarga integratif meningkatkan kualitas pengasuhan anak oleh orang tua siswa smp efektivitas teknik let’s tell a story meningkatkan keterampilan berbicara bahasa jerman efektivitas teknik manajemen diri mengurangi kecanduan online game penelitian eksperimen kuasi siswa kelas ix smpn 40 bandung tahun ajaran 2012/2013 efektivitas teknik manajemen diri mengurangi kecanduan online game penelitian eksperimen kuasi siswa kelas ix smpn 40 bandung tahun ajaran 2012/2013 efektivitas teknik numbered head together meningkatkan keterampilan membaca pemahaman bahasa perancis penelitian eksperimen semu siswa kelas xi semester ii smk n 3 bandung tahun ajaran 2011/2012 efektivitas teknik pembelajaran two stay two stray meningkatkan keterampilan menulis karangan deskripsi bahasa perancis siswa kelas xii bahasa sma negeri 3 cimahi tahun ajaran 2012/2013 efektivitas teknik permainan amazing adventures around the world pembelajaran kosakata nomina bahasa jepang tingkat dasar efektivitas teknik permainan cerita berantai media gambar pembelajaran berbicara bahasa perancis studi pra-eksperimen mahasiswa semester iii jurusan pendidikan bahasa perancis fpbs universitas pendidikan indonesia tahun akademik 2012/2013 efektivitas teknik permainan circular word puzzles meningkatkan keterampilan siswa menulis kalimat bahasa perancis berdasarkan evaluasi cecrl studi pra eksperimen siswa kelas xii program ips sma negeri 1 rancaekek tahun ajaran 2012/2013 efektivitas teknik permainan circular word puzzles meningkatkan keterampilan siswa menulis kalimat bahasa perancis berdasarkan evaluasi cecrlstudi pra eksperimen siswa kelas xii program ips sma negeri 1 rancaekek tahun ajaran 2012/2013 efektivitas teknik permainan bimbingan kelompok meningkatkan penyesuaian diri siswa studi kuasi eksperimen siswa kelas vii smp negeri 29 bandung tahun ajaran 2012/2013 efektivitas teknik permainan teknik sosiodrama meningkatkan kepercayaan diri peserta didik efektivitas teknik permainan jenga kemampuan berbicara tingkat dasar efektivitas teknik permainan kartu kuartet meningkatkan penguasaan kosakata bahasa arab siswa studi eksperimen kuasi siswa kelas viii mts al musyswarah lembang tahun ajaran 2012/2013 efektivitas teknik permainan missing letter kemampuan penguasaan kosakata dasar bahasa jepang penelitian kuasi eksperimen siswa kelas x sma laboratorium percontohan upi tahun ajaran 2013/2014 efektivitas teknik permainan mystery bag meningkatkan penguasaan kosakata keterampilan menulis bahasa perancis efektivitas teknik permainan octagon board meningkatkan keterampilan menulis bahasa perancis tingkat dasar sma efektivitas teknik permainan pantomim pembelajaran kosakata bahasa jerman efektivitas teknik permainan the clues meningkatkan penguasaan kosakata bahasa jepang studi eksperimen siswa kelas xi smk negeri 1 cimahi tahun ajaran 2012/2013 efektivitas teknik poster comment meningkatkan kemampuan berbicara siswa sma penelitian eksperimen kuasi siswa kelas xi bahasa sman 1 rancaekek efektivitas teknik praktek berpasangan (practice rehearsal pairs efektivitas teknik problem solving meningkatkan kemampuan pembuatan keputusan karir penelitian eksperimen kuasi peserta didik kelas xi sma negeri 1 soreang tahun ajaran 2013/2014 efektivitas teknik psikodrama meningkatkan penerimaan diri peserta didik efektivitas teknik récit raconté en tandem meningkatkan keterampilan berbicara bahasa perancis studi kuasi eksperimen siswa kelas xi bahasa sman 1 cicalengka tahun ajaran 2012/2013 efektivitas teknik restrukturisasi kognitif meningkatkan kecerdasan sosial peserta didik penelitian pra-eksperimen peserta didik kelas x smk profita bandung tahun ajaran 2013/2014 efektivitas teknik restrukturisasi kognitif meningkatkan self esteem siswa studi kuasi eksperimen siswa kelas xi sma laboratorium-percontohan upi bandung tahun ajaran 2012/2013 efektivitas teknik restrukturisasi kognitif mereduksi kecemasan komunikasi remajapra- eksperimen peserta didik kelas x sma pasundan 2 bandung tahun ajaran 2013/2014 efektivitas teknik role-play mengembangkan self-esteem peserta didik studi eksperimen kuasi peserta didik kelas x negeri 15 jakarta tahun ajaran 2012/2013 efektivitas teknik self instruction mereduksi kecemasan menghadapi ujian penelitian pra-eksperimen siswa kelas vii sekolah menengah pertama negeri 40 bandung efektivitas teknik self instruction mereduksi perilaku konsumtifpenelitian pra-eksperimen peserta didik kelas xi sma negeri 6 bandung tahun ajaran 2012/2013 efektivitas teknik silang cerita berbasis pengalaman pribadi pembelajaran menulis cerpenpenelitian eksperimen semu siswa kelas x sma kartika xix-2 bandung efektivitas teknik sosiodrama meningkatkan percaya diri siswaeksperimen kuasi siswa kelas x sma negeri 1 pagelaran kabupaten pringsewu lampung tahun ajaran 2010/2011 efektivitas teknik symbolic modeling mengembangkan personal safety skills peserta didik efektivitas teknik think-pair-share meningkatkan kemampuan membaca pemahaman siswa efektivitas teknik think-pair-share meningkatkan kemampuan membaca pemahaman siswa efektivittas penggunaan computer based teaching (cbt effect of problem-based learning on students’ problem solving skill and concept comprehension in learning ecosystem for secondary effectiveness of multisim interactive multimedia application as digital techniques learning media in smk negeri 7 baleendah efficacite de la technique collaborative dans l’aquisition de la competence de la redaction de la brochure de voyage sur l’itineraire efisiensi efektivitas pelatihan meningkatkan kinerja sumberdaya manusia bidang perawatan pesawat besar pt efisiensi penggunaan tenaga pengajar ikip yogyakarta hubungan antara sikap kerja tindakan kepemimpinan prosedur kerja sikap belajar efl teachers’ perceptions towards teacher certification program eksistensi home industri tape ketan desa tarikolot kecamatan cibeureum kabupaten kuningan eksistensi sanggar seni getar pakuan kota bogor eksperimen media pembelajaran audio visual pemahaman belajar siswa smk mata diklat ilmu bahan bangunan eksperimen metode pembelajaran tutorial mata pelajaran gambar perspektif eksperimen pemberian kuis setiap akhir tatap muka meningkatkan hasil belajar siswa eksperimentasi media softbox dari lampu belajar meningkatkan artistik pencahayaan seni photography eksperimen kelas x6 sma negeri 1 kadugede kabupaten kuningan eksplorasi pembelajaran keterampilan otomotif slbn b pembina sumedang eksplorasi pola komunikasi diskusi menggunakan moodle perkuliahan simulasi pembelajaran kimia ekspresi seni lukis siswa sekolah menengah pertama festival lomba seni siswa nasional (fls2n emampuan memahami informasi fokus teks bacaan buku ajar bahasa indonesia studi pendalaman bahan pemberlakuan model membaca total kelas v sd kalirejo lampung tengah embelajaran berbasis masalah (problem based learning e-modul interaktif berbasis konstruktivisme materi genetika meningkatkan kompetensi guru biologi sltp emotional intelligence differences between the following students extracurricular football and not following in smpn 10 bekasi empowering efl students in writing through portfolio-based instruction empowering students through the implementation of portfolio assessment empowerment of vocational secondary school through strategic management study about public vocational secondary school exertion to prepare graduates which in accordance with job market needs in banda aceh nanggroe aceh darussalam engaruh kinerja bauran pemasaran ritel nilai pelanggan serta dampaknya loyalitas pelanggan survei industri mini market franchise kawasan kecamatan sukasari kota bandung engaruh terpaan media internet karakter siswa studi siswa sma negeri kota cimahi engaruh unique selling proposition keputusan pembelian survei konsumen restoran bebek garang cabang braga bebek van java cabang lombok kota bandung engaruh variasi produk volume penjualan rumah makan bakmi jogja pak roso enggunaan media 3 g communication services for people with disabilities (3 gpd english language teaching in higher education an english course design at a state university english student book evaluation in school based curriculum (ktsp estetika makna mahkota binokasih sanghyang pake sumedang larang estetika sema tarekat sufi naqsybandi haqqani jakarta sebagai media penanaman pendidikan tauhid estimasi ongkos praktik pemesinan produk uji kompetensi bubut dasar workshop islamic development bank etude kacapi gaya mang koko sebagai bahan ajar smkn 10 bandung euis komariah seniman vokal sunda kota bandung evaluasi alat penilaian ujian kenaikan kelas mata pelajaran produktif smkn 1 karangtengah cianjur evaluasi event marketing csr camejasa citra taman lalu lintas kota bandung evaluasi implementasi manajemen berbasis sekolah meningkatkan mutu pendidikan smk negeri 1 cimahi evaluasi instrumen penilaian akhir semester mata pelajaran produktif smk n 1 bojongpicung evaluasi kelayakan bisnis restoran kambing bakar cairo cabang kopo sayati bandung ditinjau dari aspek pemasaran evaluasi kelayakan bisnis surabi berbasis aspek pemasaran aspek finansial warung colenak & surabi dago kota bandung evaluasi kurikulum model responsif program pendidikan diploma iv studi administrasi perhotelan sekolah tinggi pariwisata bandung evaluasi kurikulum pendidikan pariwisata memenuhi kebutuhan industri sekolah tinggi pariwisata bandung program studi tata boga diploma iii evaluasi on street parking ruas jalan banceuy bandung tugas akhir evaluasi pelaksanaan semester pendek dikaitkan percepatan studi mahasiswa evaluasi pelatihan keterampilan bagi perajin keramik plered tahun 2008-2011 evaluasi pembelajaran pendidikan agama islam sekolah menengah atas studi evaluatif pelaksanaan standar penilaian oleh guru mata pelajaran pai sma kota bandung tahun 2014 evaluasi pembelajarananak berkebutuhan khusus sekolah dasar penyelenggara pendidikan inklusif kota tasikmalaya evaluasi pemenuhan standar pencahayaan alami ruang kelas evaluasi pemenuhan standar tingkat kebisingan ruang kelas smpn 23 bandung evaluasi pendidikan sistem ganda studi smk negeri 1 metro evaluasi pengelolaan koleksi sebagai upaya pengembangan wisata budaya museum sri baduga evaluasi penyelenggaraan program pendidikan kecakapan hidup kerangka pemberdayaan masyarakat pkbm bina terampil mandiri evaluasi program konservasi guna melestarikan kelangsungan ekologi taman tegallega evaluasi program pelatihan ict guru-guru lpmp jawa barat penelitian evaluasi menggunakan model evaluasi kirkpatrick pelatihan intel teach getting started daerah terpencil kabupaten garut evektivitas teknik bimbingan kelompok menigkatkan konsep diri remaja studi pre-eksperimen siswa kelas x smk yapema gadingrejo lampung eyl teachers’ strategies in conducting speaking assessments a qualitative research in five english courses in bandung faktor - faktor penyebab wanita karir dewasa madya menunda pernikahan wanita karir dewasa madya kota bandung faktor diterminan mutu madrasah aliyah studi tentang pengaruh kinerja kepala kinerja komite budaya mutu kinerja mengajar guru mutu madrasah aliyah swasta terakreditasi b se-kabupaten bandung faktor- faktor determinan motivasi kerja pamong belajar uptd sanggar kegiatan belajar (skb faktor faktor berpengaruh kinerja guru sekolah dasar serta dampaknya hasil belajar siswa faktor motivasi instrinsik atlet usia dini memasuki sekolah sepak bola faktor mempengaruhi partisipasi olahraga remaja masyarakat paledang rt/rw 04/12 garut faktor-faktor determinan mempengaruhi performansi pamong belajar tenaga lapangan dikmas penilik dikmas penentuan identifikasi kebutuhan belajar program keaksaraan fungsionalstudi identifikasi kebutuhan belajar teknik pra program keaksaraan fungsional kabupaten bandung ciamis faktor-faktor kesulitan belajar siswa mata diklat menggambar lay-out desain interior eksterior (mldie faktor-faktor penentu pembentukan kemampuan komunikasi interpersonalstudi tentang pelatihan sebagai bentuk kegiatan pendidikan luar sekolah kepribadian petugas lapangan kb faktor-faktor penentu keberhasilan mata kuliah perencanaan struktur bangunan tinggi (psbt faktor-faktor mempengaruhi hasil belajar siswa mata pelajaran ekonomi siswa kelas x sman 1 kroya indramayu faktor-faktor mempengaruhi keberhasilan magang sentra industri kecil kerajinan sepatu kelurahan cibaduyut kecamatan bojongloa kidul kotamadya dati ii bandung jawa barat kerajinan tas-koper desa kedensari kecamatan tanggulangin kabupaten dati ii sidoarjo jawa timur faktor-faktor mempengaruhi kecenderungan menabung marginal (marginal propensity to save faktor-faktor mempengaruhi kemampuan menggambar konstruktif mahasiswa jurusan pendidikan seni rupa faktor-faktor mempengaruhi motivasi belajar siswa program keahlian teknik gambar bangunan smk n 2 tasikmalaya faktor-faktor mempengaruhi motivasi berolahraga siswa slbn a citeureup cimahi faktor-faktor mempengaruhi perilaku menabung studi kalangan mahasiswa fakultas pendidikan ekonomi bisnis universitas pendidikan indonesia faktor-faktor menyebabkan tingginya angka putus sekolah siswa sltp terbuka alternatif upaya penanggulangannya sltp terbuka 1 tanjungsari kecamatan tanjungsari kabupaten sumedang fantasi mimpi identitas tokoh novel cala ibi karya nukila amalkajian psikoanalisis feminisme sunda kuno studi interpretasi kritis akulturasi nilai-nilai kesetaraan gender sunda-islam carita pantun sri sadana fenomena hubungan seksual pranikah kalangan mahasiswa anak kost gegerkalong bandung fenomena kesantunan berbahasa acara indonesia lawyers club tv one folklor cirebon lukisan keluarga senimankomparasi visual karya haryadi suadi radi arwinda fraud risk assessment skeptisme profesional auditor implikasinya prosedur audit efektif berbasis risiko from design to implementation looking at the practice of speaking assessment at one junior high school in bandung fungsi makna rarak godang acara pacu jalur kabupaten kuantan singingi provinsi riau fungsi makna tortor pangurason upacara pangurason masyarakat batak toba provinsi sumatra utara fungsi keluarga mengembangkan potensi anakstudi pendidikan luar sekolah mengenai pengasuhan oleh orang tua bagi anak berprestasi tinggi bidang akademik beberapa keluarga provinsi sulawesi utara fungsi kognitif siswa sekolah dasar ditinjau dari kebiasaan sarapan studi ex post facto siswa kelas v sekolah dasar kecamatan cicendo kota bandung fungsi perencanaan sebagai faktor penunjang keberhasilan manajemen pengembangan sekolah dasar kinerja manajemen sekolah dasar tanjung pinang kepulauan riau fungsi pragmatis téks laku basa sunda dina rohang status facebook gagasan cerita sebagai stimulus eksplorasi keterampilan gerak pembelajaran bina seni tk samudra kabupaten pangandaran gajah sumatera sebagai objek berkarya seni patung gambaran gangguan menstruasi partisipasi siswa pembelajaran pendidikan jasmani smk 45 lembang gambaran kemampuan berpikir matematis akhlak prestasi belajar matematika siswa smp pembelajaran berbasis budaya islam gambaran orientasi masa depan anak jalanan studi deskriptif 5 anak jalanan usia remaja binaan forum silaturahmi lembaga dakwah kampus kota bandung gambaran pengetahuan remaja putri kelas vii tentang menstruasi smpn 1 panjatan kulon progo yogyakarta gambaran pengetahuan remaja tentang hiv/aids kelas xi sma yadika cicalengka gambaran pengetahuan remaja tentang pemeriksaan payudara sendiri (sadari gambaran pengetahuan remaja tentang pornografi siswa kelas viii smpn 5 lembang gambaran pengetahuan remaja tentang seks bebas sma negeri 1 kadipaten kabupaten majalengka gambaran pengetahuan tentang penyakit reumatik wanita lanjut usia panti sosial tresna wredha budi pertiwi bandung gambaran pengetahuan warga tentang hipertensi rw 02 sukarasa kecamatan sukasari gambaran perbandingan kemampuan komunikasi matematik pemecahan masalah matematik antara siswa ekstrovertdan introvert sd kelas iv pembelajaran konvensional gambaran perilaku hidup bersih sehat siswa sekolah dasar 2 nanjung gambaran sikap remaja kelas x xi tentang bahaya merokok sekolah menengah kejuruan pakuan lembang gambaran spiritualitas pelaku konversi agama studi fenomenologis 2 orang mualaf ypm salman itb bandung gambaran tingkat kecemasan mahasiswa tingkat tiga d-iii keperawatan menghadapi uji kompetensi universitas pendidikan indonesia gambaran tingkat stres mahasiswa tingkat i (satu gambaran tingkat stres anak usia sekolah menghadapi menstruasi pertama (menarche game team quiz meningkatkan aktivitas hasil belajar siswa pembelajaran sejarah penelitian tindakan kelas kelas xi-ipa 3 sma negeri 2 rangkasbitung gandrang bulo sebagai bahan ajar seni budaya smp negeri 4 sungguminasa gaya eksplanatori wanita menikah belum dikaruniai keturunan studi deskriptif dua wanita menikah belum dikaruniai keturunan gaya menyanyi musik keroncong tugu analisis gaya saartje margaretha michiels gedung sundial kota baru parahyangan sebagai objek berkarya seni grafis seni grafis teknik alugrafi gema hanura sebagai media pendidikan politik dpd partai hanura jawa barat gender influence on slang used by teenagers in their daily conversation at school a comparative study on male and female early teenagers in one of islamic boarding schools lembang généalogi carita pondok sunda tilikan postkolonial genosida bosnia herzegovina kajian pembentukan negara bosnia herzegovina 1991-1995 gerak dinamis kuda pacuan karya seni patung gerakan donghaksuatu kajian sosio-historis gerakan sosial petani korea tahun 1894-1895 gerakan himpunan mahasiswa islam (hmi gerakan lembaga dakwah kampus eksistensinya pergerakan mahasiswa islam kota bandung (1980-1998 gerakan partai komunis indonesiastrategi partai mencapai kekuasaan politik indonesia (1920-1966 gereja katolik bebas suatu kajian historis perkembangannya hindia belanda 1926-1942 gereja katolik bebas suatu kajian historis perkembangannya hindia belanda 1926-1942 grandine apartment gunung krakatau sebagai ide berkarya seni grafis cetak teknik etsa aquatint mezzotint softground guru sebagai pembimbing memfasilitasi perkembangan kreativitas anakstudi deskriptif guru taman kanak-kanak melati mekar tahun ajaran 2012/2013 hambatan implementasi kurikulum tingkat satuan pendidikan mata pelajaran produktif smk wiraswasta kota cimahi hasil belajar menggambar ornamen pembuatan motif hiasan busana anak hasil belajar keterampilan otomotif menggunakan metode demonstrasi anak difabel smalb-b majalengka hasil belajar siswa pembelajaran senam lantai melalui metode pengajaran langsung tidak langsung penelitian tindakan kelas smk sangkuriang 1 cimahi hasil pengembangan lembar kerja siswa (lks history learning on the approach of multicultural and local national global history perspective for national integration a quasi-experimental study on senior high school student in bandung city homeschooling as vehicle character development case studies in homeschooling kakseto in cirebon west java hopememento (board game sebagai pengembangan soft skill usia 10 tahun ke atas hubunga nantara penyesuaian diridengan prestasi belajar peserta didik studi peserta didik kelas viii smp bina dharma 2 bandung tahun ajaran 2013-2014 hubungan aktivitas fisik dismenore mahasiswi program studi ilmu keolahragaan hubungan aktivitas guru penjas kkg dukungan kepala sekolah peningkatan kompetensi pedagogik kompetensi profesional guru penjas sd kecamatan kampar timur hubungan anatar peralatan praktek pelayanan guru praktek industri program studi gambar bangunan prestasi belajar siswa smkn kota bandung hubungan antara administrasi perpustakaan sekolah pemberian motivasi oleh guru fungsi perpustakaan bagi siswa hubungan antara adversity quotient motivasi studi korelasional antara adversity quotient motivasi berprestasi motivasi berafiliasi motivasi berkuasa agen prudential cabang achmad yani bandung hubungan antara antropometri tubuh kelincahan (agility hubungan antara beladiri syufu taesyukhan perilaku hidup sehat kebugaran jasmani santri aliyah tsanawiyah pesantren persatuan islam 67 benda tasikmalaya hubungan antara budaya organisasi gaya kepemimpinan kinerja pamong belajar skb provinsi gorontalo hubungan antara daya konsentrasi hasil belajar menulis hubungan antara dukungan sosial coping strategy ibu memiliki anak penyandang tunagrahita studi deskriptif korelasional ibu memiliki anak tunagrahita slb-c yplb cipaganti kota bandung hubungan antara dukungan sosial tingkat resiliensi menghadapi stres akademik mahasiswa upi perantau hubungan antara dukungan sosial orang tua efikasi diri remaja pemilihan jurusan hubungan antara dukungan sosial orang tua efikasi diri remaja pemilihan jurusan studi korelasional siswa kelas x sekolah menengah atas negeri 6 bandung hubungan antara goal setting kepercayaan diri motivasi atlet hubungan antara health locus of control tingkat depresi penderita kanker serviksstudi korelasi pasien kanker serviks rsup dr hasan sadikin bandung hubungan antara iklim organisasi sekolah kepemimpinan instruksional kepala sekolah prestasi kerja guru sekolah dasar kantor departemen pendidikan kebudayaan kecamatan padalarang kabupaten bandung hubungan antara intensitas keterlibatan tokoh masyarakat dengah tingkat pengetahuan pemahaman mereka mengenai program keluarga berencanastudi deskriptif tentang intensitas alasan keterlibatan tokoh masyarakat kegiatan program keluarga berencana kecamatan kroya kab hubungan antara kecanduan bermain game online point blank perilaku melanggar aturan studi remaja awal c-game center bandung hubungan antara kecepatan reaksi fleksibilitas pergelangan tangan hasil service forehand sidespin permainan tenis meja hubungan antara kecerdasan emosional kecanduan game online mahasiswa pemain game online kota bandung hubungan antara kecerdasan emosional kesiapan kerja pegawai hubungan antara kecerdasan emosional prokrastinasi akademik hubungan antara kecerdasan spiritual motivasi kerja harapan guru kepemimpinan kepala sekolah kinerja guru smp negeri kota jayapura selatan hubungan antara kelekatan motivasi belajar siswa hubungan antara kemampuan membaca kemampuan menerjemahkan teks berbahasa jerman hubungan antara kemampuan menentukan kata-kata kunci keterampilan membaca hubungan antara kemampuan mengajar guru tik non-liner hasil belajar siswa mata pelajaran teknologi informasi komunikasi (tik hubungan antara kesiapan mahasiswa kesiapan dosen proses pembelajaran prestasi belajar mahasiswa program diploma iii politeknik tedc bandung hubungan antara ketaatan beribadah latar belakang pendidikan agama siswa smkn 12 bandung studi deskriptif analisis smkn 12 bandung tahun ajaran 2012/2013 hubungan antara keterlibatan peserta didik kepramukaan penyesuaian sosial sekolah hubungan antara keterlibatan psikologis sekolah kebahagiaan subjektif peserta didik sekolah menengah pertamastudi deskriptif-korelasional peserta didik kelas vii smp negeri 13 bandung hubungan antara konformitas spiritualitas anggota hijabers community bandung hubungan antara konformitas teman sebaya kenakalan remaja studi korelasional siswa kelas xii sma pgri 2 sindang indramayu hubungan antara kualitas kehidupan kerja intensi keluar kerja frontliner pt hubungan antara locus of control stres akademik peserta didik hubungan antara meneladani kepahlawanan tokohdengan sikap patriotisme siswa kelas iv sekolah dasar penelitian deskriptif kelas iv sd negeri 2 cibungur kecamatan cipatujah kabupaten tasikmalaya hubungan antara minat belajar hasil belajar membaca hubungan antara minat cara belajar hasil belajar siswa hubungan antara minat menjadi teknisi sikapnya pekerjaan teknisi otomotif siswa kelas xii tkr smk negeri 1 cilaku hubungan antara minat siswa kemampuan kognitif penggunaan multimedia interaktif thd prestasi belajar siswa hubungan antara motivasi belajar hasil belajar menyimak hubungan antara motivasi berprestasi kemampuan berpikir kreatif remaja studi korelasional siswa kelas xi sekolah menengah atas negeri 6 bandung hubungan antara nilai tugas (task value hubungan antara pelayanan kesejahteraan berbeda prestasi belajar siswa studi perbandingan antara dua sma kodya bandung hubungan antara pemanfaatan bahan pustaka perpustakaan sekolah minat belajar siswa studi deskriptif korelasional siswa sma negeri 1 bandung hubungan antara pemanfaatan e-learning motivasi belajar siswa sma negeri 5 bandung hubungan antara pemanfaatan internet sekolah motivasi siswa menelusuri bahan ajar studi deskriptif korelasional siswa kelas viii smp negeri 1 lembang hubungan antara pemanfaatan perpustakaan sebagai sumber belajar hasil belajar siswa mata pelajaran bahasa indonesiastudi deskriptif korelasional siswa kelas x sma negeri 5 bandung hubungan antara pembelajaran pendidikan jasmani olahraga kesehatan (penjasorkes hubungan antara penerimaan perkembangan fisik kematangan emosi remaja awal hubungan antara penguasaan konsep matematika peningkatan kemampuan kognitif siswa menganalisis rangkaian listrik elektronika smk n 12 bandung hubungan antara penguasaan teori penerjemahan kemampuan menerjemahkan teks bahasa prancis studi korelatip mahasiswa semester vi jurusan pendidikan bahasa prancis fpbs upi tahun ajaran 2009/2010 hubungan antara penilaian kognitif stressful budaya akademik penyesuaian diri mahasiswa hubungan antara penyelenggaraan sekolah minat baca siswa sekolah menengah atas studi deskriptif perpustakaan sma negeri 4 bandung hubungan antara penyesuaian sosial perguruan tinggi prestasi akademik studi korelasional mahasiswa angkatan 2012 jurusan psikologi universitas pendidikan indonesia tahun akademik 2012-2013 hubungan antara persepsi guru tentang praktik kepemimpinan manajemen mengembangkan organisasi pembelajar optimisme akademik guru kota pangkal pinang hubungan antara persepsi kompetensi profesionalisme guru minat belajar keterampilan geografis (geographic skills hubungan antara persepsi mahasiswa tentang program pendidikan umum latar belakang sosial bubaya bengan pemahaman tentang perilaku warga negara bertanggung jawabstudi deskriptif-analitis para mahasiswa ikip bandung tahun 1986 hubungan antara persepsi seks bebas perilaku seksual komunitas motor bandung studi korelasi anggota kawasaki ninja club bandung hubungan antara persepsi peran proses pengembangan karir karyawan komitmen organisasi karyawan studi korelasional peran karyawan manajer perusahaan karyawan divisi sumber daya manusia diklat pt hubungan antara persepsi pola asuh orang tua kecerdasan interpersonal remaja studi korelasional siswa smp negeri 12 bandung hubungan antara praktik produksi program televisi video melalui teknik peer group motivasi belajar mahasiswa mata kuliah media televisi video studi korelasi mahasiswa konsentrasi perekayasa pembelajaran jurusan kurikulum teknologi pendidikan hubungan antara prestasi beajar pai akhlāq siswa hubungan antara prestasi belajar pend1dikan dasar umum pgan man prestasi belajar matakuliah dasar umum fakultas tarbiyahstudi deskriptif-analitik mahasiswa fakultas tarbiyah hubungan antara prestasl kerja kemampuan kognitif keterampilan psikomotorik kepuasan kerja karyawan lulusan stm sma suatu operator mesin-cnc pt industri pesawat terbang nusantara hubungan antara problem solving appraisal penyesuaian diri napi anak studi korelasi napi anak penghuni lapas bandung hubungan antara problem solving appraisal penyesuaian diri napi anak studi korelasi napi anak penghuni lapas bandung hubungan antara religiusitas resiliensi wanita muslimah bercadar usia dewasa awal kota bandung hubungan antara religiusitas resiliensi wanita muslimah bercadar usia dewasa awal kota bandung hubungan antara s1kap mahasiswa materi bidang studi metodologi pengajaran teknik prestasi belaiar studi deskriptif mahasiswa ttuc (technical teacher upgrading centre hubungan antara self control tingkat kepercayaan diri atlet putri ukm bola voli upi hubungan antara sikap menghadapi perilaku pelecehan seksual masalah kesehatan mental kepuasan kerja sales promotion girl kota bandung hubungan antara sikap menghadapi perilaku pelecehan seksual masalah kesehatan mental kepuasan kerja sales promotion girl kota bandung hubungan antara sikap siswa prestasi belajar siswa mata pelajaran pendidikan teknologi dasar (ptd hubungan antara tingkat kecemasan kepercayaan diri kinerja wasit bulutangkis memimpin suatu pertandingan hubungan antara tingkat partisipasi siswa mengikuti olahraga ekstrakurikuler bola basket kedisiplinan siswa smk n 1 cimahi hubungan antara tipe kepribadian posttraumatic growth orang hiv/aids (odha hubungan anthropometrik kondisi fisik prestasi atlet bulutangkis junior jawa barat hubungan antropometrik keterampilan shooting atlet scorpio basket ball club bandung permainan bola basket hubungan budaya organisasi emotional quotient prestasi kerja karyawan divisi produksi pt hubungan celebrity worship psychological ownership fans k-pop studi fans super junior bandung hubungan citra museum konperensi asia-afrika motivasi berkunjung wisatawan hubungan daya ingat penguasaan artikel penelitian siswa kelas xi sman 23 bandung hubungan daya tarik objek wisata motivasi berkunjung wisatawan kampung ladang kabupaten sumedang hubungan diversity kepuasan kerja retensi karyawan hubungan environmental sustainability economical benefits aktivitas kukuyaan arung jeram cikapundung hubungan goal setting performa atlet cabang olahraga bola voli klub alko bandung hubungan guru profesional hasil belajar siswa mata pelajaran matematika sd hubungan hasil belajar mata kuliah kewirausahaan minat kerja mandiri mahasiswa program studi pendidikan teknik bangunan jpts fptk upi hubungan hasil belajar siswa tentang pembiakan tanaman secara generatif minat merintis usaha budidaya tanaman sayuran organik hubungan hasil pelatihan kompetensi tutor mutu pembelajaran program paket b provinsi gorontalo hubungan hasil pelatihan bantuan modal pendampingan program microfinance syariah berbasis masyarakat kemandirian ekonomi mustahik studi tentang lembaga amil zakat nasional dompet peduli ummat daarut tauhiid bandung jawa barat hubungan induksi daya suai melaksanakan tugas sebagai guru sekolah menengah umum tingkat atas (sma hubungan intensitas membaca kemampuan memahami teks bahasa jerman siswa sman 23 bandung hubungan intensitas membaca penguasaan kosakata bahasa jerman hubungan interaksi belajar mengajar guru siswa hasil belajar siswa mata pelajaran gambar teknik smk negeri 2 kota bandung no panggil stm ind h-2009 hubungan interpersonal antara kepala sekolah guru pamong mahasiswa peserta ppl mengembangkan perilaku calon guru sekolah dasar studi eksploratif tentang hubungan interpersonal sekolah latihan m ahasiswa program d-ii pgsd fkip untan pontianak hubungan jiwa kewirausahaan minat berwirausaha mahasiswa prodi pendidikan teknik bangunan jpts fptk upi hubungan kebiasaan menonton tayangan sinetron perilaku bullying siswa serta implikasinya bagi bimbingan konseling hubungan kebugaran jasmani prestasi akademik mahasiswa ilmu keolahragaan fpok upi hubungan kecerdasan emosional kemampuan tembakan hukuman permainan bolabasket hubungan kecerdasan emosional partisipasi belajar siswa pembelajaran pendidikan jasmani study deskriptif siswa kelas 7 smp it as-syifa subang hubungan kecerdasan intelektual kebugaran jasmani keterampilan teknik dasar futsal anggota ukm futsal universitas pendidikan indonesia hubungan kecerdasan intrapersonal kemampuan berbicara siswa hubungan kegiatan ekstrakurikuler information communication and technology (ict hubungan kekuatan otot tungkaidan kelenturan hasil shooting ke gawang cabang olahragasepak bola study kasus ssb garut muda hubungan kemampuan berbicara (kaiwa hubungan kemampuan berpikir logis kemampuan menulis teks bahasa jerman studi korelasi kemampuan berpikir logis kemampuan menyusun kalimat menjadi sebuah teks bahasa jerman siswa kelas xii bahasa sman 15 bandung tahun ajaran 2012/2013 hubungan kemampuan berpikir logis kemampuan menulis teks bahasa jermanstudi korelasi kemampuan berpikir logis kemampuan menyusun kalimat menjadi sebuah teks bahasa jerman siswa kelas xii bahasa sman 15 bandung tahun ajaran 2012/2013 no panggil sjrm reg h-2013 hubungan kemampuan metakognisi keterampilan berpikir kritis sikap ilmiah siswa kelas xi materi sistem ekskresi manusia hubungan kepemimpinan kepala bapusipda brand judgement pemustaka studi deskriptif badan perpustakaan kearsipan daerah provinsi jawa barat hubungan kepemimpinan kepala sekolah kinerja guru taman kanak-kanak penelitian korelasi kepemimpinan kepala sekolah kinerja guru taman kanak-kanak kecamatan sukasari bandung hubungan kerja antara kepala sekolah penilik sekolah guru hubungannya penampilan mengajar guru sd hubungan ketergantungan partisipasi karakteristik pemuda partisipan kegiatan keluarga muda-mudi kpad gegerkalong kotamadya bandung hubungan kinerja guru motivasi mengajar meningkatkan pencapaian kompetensi dasar pelajaran gambar konstruksi bangunan siswa kelas 2 smk negeri 5 bandung hubungan kinesthetic perception keterampilan juggling freestyle soccer hubungan kompetensi motivasi berprestasi mutu layanan tutor pembelajaran anak usia dini studi deskriptif korelasional kelompok bermain kota bengkulu hubungan kondisi air tanah intrusi air laut pesisir daerah palabuhan ratu kabupaten sukabumi hubungan kondisi fasilitas pemanfaatan fasilitas terminal rawabango kabupaten cianjur hubungan kondisi fisik aspek mental percaya diri siswa sepak bola usia muda (ssb hubungan kondisi fisik agresivitas kemampuan teknik penampilan atlet pertandingan karate nomor kumite hubungan kontrol diri kenakalan remaja serta implikasinya bagi layanan bimbingan konseling studi deskriptif siswa salah satu sma swasta kota bandung tahun ajaran 2013/2014 hubungan kreativitas mengajar guru prestasi belajar siswa mata pelajaran produktif administrasi perkantoran smk profita bandung hubungan kualifikasi pendidikan pengalaman motivasi kinerja wasit tenis hubungan latar belakang pendidikan nilai budaya ekonomi motivasi kerja aspirasi pendidikan tenaga kerja wanita sektor industristudi tentang perencanaan pendidikan luar sekolah tenaga kerja wanita kotamadia medan hubungan mengikuti kegiatan ekstrakulikuler futsal hasil pembelajaran penjas sepak bola sma n 10 bandung hubungan minat berolahraga rekreasi tingkat kebugaran jasmani remaja desa serang hubungan motif berprestasi kreativitas hasil pelatihanstudi deskriptif analisis pelatihan guru pamong sltp terbuka bpg bandung hubungan motivasi belajar hasil belajar menulis hubungan motivasi berprestasi pengalaman kerja industri peserta didik efektifitas pembelajaran produktif studi smk negeri kota tasikmalaya hubungan panjang tungkai tinggi loncatan hasil lay up shoot permainan bola basket hubungan panjat dinding dilihat dari segi anatomical fitness physiological fitness kecepatan pemanjatan ukm pamor hubungan pemanfaatan media lcd proyektor motivasi penyelesaian tugas mata diklat gambar beton bertulang smkn 1 sumedang hubungan pembelajaran pendidikan jasmani perilaku sosial siswa hubungan pembelajaran modal usaha pendampingan perintisan usaha kemandirian usaha warga belajar kum pkbm kinanti kecamatan lembang hubungan pendidikan pelatihan pengalaman mengajar profesional guru sekolah menengah kejuruan negeri 6 bandung hubungan penerapan iso 90012000 organisasi pembelajar kinerja stafstudi lembaga p2pnfi regional i jayagiri p2pnfi regional ii semarang hubungan penerapan model problem based learning hasil belajar peserta bimbingan keterampilan kerja hubungan pengaruh antara budaya organisasi kualitas kinerja dosen suatu kajian pendapat dari para dosen fptk ikip bandung hubungan pengelolaan program pelatihan meister otomotif kompetensi peserta studi deskriptif balai besar pengembangan latihan kerja negeri bandung hubungan pengetahuan ibu pengetahuan anak tentang gizi lapangan remaja lingkungan ssb hubungan pengetahuan keunggulan lokal pemanfaatan sumber pembelajaran ips kecakapan hidup peserta didik smk kota tasikmalaya hubungan penggunaan media piranti lunak virtualbox hasil belajar siswa mata pelajaran sistem operasi dasar studi deskriptif korelasional siswa kelas x smk negeri 4 padalarang hubungan penguasaan kosakata kemampuan menulis dialog bahasa jerman siswa kelas xii sman 18 bandung hubungan penilaian kinerja standar kompetensi memberi pakan berbasis produksi hasil belajar siswa apsdp smkn 2 subang hubungan perilaku agresif tingkat prestasi taekwondo studi deskriptif atlet taekwondo sdpn sabang bandung hubungan perilaku guru mengajar penjas disiplin siswa hubungan perilaku makan status gizi anak usia 10-12 tahun sdn 3 klangenan hubungan persepsi mahasiswa tentang metode penugasan presentasi multimedia hasil belajar mata kuliah mpkb prodi ptb jpts fptk upi hubungan persepsi mahasiswa tentang proses pembelajaran penyelesaian tugas terstruktur mata kuliah manajemen konstruksi hubungan persepsi pemustaka mengenai kelengkapan koleksi motivasi kunjungan ke perpustakaan sma negeri 1 bandung hubungan persepsi peserta diklat pelaksanaan program diklat teknik pengukuran kalibrasi prestasi belajar peserta diklat studi deskriptif korelasional peserta diklat balai pengembangan instrumentasi lipi bandung hubungan persepsi peserta kursus mengenai kompetensi tenaga pendidik prestasi belajar peserta kursus lembaga kursus menjahit wilayah kec hubungan persepsi siswa tentang keterampilan mengajar guru motivasi berprestasi hasil belajar siswa sekolah menengah kejuruan hubungan persepsi siswa tentang kinerja guru motivasi belajar siswa mata pelajaran dasar kompetensi kejuruan smk negeri 8 bandung hubungan persepsi tentang kinerja guru ppl motivasi belajar siswa jurusan teknik gambar bangunan smk negeri 2 garut hubungan persepsi tentang kinerja guru ppl motivasi siswa jurusan teknik gambar bangunan smk negeri 2 garut hubungan proses belajar mengajar pendidikan pancasila hasil belajar kognitif afektif suatu studi deskriptif koreiasional fkcp universitas islam riau pekanbaru hubungan self efficacy perceived organizational support keterikatan kerja karyawan unit theme park pt hubungan self-esteem pencapaian prestasi atlet ukm softball upi bandung hubungan sikap minat belajar siswa kreativitas siswa smk kompetensi agribisnis tanaman pangan hortikultura (atph hubungan sikap minat belajar siswa kreativitas siswa smk kompetensi agribisnis tanaman pangan hortikultura (atph hubungan sikap kerja prestasi belajar proses las busur metal manual smkn 1 karawang hubungan sistem pembinaan profesional guru kinerja guru sd kecamatan banjaran kabupaten bandung hubungan tinggi badan power lengan panjang lengan servis atas bola voli hubungan tingkat intelegensi kemampuan belajar gerak siswa smp handayani i banjaran hubungan tingkat intelegensi kemampuan membaca teks bahasa jerman hubungan tingkat kebugaran jasmani teknik dasar futsal siswa sman 1 losarang kabupaten indramayu hubungan tingkat pendidikan nilai anak status sosial budaya (adat istiadat hubungan tingkat pengetahuan kesehatan mahasiswa partisipasi olahraga hubungan tipe kepribadian pemilihan karir mahasiswa program studi pendidikan teknik bangunan fptk upi hubungan upaya guru mengimplementasikan ktsp hasil ujian nasional studi madrasah tsanawiyah (mts hukum waris adat baduymengungkap kearifan lokal budaya matematika sebuah kajian ethnomathematics ibing pencak acara seni ketangkasan olahraga domba daerah padalarang identifikasi bakteri endofit kultivar nanas (ananas comosus (l identifikasi faktor penyebab kerawanan sosial ekonomi serta harapan perempuan rawan sosial ekonomi (prse identifikasi keterampilan bahasa tulis melalui hasil gambar anak studi deskriptif analitik tk al-furqon jl identifikasi masalah-masalah konseptual pokok bahasan metabolisme buku teks pelajaran biologi sma identifikasi miskonsepsi siswa sma berdasarkan cluster sekolah menggunakan tes pilihan ganda beralasan konsep sistem reproduksi tumbuhan biji identifikasi miskonsepsi siswa sma berdasarkan cluster sekolah menggunakan tes pilihan ganda beralasan konsep sistem reproduksi tumbuhan biji identifikasi miskonsepsi siswa sma konsep difusi-osmosis melalui analisis gambar identifikasi miskonsepsi siswa smp konsep fotosintesis melalui analisis gambar identifikasi parasitoid menginfeksi drosophila sp ada sekitar wilayah kebon bibit kota bandung identifikasi perkembangan pra akademik balita oleh kader posyandu kelurahan neglasari kecamatan cibeunying kaler kota bandung identifikasi potensi budaya pengembangan desa pasir biru sebagai desa wisata kabupaten sumedang identifikasi rayap kayu umpan kampung babakan cimareme kecamatan ciranjang kabupaten cianjur ilustrasi karakter ikan hiu predator imajinatif karya seni terapan impelentasi model pembelajaran terintegrasi membina civic responsibility mata pelajaran pendidikan kewarganegaraan sma darul hikam bandung implemenstasi manajemen pendidikan pelatihan berbasis kompetensi bagi karyawan implementasi aktivitas pembelajaran permainan tradisional upaya meningkatkan waktu aktif belajar siswa implementasi algoritma entropy metode certainty factor (cf implementasi blended learning berbasis perangkat lunak open source moodle versi 2 implementasi brain-based learning meningkatkan kemampuan koneksi berpikir kritis matematis siswa smp implementasi brain-based learning meningkatkan kemampuan koneksi kemampuan berpikir kritis matematis siswa sekolah menengah pertama implementasi coaching berbasis rekaman video kemunculan pertanyaan guru berdasarkan jenjang kognitif bloom proses pembelajaran ipa kelas v sekolah dasar implementasi cooperative learning peningkatan kemampuan menyusun sebuah paragraf siswa kelas iv sd negeri kelanggaran unyur - serang implementasi e-book sebagai media pembelajaran meningkatkan pemahaman konsep elektronika dasar implementasi e-learning upaya meningkatkan kemampuan komunikasi matematis dampaknya kemandirian belajar mahasiswa implementasi e-learning meningkatkan penguasaan konsep memperbaiki sikap belajar mahasisw materi pencemaran lingkungan implementasi fungsi organisasi kemasyarakatan meningkatkan partisipasi keberdayaan masyarakat sebagai media demokrasistudi deskriptif analitis pw muhammadiyah jawa barat implementasi gaya mengajar inklusi pembelajaran aktivitas permainan bola tangan studi ptk kelas vii-d smpn 26 bandung implementasi gaya mengajar resiprokal aktivitas pembelajaran pencak silat mengembangkan sikap disiplin siswa implementasi hasil pelatihan berbasis kompetensi bagi pendidik paud tingkat pemula proses pembelajaran anak usia dini kelompok bermain skb kota bandung implementasi integrasi sosial pengembangan budaya kewarganegaraan masyarakat kelurahan gadang kota banjarmasin implementasi internet sebagai sumber pembelajaran demokrasi implementasi jaringan syaraf tiruan mengidentifikasi telapak tangan menggunakan metode learning vector quantization implementasi kearifan lingkungan budaya masyarakat adat kampung kuta sebagai sumber pembelajaran ips studi etnografi masyarakat adat kampung kuta kajian ptk smp negeri 1 tambaksari kabupaten ciamis implementasi kebijakan alokasi anggaran pendidikanstudi alokasi anggaran meningkatkan mutu pendidikan dasar sembilan tahun provinsi jawa barat implementasi kebijakan pemerintah kota upaya pemeliharaan ruang terbuka hijau kota bandung implementasi kebijakan penyelenggaraan pendidikan profesional keahlian teknik implementasi kebijakan program peningkatan mutu pendidikan kedinasan kepolisian studi pendidikan tinggi kedinasan (ptk implementasi kegiatan ekstrakulikuler kesenian tari topeng cirebon meningkatkan rasa cinta tanah air siswa sekolah dasar studi deskriptif ekstrakulikuler kesenian tari topeng cirebon sd negeri 3 arjawinangun kabupaten cirebon implementasi kegiatan lesson study pembelajaran bahasa arab studi deskriptif proses belajar mengajar bahasa arabdi kelas xi ips 5 sma pgii 2 bandung implementasi keselamatan kesehatan kerja proses produksi implementasi knowledge management meningkatkan mutu perguruan tinggi multi universitas pasundan bandung universitas langlangbuana universitas garut implementasi konsep pendidikan politik pendidikan pancasila kewarganegaraan sebagai pendidikan umum smu studi naturalistik pendidikan nilai moral smun 1 sumedang implementasi ktsp mata pelajaran pai (studi sma negeri 3 solok selatan implementasi kurikulum boarding school proses pembelajaran biologi studi evaluatif sit al-multazam kabupaten kuningan implementasi kurikulum level mikro melalui model cooperative learning tipe team games turnament (tgt implementasi kurikulum pendidikan pelatihan bagi peningkatan kompetensi guru ipa pppptk ipa bandung implementasi kurikulum pendidikan keaksaraan berbasis kompetensi studi evaluasi warga belajar pendidikan keaksaraan fungsional implementasi kurikulum pendidikan menengah berciri khas agama islam studi program ips madrasah aliyah negeri surade implementasi kurikulum smk 1994 mata pelajaran agribisnis bentuk pbm kelas studi kualitatif smkn 2subang jawa barat implementasi kurikulum tingkat satuan pendidikan berbasis islam pendekatan mutual adaptive mata pelajaran ipa studi mtsn salido kabupaten pesisir selatan implementasi kurikulum tingkat satuan pendidikan berbasis islam pendekatan mutual adaptive mata pelajaran ipa study mtsn salido kabupaten pesisir selatan implementasi kurikulum tingkat satuan pendidikan mata pelajaran bahasa indonesia madrasah tsanawiyah negeri kolaka kabupaten kolaka implementasi kurikulum memenuhi tuntutan dunia usaha dunia industri studi program studi keahlian teknik otomotif kompetensi keahlian teknik kendaraan ringan smk bandung implementasi lagu kaulinan barudak melalui model carl off`pada siswa kelas iii kegiatan ekstrakurikuler sdn pasirhuni 1 kabupaten sumedang implementasi manajamen stratejik pengembangan program diklat era otda balai besar pendidikan pelatihan kesejahteraan sosial (bbppks implementasi manajemen inovasi pendidikan nonformal pusat pengembangan pendidikan anak usia dininonformal informal regional 1 jaya giri bandung implementasi manajemen strategik pendidikan tinggi kepariwisataan berbasis pelanggan sekolah tinggi pariwisata bandung implementasi manajemen stratejik berbasis kemitraan meningkatkan mutu smkstudi smk kelompok teknologi bidang otomotif kota yogyakarta implementasi mata kuliah budaya sunda sebagai muatan lokal pembinaan akhlak mahasiswa fkip unpas implementasi mata kuliah budaya sunda sebagai muatan lokal pembinaan akhlak mahasiswa fkip unpasupaya pendidikan nilai moral membina disiplin siswa dl sekolah studi tentang upaya guru membina disiplin siswa smu negeri 2 bandung implementasi media audio visual hasil belajar passing pembelajaran futsal putri implementasi media gambar seri peningkatan kemampuan menulis karangan deskripsi siswa kelas v sdn kelanggaran unyur kota serang implementasi media interaktif meningkatkan hasil belajar siswa studi mata pelajaran fisika smpn 1 warunggunung kabupaten lebak-banten implementasi media kartu kata pembelajaran kosakata peningkatan hasil belajar menulis siswa kelas iv sd negeri silebu 1 kecamatan kragilan kabupaten serang implementasi media pembelajaran berbasis adobe flash meningkatkan prestasi belajar siswa standar kompetensi melaksanakan pengukuran besaran listrik smk negeri 2 cimahi implementasi media pembelajaran perangkat lunak logisim meningkatkan pemahaman siswa kompetensi dasar menjelaskan operasi logika implementasi media video pembelajaran menerapkan fungsi periferal instalasi pc implementasi metode amm76;q21;l qur’q21;nq53; pembelajaran pendidikan agama islam studi deskriptif implementasi metode amm77;q13;l qur’q13;nī pembelajaran pendidikan agama islam kelas vii smp negeri 40 bandung implementasi metode mind map meningkatkan kemampuan siswa pembelajaran apresiasi seni rupa sma penelitian tindakan kelas siswa kelas x sma pasundan 1 bandung implementasi metode pembelajaran afika meningkatkan kecerdasan kognitif anak usia 4-6 tahun studi deskriptif pembinaan anak salman itb bandung implementasi metode penemuan terbimbing meningkatkan kemampuan pemahaman konsep penalaran matematis siswa sekolah dasar implementasi metode problem based learning(pbl implementasi metode resitasi berbasis classroom blogging meningkatkan kemampuan pemahaman konsep siswa implementasi metode sinektik pembelajaran sejarah penelitian tindakan kelas kelas vii smplb negeri padjajaran bandung implementasi metode tutor sebaya dapat meningkatkan prestasi belajar motovasi mahasiswa diploma iv regular semester 1 implementasi model bim3ingan ekologis layanan bimbingan karir dl sekolah menengah kejuruan (smk implementasi model cooperative learning tipe listening teamuntuk meningkatkanketerampilan berbicara siswa kelas iv sdn kubang sepat ii kecamatan citangkilkota cilegon implementasi model cooperative learning tipe listening teamuntuk meningkatkanketerampilan berbicara siswa kelas iv sdn kubang sepat ii kecamatan citangkilkota cilegon implementasi model cooperative learning tipe stad meningkatkan hasil belajar siswa tentang sifat bahan kegunaannya penelitian tindakan kelas siswa kelas iv sdn citigeu kabupaten sukabumi implementasi model countenance-stake evaluasi program pendampingan lesson study pembelajaran tematik kkg gugus iv citangkil implementasi model kooperatif two stay two stray meningkatkan hasil belajar siswa standar kompetensi pembelajaran praktikum dasar-dasar elektronika implementasi model mengajar 'active learning' pengajaran pendidikan agama islam (pai implementasi model observasi simulasi (obsim implementasi model pembelajaran berbasis e-learning meningkatkan hasil belajar mahasiswa mata kuliah pengembangan kurikulum implementasi model pembelajaran berbasis masalah meningkatkan kemampuan mengemukakan pendapat siswa penelitian tindakan kelas vii smp negeri 1 purwakarta implementasi model pembelajaran berbasis masalah inkuiri terbimbing meningkatkan keterampilan proses sains pemahaman konsep gelombang siswa smp implementasi model pembelajaran blended learning meningkatkan kemampuan pemahaman konsep siswa sekolah menengah kejuruan (smk implementasi model pembelajaran canter asertif pembelajaran penjas mengembangkan nilai sportifitas studi penelitian tindakan kelas siswa kelas viii a smp negeri 2 katapang kabupaten bandung implementasi model pembelajaran cooperative learning tipe student teams achievement divisions (stad implementasi model pembelajaran example non example upaya meningkatkan motivasi belajar siswa pembelajaran pendidikan kewarganegaraanstudi deskriptifpada siswakelas viismp negeri4 bandung implementasi model pembelajaran experiential kolb berbantu multimedia interaktif meningkatkan kemampuan aplikasi siswa smk bidang rekayasa perangkat lunak (rpl implementasi model pembelajaran hellison pembelajaran aktivitas permainan bolavoli meningkatkan rasa tanggung jawab siswa penelitian tindakan kelas siswa kelas x8-agama man 1 bandung implementasi model pembelajaran inkuiri pembelajaran bola besar penelitian tindakan kelas peserta didik kelas v implementasi model pembelajaran integratif upaya meningkatkan kemampuan berpikir kritis matematis siswa smpsuatu penelitian kuasi eksperimen siswa kelas vii salah satu smp negeri kabupaten bandung implementasi model pembelajaran investigasi kelompok meningkatkan kemampuan mengapresiasi motif batik cirebonan siswa kelas viii smp pasundan 3 bandung implementasi model pembelajaran ipa berbasis karakter studi siswa kelas vi sekolah dasar kota tangerang implementasi model pembelajaran kemandirian berbasis nilai satya darma pramuka membentuk generasi muda mandiri melalui kegiatan alam terbuka implementasi model pembelajaran konstruktivisme tipe novick meningkatkan pemahaman konsep pembiasan cahaya keterampilan generik sains siswa smkn implementasi model pembelajaran konstruktivisme tipe novick meningkatkan pemahaman konsep pembiasan cahaya keterampilan generik sains siswa smkn implementasi model pembelajaran kooperatif tipe numbered head together (nht implementasi model pembelajaran kooperatif tipe teams-games-tournament meningkatkan kemampuan berpikir kritis penalaran matematis siswa madrasah aliyah implementasi model pembelajaran quantum teaching meningkatkan proses belajar ips tentang sumber daya alam sekolah da penelitiantindakan kelas siswakelas iv sd negeri 3 mekarsari kecamatan tambaksari kabupaten ciamis implementasi model pembelajaran sains teknologi masyarakat tema energi alternatif meningkatkan literasi sains siswa smp implementasi model pembelajaran seni terpadu meningkatkan apresiasi kreasi seni rupa terapan tradisional daerah setempat penelitian tindakan kelas siswa kelas x sma negeri i karangnunggal tahun pembelajaran 2009/2010 kabupaten tasikmalaya implementasi model pembelajaran teaching game for understanding (tgfu implementasi model pembelajaran tematik tema kebunku meningkatkan hasil belajar siswa pembelajaran ipa implementasi model pembelajaran tematik meningkatkan kemampuan dasar siswa sekolah dasar implementasi model pembelajaran think talk write meningkatkan kemampuan siswa mata pelajaran diklat elektronika dasar analog digital implementasi model pembelajaran think-pair-share (tps implementasi model pembelajaranpemecahan masalah pendidikan teknologi dasar meningkatkan kreativitas siswa penelitian tindakan siswa sltp taruna baku bandung implementasi model pendidikan resolusi konflik melalui pendidikan kewarganegaraan sekolah menengah atas implementasi model pengembangan nilai-nilai demokrasi melalui pembelajaran kooperatif bagi upaya penumbuhan sikap warga negara demokratis studi deskriptif analitik pembelajaran pkn sman 1 pontianak implementasi model program khusus madrasah aliyah negeri darussalam ciamis analisis efektivitas pengelolaan madrasah aliyah ditinjau dari fungsi-fungsi administrasi pendidikan implementasi model savi (somatis auditori visual intelektual implementasi model teaching game for understanding (tgfu implementasi model teaching personal and social responsibility (tpsr implementasi modifikasi media pembelajaran aktifitas permainan bolavoli meningkatkan waktu aktif belajar implementasi modifikasi permainan bolavoli siswa kelas v sdn pangauban i kabupaten bandung (ptk implementasi nilai – nilai demokrasi melalui kesenian benjang membangun warga negara baik kecamatan ujungberung kota bandung implementasi nilai-nilai good governance perguruan tinggi studi deskriptif analitik tentang pengaruh transparansi akuntabilitas responsiveness budaya akademik prakarsa serta dampaknya mutu layanan akademik perguruan tinggi badan hukum milik negara implementasi nilai-nilai patriotisme siswa melalui kajian biografi raden haji prawatasari pembelajaran sejarah penelitian naturalistik inkuiri sman 1 cianjur implementasi pancasila melalui pendidikan kewarganegaraan sebagai upaya mengembangkan jatidiri bangsa implementasi pelatihan berbasis kompetensi meningkatkan kinerja studi pelatihan berbasis kompetensi bagi pekerja sosial masyarakat (psm implementasi pembelajaran aktif metode peer lesson meningkatkan kemampuan pemahaman komunikasi matematis siswa sekolah menengah pertama implementasi pembelajaran al-qur’an anak usia dini anak usia 5-6 tahun tk islam nur al-rahman kota cimahi implementasi pembelajaran al-quran anak usia dini tk al-quran rumah qurani implementasi pembelajaran berbasis biografis nilai-nilai kejuangan sultan babullah membangun patriotisme nasionalisme penelitian inquiry kualitatif pembelajaran ips sejarah sma negeri 3 ternate implementasi pembelajaran berbasis multikultural mengembangkan sikap toleransi anak taman kanak-kanakstudi deskriptif kualitatif kelompok b taman kanak-kanak bunda balita bandung tahun pelajaran 2012/2013 implementasi pembelajaran berbasis pengalaman membina kemadirian kepemimpinan siswa (proses pengembangan karakter konteks pendidikan kewarganegaraan sekolah lanjutan alam bandung implementasi pembelajaran menggunakan media komputer mengembangkan kreativitas anak tk implementasi pembelajaran generatif berbantuan multimedia interaktif meningkatkan pemahaman konsep keterampilan berpikir kritis siswa sekolah menengah kejuruan (smk implementasi pembelajaran induktif materi kalor meningkatkan pemahaman konsep keterampilan berpikir rasional siswa smp implementasi pembelajaran ipa terpadu tema air kesehatan meningkatkan literasi sains siswa smp implementasi pembelajaran konstruktif membentuk siswa menjadi siswa aktif kelas 4 sd cendekia muda bandung implementasi pembelajaran konstruktif membentuk siswa menjadi siswa aktif kelas 4 sd cendekia muda bandung implementasi pembelajaran kontekstual upaya meningkatkan belajar siswa studi penelitian tindakan kelas mata pelajaran akhlak man 1 pontianak implementasi pembelajaran matematika kontekstual meningkatkan kemampuan pemahaman sikap matematika siswa sekolah dasar studi kuasi eksperimen siswa kelas iv sekolah dasar kecamatan bekasi timur kota bekasi jawa barat implementasi pembelajaran matematika realistik upaya meningkatkan pemahaman konsep dasar pecahan keterampilan berpikir kritis siswa sekolah dasar implementasi pembelajaran matematika realistik upaya meningkatkan pemahaman konsep dasar pecahan keterampilan berpikir kritis siswa sekolah dasar implementasi pembelajaran melukis lilin (candle painting implementasi pembelajaran pendidikan kewarganegaraan melalui model jurisprudensial menumbuhkan kesadaran hukum siswa studi deskriptif siswa kelas xi teknik komputer smk ulil albab depok kabupaten cirebon implementasi pembelajaran pendidikan kewarganegaraan melalui pendekatan tematik sekolah dasar alam bandung implementasi pembelajaran pendidikan kewarganegaran bermuatan pendidikan antikorupsi studi deskriptif sma negeri 8 bandung implementasi pembelajaran sejarah berbasis religi budaya kawasan banten lama suatu kajian transformatif nilai-nilai religi budaya pendidikan sejarah sma implementasi pembinaan kinerja guru smp 3 padalarang kabupaten bandung-barat implementasi pendekatan bermain upaya meningkatakan jumlah waktu aktif belajar gerak siswa pembelajaran pendidikan jasmani sekolah dasar negeri sukarasa 3 4 bandung implementasi pendekatan bermain upaya meningkatkan hasil belajar keterampilan gerak dasar melempar menangkap melalui aktivitas basket ball like games penelitian tindakan kelas kelas vi sdn 3 ciharashas bandung barat implementasi pendekatan contextual teaching and learning menigkatkan keterampilan menulis karangan narasi sekolah dasar negeri ii ciptasaripenelitian tindakan kelas dilakukan siswa kelas iv sekolah dasar negeri ii ciptasari kecamatan pangkalan kabupaten karawang tahun ajaran 2012/2013 implementasi pendekatan permainan belajar lompat smp nasional kota bandung penelitian tindakan kelas implementasi pendekatan problem based learning berbantuan 3d sketchup meningkatkan kemampuan spatial sense siswa sma penelitian kuasi eksperimen siswa kelas x sma negeri 4 bandung implementasi pendekatan somatic auditory visual intellectual (savi implementasi pendekatan taksis permainan bola voli siswa kelas v sdn ciporeat bandung implementasi pendekatan taktis pembelajaran aktivitas penguasaan bola implementasi pendekatan taktis pembelajaran forehand groundstroke permainan tenis lapang penelitian tindakan kelas siswa kelas x2 sma negeri 3 karawang implementasi pendekatan taktis pembelajaran permainan bolabasket studi penelitian tindakan kelas pembelajaran menyerang basket lawan kelas x ips 4 sma negeri 3 cilegon implementasi pendekatan taktis upaya meningkatkanwaktu aktif belajar siswa pembelajaran permainan futsal penelitian tindakan kelas siswa sman 6 garut kabupaten garut implementasi pendekatan taktis upayameningkatkan kemampuan gerak chest pass catching permainan bolabasket implementasi pendekatan taktis pendekatan teknis peningkatan keterampilan dribbling permainan sepakbola studi eksperimen siswa ssb viking soccer school ku-12 implementasi pendekatan taktis hasil belajar permainan bola tangan keterampilan kreatifitas implementasi pendekatan taktis hasil pembelajaran sepakbola implementasi pendekatan taktis motivasi pembelajaran permainan bola tangan implementasi pendidikan agama islam keluarga militer study kasus keluarga kopda tni ad aris riyanto implementasi pendidikan agama islām sekolah alam implementasi pendidikan anti korupsimelalui habituasi pembelajaran pendidikan kewarganegaraan pendidikan kewarganegaraan membangun karakter siswa membangun karakter siswa studi deskriptif smp negeri 1 cianjur-jawa barat implementasi pendidikan inklusif sekolah dasar x y z kota jayapura implementasi pendidikan inklusif sekolah dasar x y z kota jayapura implementasi pendidikan karakter kegiatan storytelling implementasi pendidikan karakter pembelajaran sains sekolah dasarstudi tentang kompetensi guru sdn sukagalih 1 6 kota bandung implementasi pendidikan karakter anak usia dini tka al-mukhlisin cibodas lembang implementasi pendidikan multikultural pembelajaran pendidikan kewarganegaraan sma taruna bakti studi deskriptif sma taruna bakti bandung implementasi pendidikan nilaidalam mata kuliah dasar umum (mkdu implementasi pendidikan politik melaluipembelajaran pkn mengembangkan kompetensi kewarganegaraan sma negeri 2 subang implementasi pengelolaan kekaryaan seni rupa berorientasi aktivitas siswa pelaksanaan pengelolaan kekaryaan seni rupa tiga smp kabupaten majalengka implementasi penggunaan media pembelajaran berbasis perangkat lunak adobe flash pembelajaran teknik digital implementasi penggunaan model cooperative learning tipe student fasilitator and explaining (sfe implementasi perangkat lunak courselab 2 implementasi perangkat lunak logisim 2 implementasi perangkat lunak multisim sebagai media pembelajaran ditinjau dari hasil belajar siswa kompetensi dasar menggunakan komponen elektronika implementasi permainan arisan kata tk baiturrahman pusdikku tni ad-bandung studi deskriftif kelompok a tk baiturahman pusdikku tni adkota bandung tahun pelajaran 2012-2013 implementasi playdough menstimulasi kemampuan motorik halus penelitian tindakan kelas kelompok a tk artha kencana kota serang banten tahun ajaran 2012-2013 implementasi playdough menstimulasi kemampuan motorik halus penelitian tindakan kelas kelompok a tk artha kencana kota serang banten tahun ajaran 2012-2013 implementasi playdough menstimulasi kemampuan motorik haluspenelitian tindakan kelas kelompok a tk artha kencana kota serang banten tahun ajaran 2012-2013 implementasi problem based learning (pbl implementasi problem based learning berbasis ecoshool meningkatkan hasil belajar siswa pembelajaran biologi smp implementasi problem based learning berbasis ecoshool meningkatkan hasil belajar siswa pembelajaran biologi smp implementasi production based education sebagai upaya meningkatkan mutu lulusan pendidikan vokasi akademi teknik soroako implementasi program bimbingan pribadi- sosial meningkatkan penyesuaian sosial anak berbakat akademik implementasi program kerja sekolah bidang kesiswaan pengembangan pendidikan budaya karakter bangsa implementasi program pendidikan lingkungan hidup taman kanak-kanak studi deskriptif tk negeri centeh kota bandung implementasi program pendidikan nilai-nilai kewirausahaan anak usia dini tentang program pembelajaran pendidikan nilai-nilai kewirausahaan kelompok b taman kanak-kanak negeri pembina centeh kota bandung implementasi reward punishment sportivitas siswa permainan sepakbola studi eksperimen sekolah sepakbola psbum fpok upi kota bandung implementasi sistem informasi manajemen akademik berbasis teknologi informasi sekolah dasar sekolah dasar islam terpadu fithrah insani implementasi sistem manajemen mutu layanan akademik guru prestasi siswa implementasi sistem penjaminan mutu sekolah menengah atas negeri kabupaten bandung sman 1 baleendah sman 1 margahayu sman 1 ciparay implementasi smm iso 9001 2000 penjaminan mutu kinerja satuan pendidikanstudi penerapan smm iso 9001 2000 smk n 3 palangka raya implementasi standar proses meningkatkan mutu pembelajaran smp negeri 19 jakarta implementasi strategi active learning tipe peer lesson pembelajaran kosakata adjektiva bahasa jepang implementasi strategi pembelajaran intertekstual materi asam basa kelas xi implementasi strategi pembelajaran intertekstual materi larutan elektrolit nonelektrolit kelas x implementasi strategi pembelajaran intertekstual materi reaksi redoks kelas x implementasi strategi pembelajaran intertekstual materi sistem koloid sma kelas xi implementasi strategi pembelajaran intertekstual submateri pokok kenaikan titik didih larutan sma kelas xii implementasi strategi pembelajaran think-talk-write upaya meningkatkan kemampuan berpikir kreatif koneksi matematik siswa sma eksperimen sma negeri i sumedang kelas xi ipa implementasi tata tertib sekolah penanaman budaya disiplin siswastudi deskriptif smpn i tanjungsiang implementasi teknik cerita berantai peningkatan kemampuan menyimak siswa kelas v sdn kragilan 3 kecamatan kragilan kabupaten serang implementasi teknik skrambel meningkatkan kemampuan membaca pemahaman siswa mata pelajaran bahasa indonesia sd penelitian tindakan kelas kelas iii sdn telajung 01 kecamatan cikarang barat kabupaten bekasi implementasi value clarification technique model analisis nilai meningkatkan tanggung jawab siswa sebagai warga negara baikstudi deskriptif siswa kelas xi pemasaran smk negeri 3 bandung implikasi fungsionalisasi jabatan pengawas sekolah pola pengembangan pengawas sekolah tk sd sdlb propinsi jawa barat studi deskriptif analitis tentang pengelolaan pengembangan pengawas sekolah tk sd sdlb lingkungan kanwil depdikbud propinsi jawa barat implikasi kebijakan pendidikan lingkungan departemen agama pengelolaan tenaga kependidikan madrasah aliyah man 1 kotamadya bandung kanwil dep implikasi kompetensi it mahasiswa hasil pembelajaran perguruan tinggi vokasionalstudi jurusan pendidikan teknik elektro fptk upi implikasi konsep insân kâmil pendidikan umum pondok sufi pomosda implikatur penggunaan bahasa indonesia oleh siswa sma muhammadiyah 4 jakarta jejaring facebook perancangannya sebagai bahan ajar ketrampilan menulis improving students’ ability in writing recount paragraphs through webbing technique an experimental study improving students’ reading comprehension through the scanning technique indeks inklusi sd negeri kabupaten musi banyuasin studi tentang keberhasilan implementasi pendidikan inklusif tahun 2010 individualisasi pendidikan refleksi kritis eksistensialisme søren aabye kierkegaard tentang eksistensi manusia sistem pendidikan indonesia inferensi pornografi tuturan film indonesia bergenre horor melalui perspektif pragmatik inferioritas remaja panti asuhan tiga orang remaja panti asuhan jabal 165 bandung inisiasi respons topik anak adhd (attention deficit hyperactivity disorder inklusivitas kelas hasil belajar peserta didik berkesulitan belajar model pembelajaran kooperatif tipe stadstudi deskriptif tentang model pembelajaran kooperatif stad sd x kota bandung inklusivitas sekolah dasar kota makassar instructional media in teaching english to young learnersa case study in elementary schools in kuningan integrasi nilai agama hubungan bisnis antara nasabah bank bank bni syariah cabang buah batu bandung integrasi nilai islam pembelajaran sains (ipa integrasi pembelajaran sejarah lokal ke sejarah nasional menumbuhkan sikap menghargai sejarah pejuang indragiri hilir studi deskriptif sma negeri 1 tembilahan indragiri hilir riau integrasi pendidikan nilai pembelajaran pai sekolah dasar sebagai upaya pembinan akhlak siswa sd peradaban serang integrasi program pendidikan madrasah pesantren mts pesantren satu atap nurul ihsan kabupaten tasikmalay intensi mengikuti kegiatan organisasi sosial pensiunan studi deskriptif pensiunan pt interaksi sosial pria gay studi seorang pria dewasa awal menjadi gay kota bandung interaksi sosial pria gay studi seorang pria dewasa awal menjadi gay kota bandung interaksi sosial siswa tunanetra lingkungan madrasah aliyah negeri kota sukabumi interalisasi sikap hidup kemandirian reflektif religius pendidik melalui program pembelajaran entrepreneurship interferensi bahasa sunda bahasa indonesia lisan implikasinya pembelajaran berbicara penelitian deskriptif analitik siswa kelas xii ips ma ar-rochmah lembang tahun ajaran 2013/ 2014 interferensi fonologis penggunaan bahasa indonesia lisan studi eksploratif murid - murid sekolah dasar negeri berbahasa pertama melayu palembang kota madya palembang interkoneksi multipel level representasi mahasiswa calon guru kesetimbangan larutan melalui pembelajaran berbasis web internalisasai nilai-nilai akhlak sufi melalui pengkajian kitab sirrul asrar ikhwan thariqah qadiriyyahnaqsyabandiyyah pesantren suryalaya tasikmalaya internalisasi nilai disiplin pembelajaran matematika membentuk siswa kreatif smpn 10 kota pontianak internalisasi nilai integrasi menciptakan keharmonisan hubungan antaretnik kabupaten ketapang kalimantan barat internalisasi nilai kerjasama kuliah kerja mahasiswa berbasis participatory action research sebagai upaya mewujudkan kepedulian sosial ( pengembangan model iain syekh nurjati cirebon internalisasi nilai peduli lingkungan melalui pembelajaran berbasis kearifan lokal studi sdn antasan besar 7 banjarmasin internalisasi nilai-nilai budaya dati pembelajaran sejarah meningkatkan solidaritas siswapenelitian tindakan kelas sekolah madrasah aliyah swasta mareku-kota tidore kepulauan internalisasi nilai-nilai da’wah sekolah tinggi ilmu da’wah mohammad natsir internalisasi nilai-nilai ibadah syaum pondok pesantren kesalehan sosial pondok pesantren al-muhajirin purwakarta internalisasi nilai-nilai kecerdasan moral anak usia dini studi deskriptif analisis tk salman al farisi bandung internalisasi nilai-nilai kemandirian siswa pembelajaran ilmu pengetahuan alam sekolah dasar negeri 09 sungai raya kubu raya internalisasi nilai-nilai kewirausahaan pengembangan pembelajaran ips materi proses perkembangan kebudayaan islam indonesia internalisasi nilai-nilai kewirausahaan melalui proses pembelajaran menumbuhkembangkan kemandirian usahastudi deskriptif analitis program pendidikan santri mukim akhlak plus wirausaha pesantren daarut tauhiid bandung internalisasi nilai-nilai pendidikan luqman al-hakim pembinaan akhlak siswa sekolah dasar islam terpadu al-iman bogor internalisasi soft skills melalui diklat pakem rangka meningkatkan mutu pendidikan interpretasi badekan rubrik jogregan harian umum kabar cirebon interpretasi porno melalui inferensi pragmatik lirik lagu dangdut album kamasutra dipopulerkan oleh julia perez invasi sekutu operasi militer pulau sisilia tahun 1943 inventarisasi dongeng kacamatan nagrak kabupaten sukabumi pikeun bahan pangajaran ngaregepkeun smp invéntarisasi dongéng kacamatan nagrak kabupatén sukabumi pikeun bahan pangajaran ngaregepkeun smp irak bawah kepemimpinan saddam hussein kejayaan sampai kejatuhannya dari tahun 1979-2003 istilah tatanén ngahuma desa bencoy kecamatan cireunghas sukabumi pikeun bahan pangajaran maca sma kelas xii istilah-istilah dina kasenian penca silat panglipur kalurahan balééndah kacamatan balééndah kabupatén bandung pikeun salah sahiji alternatif bahan ajar maca bahasan kasenian sma kelas xii istilah-istilah dina kasenian penca silat panglipur kalurahan balééndah kacamatan balééndah kabupatén bandung pikeun salah sahiji alternatif bahan ajar maca bahasan kasenian sma kelas xii isu gender kumpulan cerpen karya danarto relevansinya pembelajaran sastra berperspektif gender sekolah menengah atas jenis-jenis perilaku indisipliner siswa upaya mengatasinya pengajaran ppkn penelitiannaturalistik-kualitatifpada smu negeri 1 cianjur judul penerapan teknik transformasi lirik lagu pembelajaran menulis paragraf narasi siswa sekolah menengah atas penelitian eksperimen kelas x sman 6 bandung tahun pelajaran 2012/2013 judul pengaruh layanan akademik kesiapan industri efektivitas praktek kerja industri siswa smkn 1 gantar kabupaten indramayu julukan klub sepak bola indonesia kadar cbsa proses belajar-mengajar pendidikan umum dilihat dari latar belakang pribadi guru sikapnya cbsastudi deskriptif-anaiitik tentang kadar cbsa pbm pendidikan umum beberapa sma negeri kota madya manado kabupaten minahasa kajian analitis tentang kesadaran masyarakat membayar pajak bumi bangunan/pbb studi deskriptif masyarakat desa kayuambon kecamatan lembang kabupaten bandung barat kajian atas kumpulan cerpen rectoverso karya dee sebagai alternatif bahan pembelajaran bahasa indonesia smk yppt bandung kajian bahasa tutur ragam pramuwisata studi deskriptif penggunaan bahasa indonesia kegiatan memandu wisatawan oleh mahasiswa sekolah tinggi parawisata bandung tahun ajaran 1996/1997 kajian bandingan wawacan layang syekh abdul qadir jaelani manaqib syeh abdul qadir jaelani pemanfaatannya bagi pendidikan kajian etnografi makna syair lagu ritual daur hidup masyarakat suku nuaulu pulau seram kabupaten maluku tengah model pelestariannya kajian etnokoreologi tari wayang srikandi-mustakaweni kajian fenomenografi aspek-aspek model mental subyek lintas level akademik problem solving konsep dasar mekanika kajian fenomenografi aspek-aspek model mental subyek lintas level akademik problem solving konsep dasar mekanika kajian fenomenologis tentang pola pendidikan karakter melalui sistem fullday school sma labschool universitas syiah kuala kajian filosofi kurikulum pendidikan umum kajian fonetis tuturan anak penyandang tunagrahita slb-c sukapura kiaracondong kajian gambar ekspresi karya siswa tingkat sekolah dasar kajian implementasi pembelajaran pemahaman konsep materi sifatnya guru ipa smp peserta program bermutu mgmp sub rayon i tanjungsari kajian implementasi pendidikan lingkungan hidup kota bandung smpn 7 kota bandung kajian kesesuaian pembelajaran matematika capaian perkembangan kognitif anak tunagrahita kelas satu sdlb npm kajian kualitas air tanah sekitar kawasan budidaya ikan keramba jaring apung waduk jatiluhur kabupaten purwakarta kajian linguistik klinis anak labioshizchis pascaoperasi bibir sumbing kesulitan artikulasi fonem konsonan bahasa inggris upaya penanggulangannyapada anak labioshizchis sebuah smp negeri kabupaten bandung kajian makna filosofi motif batik gajah oling banyuwangi kajian makna nilai budaya konteks seni tradisional indramayu sintren serta upaya pewarisannya kajian marawis seni bernuansa islami tasikmalaya kajian marawis seni bernuansa islami tasikmalaya kajian morfosemantis ra-nuki kotoba percakapan drama jepang kajian nilai budaya karakter tokoh remaja novel negeri 5 menara karya ahmad fuadi sebagai bahan pembelajaran apresiasi sastra sma kajian nilai budaya pesta laut nadran masyarakat pesisir sebagai sumber pembelajaran pendidikan kewarganegaraan studi deskriptif analitis tradisi upacara nadran desa waru duwur kecamatan mundu kabupaten cirebon kajian nilai karakter tokoh utama cerita rakyat kecamatan darmaraja kabupaten sumedang model pelestariannya kajian nilai moral karya iwan fals sebagai inspirator kesadaran sosial ( dpd knpi kab kajian nilai moral citraan cerpen konten proses sosial kabar kaitannya pemilihan bahan ajar hasil pembelajaran bahan sastra indonesia sekolah menengah atas kajian nilai-nilai lirik lagu indonesia respons pendengar serta pengemasannya sebagai bahan ajar puisi smp kajian on street parking ruas jalan gardujati kajian pemakaian kode bahasa masyarakat dwibahasawan pangandaran kabupaten ciamis alternatif model pembelajaranya berbasis multikultural kajian pembinaan akhlak mulia siswa melalui kegiatan ekstrakurikuler rohani islam (rohis kajian pengembangan bahan ajar berorientasi literasi sains pendidikan dasar kajian penggunaan ruang publik fptk upi sebagai tempat aktivitas mahasiswa kajian psikolinguistik penderita afasia broca pascastrokepemanggilan leksikon kekeliruan berbahasa siasat komunikasi kajian psikologi sastra dimensi emosional spiritual nyanyian kanak masyarakat tambelan kepulauan riau implikasinya pendidikan anak usia dini kajian semiotik nilai moral pementasan drama ah matjam-matjam maoenja karya moliere serta kemungkinan pemanfaatannya sebagai bahan ajar mata kuliah kajian drama jurusan pendidikan bahasa indonesia universitas negeri medan kajian semiotik gurindam dua belas karangan raja ali haji aplikasinya pembelajaran sastra sma kajian semiotik novel perempuan berkalung sorban karya abidah el khalieqy kajian simiotik puisi koran studi deskriptif-analitis puisi koran sebagai alternatif bahan ajar kesusastraan sekolah lanjutan tingkat atas kajian stilistika nilai budaya puisi indonesia sebagai bahan pembelajaran sastra bagi siswa kelas viii mts misykat al-anwar kwaron diwek jombang kajian struktur nilai-nilai karakter cerita rakyat daerah sumedang sebagai bahan ajar apresiasi sastra proses pembelajarannya sekolah menengah atas kajian struktur konteks pertunjukan fungsi kakawihan kaulinan barudak lembur masyarakat sunda serta model pelestariannya kajian struktur konteks fungsi pertunjukan nyanyian dambus serta upaya pelestariannya melalui kegiatan ekstrakurikuler smk i simpangkatis kabupaten bangka tengah kajian struktur nilai budaya konteks cerita rakyat masyarakat panjalu ciamis penyusunan bahan ajar mata pelajaran bahasa sastra indonesia siswa sekolah menengah kejuruan kajian tata ruang sas center smk negeri 6 bandung kajian tentang budaya demokrasi pesantren mengembangkan civic disposition santri studi deskriptif pesantren al-basyariah bandung kajian tentang desain ruang belajar sekolah dasar luar biasa tunanetra slb a bandung kajian tentang evaluasi on street parking jalan suniaraja kota bandung kajian tentang kecerdasan sosial mahasiswa pelatihan manajemen kepemimpinan efektif proses pelatihan manajemen kepemimpinan mahasiswa efektif jurusan pendidikan kewarganegaraan fakultas pendidikan ilmu pengetahuan sosial universitas pendidikan indonesia kajian tentang kesadaran masyarakat membayar pajak bumi bangunanstudi deskriptif analitis masyarakat desa kayuambon kecamatan lembang kabupaten bandung barat kajian tentang kompetensi mahasiswa merekonstruksi pembelajaran terpadu studi inkuiri naturalistik mahasiswa semester enam jurusan pendidikan ips fkip - universitas islam riau kajian tentang makna modernisasi pesantren terpadumenyimak keterpaduan kegiatan penyelenggaraan pendidikan luar sekolah pendidikan sekolah pesantren al-fath cicalengka bandung kajian tentang nilai-nilai kesenian tari topeng memperkaya civic culture kota cirebon studi deskriptif sanggar seni sekar pandan kota cirebon kajian tentang perilaku menyimpang kalangan siswa sma studi deskriptif sma negeri 1 ciamis kabupaten ciamis kajian tentang perilaku siswa salat jumat kajian tentang program ujian kader partai golkar meningkatkan etika politik kajian tentang upaya pewarisan nilai budaya pesta serang meningkatkan kesadaran masyarakat mempertahankan civic culture studi deskriptif desa serang kecamatan klangenan kabupaten cirebon kajian kualitas pembelajaran kelas produktif teknik gambar bangunan smk negeri 2 tasikmalaya kajian upacara adat laku pepe laku kungkum sebagai pelaksanaan kewajiban adat kajian tingkat kesadaran hukum pedagang kaki lima menjadi warga negara baik studi deskriptif pedagang kaki lima kabupaten sumedang kajian tingkat kesadaran hukum pedagang kaki lima menjadi warga negara baik studi deskriptif pedagang kaki lima kabupaten sumedang kajian tingkat kesadaran hukum pedagang kaki lima menjadi warga negara baikstudi deskriptif pedagang kaki lima kabupaten sumedang kajian tradisi nganggung masyarakat bangka perayaan hari besar islam pemanfaatannya sebagai bahan ajar berorientasi kecakapan hidup pembelajaran berbicara smk kajian unjuk kerja cuso4 anhidrat sebagai purifier bioetanol kajian variabel penentuan harga jual rumah metode titik impas (break even point kajian variabel penentuan nilai harga jual rumah metode titik impas (break even point kajian visual celengan gerabah desa arjawinangun blok posong kabupaten cirebon kajian visual makna ornamen hias bangunan paseban tri panca tunggal cigugur kabupaten kuningan kajian visual makna ornamen hias bangunan paseban tri panca tunggal cigugur kabupaten kuningan kajian visual desain sampul buku novel karya andrea hirata kajian visual desain sampul buku novel karya andrea hirata kajian visual kriya spun bambu desa somagede kecamatan sempor kabupaten kebumen jawa tengah kajian visual properti seni pertunjukkan buaya putih kajian visual relief monumen perjuangan jogja ii kabupaten sumedang kalungguhan tokoh wanoja dina kumpulan carpon haté awéwé karangan risnawatitilikan féminisme kandungan nilai kearifan lokal leksikon batik trusmi kajian etnolinguistik karakterisasi morfologi hubungan filogenetik sepuluh kultivar nanas (ananas comosus (l karakterisasi sensor has to berbasis 5ho2 metode sol gel menggunakan teknologi thick film karakteristik implementasi kurikulum muatan lokal kaitannya perkembangan kebutuhan masyarakat setempat karakteristik tanggapan wisatawan pelayanan pengelola taman wisata alam gunung tangkuban parahu karakteristik daya tarik wisata wisatawan kabupaten belitung karakteristik hamba allāh al-qur`ān implikasinya pengembangan pendidikan islam studi tafsīr q karakteristik proses belajar mengajar filsafat pancasila ditinjau dari pendidikan umum suatu sludi dosen filsafat pancasila ikip yogyakarta karakteristik proses belajar mengajar penataran p4 pola 4 5 jam bagi mahasiswa barustudi kuaiitatif tentang penataran p4 pola 45 jam bagi masiswa barii ikip malang karinding kawung kajian hérméneutik kana seni tradisional cinéam karir sebagai motivasi pengembangan diri wanita menunda menikah tiga wanita karir menunda menikah kasalahan morfologis dina karangan naskah drama siswa kelas ix smpn 6 bandung taun ajaran 2013/2014 kasenian bring-brung kalurahan ledeng kacamatan cidadap kota bandung pikeun bahan pangajaran maca sma ulikan struktural-sémiotik kawasan wisata taman mini indonesia indah dampaknya kehidupan sosial-ekonomi kecamatan makasar kajian historis tahun 1975-2000 keanekaragaman kelimpahan collembola kebun brokoli (brassica oleracea l keanekaragaman kelimpahan lepidoptera objek wisata hutan lindung curug sawer cililin bandung barat kearifan lokal masyarakat pekon pahmungan pelestarian repong dammar kawasan penyangga taman nasional bukit barisan selatan (tnbbs keberadaan pedagang taman wisata alam cimanggu berdasarkan tanggapan pengelola wisatawan keberadaan pedagang taman wisata alam cimanggu berdasarkan tanggapan pengelola wisatawan keberhasilan cabang olahraga membuat program latihan tidak membuat program latihan hasil tes kemampuan fisik atlet pelatkab karawang menuju porda 2014 keberhasilan pendidikan luar sekolah pembinaan sikap kewiraswastaan melalui pembelajaran pembinaan motivasi warga belajarstudi deskriptif analitik warga kelompok beiajar tata rias kacantikan rambut sanggar kegiatan beiajar babakan ciparay bandung keberhasilan program praktek kerja industri (prakerin kebijakan pendanaan pendidikan studi tentang program implementasi dampak pengawasan pertanggungjawaban pendanaan pendidikan kota salatiga kabupaten semarang provinsi jawa tengah kebijakan the great leap forward mao tse tung dampaknya industri china tahun (1958-1962 kebutuhan belajar motif berprestasi proses pembelajaran sebagai faktor determinatif prestasi belajar peserta latihan kerja kebutuhan penyediaan tenaga guru taman kanak-kanak daerah kabupaten sleman daerah istimewa yogyakarta periode tahun 1979/1980 sampai 1988/1989 kecap pagawéan dina fiksimini basa sunda kecenderungan cara berfikir anak cerdas istimewa pemecahan masalah geometri seorang anak 9 tahun diduga berbakat matematik kecenderungan berfikir sebagai pembelajar visual -spasial visual-spatial learner kecenderungan kepribadian peserta didik berdasarkan tingkat gejala stres akademik kedudukan opsir cina pemerintahan hindia belanda batavia antara tahun 1910-1942 keefektifan media komik peningkatan kemampuan berpikir kreatif kemampuan mengapresiasi drama keefektifan media realia pembelajaran menulis karangan narasi sugestif penelitian eksperimen semu siswa kelas vii smpn 1 lembang tahun ajaran 2008/2009 keefektifan media tayangan anak-anak bocah petualang trans7 pembelajaran menulis puisi keefektifan media vcd lagu grup vokal raihan pembelajaran menulis puisi penelitian eksperimen semu siswa kelas vii smp negeri 4 bandung tahun ajaran 2011-2012 keefektifan metode cleo (claim law evaluation and outcome keefektifan metode pembelajaran bahasa komunitas berorientasi kecakapan hidup bagi peningkatan kemampuan membaca pemahamanpenelitian subjek tunggal peserta kelompok belajar pendidikan keaksaraan nagari salayo kecamatan kubung kabupaten solok keefektifan metode tongkat berestafet menceritakan tokoh idola pembelajaran berbicara eksperimen kuasi siswa kelas vii semester 2 smp pasundan 3 bandung tahun ajaran 2012/2013 keefektifan model calla (cognitive academic language learning approach keefektifan model pembelajaran group field tour meningkatkan kemampuan menemukan ide menulis puisi sekolah dasar studi kuasi eksperimen siswa kelas 5 sd gugus padamulya kecamatan majalaya kabupaten bandung tahun pelajaran 2010/2011 keefektifan model pembelajaran menulis puisi model pembelajaran terpadu bentuk nested berorientasi kecerdasan berpikir keterampilan sosial penelitian eksperimen siswa kelas vii smp islam al azhar 5 cirebon tahun ajaran 2011/2012 keefektifan model proyek respons kreatif pembelajaran menulis teks berita studi eksperimen kuasi siswa kelas viii smp negeri 10 bandung tahun ajaran 2011/2012 keefektifan multimedia pembelajaran idoudoushi mahasiswa akademi pariwisata makasar keefektifan penerapan attention through music (atm keefektifan penerapan teknik bercerita berpasangan pembelajaran apresiasi dongeng diperdengarkan studi eksperimen semu siswa kelas vii smpn 10 bandung tahun ajaran 2011/2012 keefektifan penggunaan komik rama sinta melalui strategi pemetaan pikiran pembelajaran menulis cerpen berorientasi nilai karakter penelitian kuasi eksperimen siswa kelas x sma bina muda cicalengka keefektifan penggunaan media video kerusakan lingkungan pembelajaran menulis paragraf persuasif siswa kelas x sma negeri 24 bandung keefektifan penggunaan strategi kwl (know-want to know-learned keefektifan tayangan fiksi musikal apologia sebuah nama karya revolvere project pembelajaran menulis puisi studi eksperimen kuasi siswa kelas x-9 sma 1 cicalengka bandung tahun ajaran 2011/2012 kegagalan suatu operasi militer sekutu arnhem 1944 kegiatan bermain musik bagi anak autis taman musik dian indonesia cilandak barat jakarta selatan kegiatan bernyanyi siswa down syndrome slb-c yayasan karya bakti garut kegiatan guru pembimbing melaksanakan tugas smu kendalanya smu 3 bandung rangka merumuskan upaya peningkatan mutu kegiatan guru pembimbing kegiatan laboratorium berbasis inkuiri submateri pokok sel volta meningkatkan literasi sains siswa sma kegiatan pembelajaran realistic mathematics education (rme kehidupan arat sabulungan masyarakat tradisional mentawai kehidupan nyai jawa barat kajian historis tahun 1900-1942 kehidupan petani sayur desa cibodas kecamatan lembang tahun 1992-2010 kehidupan suku anak – kecamatan air hitam kabupaten sarolangun kelas verba kalimat bahasa sunda kajian role and reference grammar kemampuan berbicara argumentatif anak keluarga multikultural pola asuh otoritatif sebuah alternatif pendekatan pembelajaran berbicara kemampuan berbicara penerapan model pembelajaran jurisprudensial siswa kelas xi smk citra bangsa kemampuan berpikir kreatif siswa smp materi dampak kepadatan penduduk lingkungan melalui pembelajaran berbasis proyek kemampuan berpikir kritis kreatif matematis siswa smp melalui pembelajaran berbasis masalah strategi konflik kognitif kemampuan berpikir kritis kreatif matematis siswa smp melalui pembelajaran berbasis masalah strategi konflik kognitif kemampuan berpikir kritis kreatif matematis serta karakter siswa pembelajaran matematika realistik berbasis budaya kemampuan berpikir kritis siswa sma melalui pembelajaran guided inquiry subkonsep pencemaran air kemampuan berpikir kritis siswa smp melalui problem based instruction (pbi kemampuan berpikirkreatif matematis self efficacy matematika siswa sekolah menengah atas (sma kemampuan guru sd melaksanakan tugas bagi telah mengikuti tugas belajar program s-1 lingkungan dinas p k dati i propinsi riau kemampuan ibu balita penggunaan kartu kembang anak (kka kemampuan ibu balita penyelenggaraan makanan pendamping asi kelurahan leuwigajah cimahi selatan kemampuan inkuiri sikap ilmiah guru biologi sma kota bandung setelah melaksanakan kegiatan inkuiri ilmiah kemampuan interpretasi gambar grafik siswa tes literasi sains pisa tes kemampuan dasar kemampuan kolaboratif mahasiswa perkuliahan bimbingan perawatan anak melalui kegiatan lesson study kemampuan komunikasi penalaran matematis serta karakter siswa sma pembelajaran strategi brain-based learning kemampuan matematis ditinjau dari perbedaan gender kemampuan membaca huruf hiragana siswa kelas x sman 14 bandung tahun ajaran 2012-2013 kemampuan membaca huruf katakana siswa kelas xi sma pasundan 8 bandung kemampuan membaca permulaan siswa low vision kemampuan membaca permulaan siswa low vision kemampuan metakognisi pemecahan masalah matematis siswa smp pembelajaran matematika metode eksplorasi kemampuan pemahaman komunikasi matematis siswa pembelajaran kooperatif berbasis konflik kognitif kemampuan pemahaman kosakata siswa tunarungu hambatan majemuk slb bc pambudi dharma 2 cimahi kemampuan pemahaman berpikir kritis disposisi matematis siswa sma melalui strategi pembelajaran think-pair-square-share pendekatan induktif-deduktif kemampuan profesional motivasi kerja guru kinerja mengajarnya sma negeri kota cimahi kemampuan reflektif mahasiswa perkuliahan bimbingan perawatan anak melalui kegiatan lesson study kemandirian perilaku remaja tunarungu slb permata cianjur kemasan sisingaan grup setia wargi muda kabupaten subang no panggil s sdt pus k-2013 kendala kendala belajar dominan dihadapi warga belajar program pendidikan paket b setara smp kepedulian masyarakat kelurahan ciumbuleuit kecamatan cidadap kota bandung wilayah punclut sebagai kawasan konservasi kawasan bandung utara (kbu kepemimpinan berbasis nilai (value-based leadership kepemimpinan berbasis nilai konteks peningkatan mutu pendidikan penerapan kepemimpinan berbasis nilai sekolah islam terpadu menuju ke arah pengembangan sekolah islam bermutu kepemimpinan berbasis nilai konteks peningkatan mutu pendidikan penerapan kepemimpinan berbasis nilai sekolah islam terpadu menuju ke arah pengembangan sekolah islam bermutu kepemimpinan dl lingkungan pesantren santi asromo majalengka era perubahan kepemimpinan guru iklim organisasi kelas hubungannya perilaku belajar siswa suatu studi sekolah dasar kecamatan tilatang kamang kabupaten agam provinsi sumatera barat kepemimpinan kepala sekolah mengembangkan sekolah efektif studi sma titian teras muara jambi sma negeri 1 kota jambi sma negeri 2 sarolangun kepemimpinan kepala sekolah mengembangkan sekolah efektif studi sma titian teras muara jambi sma negeri 1 kota jambi sma negeri 2 sarolangun sumber daya air berbasis client-server asuhan keperawatan tn n gangguan isolasi sosial menarik diri ruang abimanyu rsjd surakarta evaluasi kinerja ruas jalan lintas kabupaten ( ruas jalan ngadirojo wonogiri jatipuro karanganyar) hubungan antara kecerdasan emosi perilaku melanggar peraturan lalu lintas pengendara sepeda motor kepuasan tenaga pendidikan pembinaan layanan kesejahteraan universitas muhammadiyah surakarta upaya polsek singosari menanggulangi penambangan pasir tanpa izin desa toyomarto kecamatan singosari analisis data citra noaa/avhrr catch effort survey sebagai dasar pendugaan potensi sumberdaya ikan pelagis analisis determinan pemakaian kontrasepsi nusa tenggara baratsuatu analisis data hasil pilot susenas 1991 kebutuhan reformasi layanan pos kebijakan publik meningkatkan kinerja layanan pos era pasar bebas model pengelolaan air bawah tanah daerah resapan cekungan semarang kab semarang propinsi jawa tengah strategi pemasaran jasa perawatan pesawat terbang komponennya ( garuda maintenance facility) analisa tegangan pipa bawah laut akibat gerakan lay-barge saat laying berdasar ranah frekuensi analisis manajemen pengelolaan limbah medis rsud kayuagung kabogan komering ilir propinsi sumatera selatan arsitektur tradisional cibal manggarai flores barat asuhan keperawatan tn s isolasi sosialmenarik diri bangsal pringgondani rsj daerah surakarta dasar program perencanaan perancanagan arsitektur pengembangan markas pusat pemadam kebakaran surakarta evaluasi implementasi kebijakan pemberian hak desain industri oleh direktorat jenderal hak kekayaan intelektual optimasi alokasi batu bara pertimbangan biaya produksi emisi sulfur pendekatan sistem dinamik penerapan kurikulum tingkat satuan pendidikan (ktsp) ( smp muhammadiyah i sragen tahun 2007/2008) pengaruh komunikasi keluarga kenakalan remaja ( kelurahan tamansari kerjo karanganyar) perencanaan perancangan arsitektur (ppa) pusat informasi pariwisata kebudayaan kabupaten karanganyar sistem pengamanan fisik mapolabes bandar lampung kaitannya peningkatan pelayanan kepada masyarakat tinjauan perilaku minum minuman beralkohol gangguan kondisi kesehatan pemuda desa kiringan boyolali faktor-faktor kendala internalisasi pendidikan agama islam siswa madrasah aliyah negeri boyolali tahun 2007 hubungan antara gaya kepemimpinan demokratis komitmen organisasi karyawan pttainesia jaya wonogiri implementasi kurikulum tingkat satuan pendidikan (ktsp) smk muhammadiyah 2 surakarta tahun ajaran 2007 2008 implementasi kurikulum tingkat satuan pendidikan (ktsp) smp negeri 2 nogosari boyolali tahun ajaran 2007/2008 kajian penerapan zona selamat sekolah lalu lintas ( jl gajahmada jl veteran surakarta) pemberdayaan masyarakat mencegah penambangan pasir tanpa ijin kecamatan cileungsi oleh polsek cileungsi pengaruh inhibitor logam bahan organik parameter kinetika pertumbuhan mikroba pembuatan biogas pengembangan model heuristik dynamic integrated inventory and distribution problem retailer chain peran desa adat pelestarian fungsi lingkungan hidup ( obyek wisata hutan sangeh badung bali) prosedur penerimaan pesanan produk karton box divisi corrugated pt pindo deli pulp and paper mills karawang sikap alumni fakultas hukum universitas airlangga surabaya bekerja luar bidang hukum profesinya studi kandungan total karbohidrat biofilm substrat kaca kayu baja beton perairan jembatan suramadu analisis perancangan aplikasi gis penentuan lokasi pengeboran sumur lapangan minas pt cpi faktor-faktor berhubungan kejadian tb paru usia 0-14 tahun kotamadya jakarta timur tahun 2004 hubungan antara konflik intergroup sikap egois motivasi mengatasi kendalakendala tenaga pemasaran pengembangan bi'ah arabiyyah ma'had sunan ampel al-aly universitas islam negeri (uin) malang hasyim amrullah penyidikan tindak pidana illegal logging kabupaten banjar oleh satuan reskrim polres banjar kalimantan selatan peran satuan brimob polda bengkulu pencegahan tindak pidana illegal logging wilayah hukum polda bengkulu upaya penanganan tindak pidana perburuan liar satwa langka taman nasional way kambas oleh polres lampung timur analisis kinerja pelayanan importasi jalur hijau kantor wilayah vi direktorat jenderal bea cukai semarang kinerja unit rpk polres malang penanganan kasus tindak pidana kekerasan dlam rumah tangga perempuan model prediksi faktor-faktor berhubungan waktu kerja produktif perawat kesehatan puskesmas april 2001 optimasi jumlah titik kontrol tanah koreksi geometris citra radarsat landsat tm metode polinomial pembinaan akhlaq remaja remaja penderita kecanduan obat bius pesantren suryalaya tasikmalaya pengaruh kompensasi komunikasi prestasi kerja karyawan perusahaan meubel cv mugiharjo boyolali pengaruh perubahan sosial akibat pembangunan kawasan industri buntaran pola pemukiman petani tambak garam pengaruh tata letak massa bangunan efektivitas pembelajaran sistem kelas berjalan smk negeri 6 bandung peranan babinkamtibmas mencegah tindak pidana penambangan batubara tanpa izin wilayah hukum polsek talawi perancangan implementasi pengaturan saat penyalaan spark ignition engine menggunakan kontroler knowledge-based hubungan insentif disinsentif pengelolaan tanah kecamatan satar mese kabupaten dati ii manggarai ntt interaksi sosial teman sebaya anak homeschooling anak sekolah reguler (study deskriptif komparatif penegakan hukum kasus kebakaran hutan dilakukan oleh korporasi areal hti hph kalimantan barat pengaruh kedisiplinan kerja jaminan sosial kepuasan kerja karyawan bpr bkk karangmalang sragen persepsi karakteristik individu tentang standar akuntansi pemerintahan ( pemerintah kota surakarta) problematika pengajaran bidang studi pendidikan agama islam smp negeri 1 nguter sukoharjo tahun ajaran 2007-2008 studi implementasi program penanggulangan kemiskinan perkotaan (p2kp) kecamatan semarang timur kota semarang hubungan antara perubahan sosial budaya masyarakat peningkatan kualitas pembelajaran ppkn/pkn sekolah kualitas layanan pajak kendaraan bermotor kantor sistem administrasi manunggal satu atap (samsat) kota surakarta masalah-masalah sosial novel ketika cinta bertasbih karya habiburrahman el shirazytinjauan sosiologi sastra model pengelolaan sampah berbasis kesehatan masyarakat estimasi pembiayaan tahun 2005-2030 kota tanjungpinang pelaksanaan perjanjian kerjasama antara perum perhutani perkumpulan masyarakat desa hutan kabupaten blora pengaruh variasi konsentrasi larutan nacl konsentrasi 35% 4% 5% laju korosi baja karbon sedang perancangan sistem pendukung keputusan (spk) perencanaan produksi pt (persero) inka - madiun sinergitas polres asahan dinas kehutanan rangka pencegahan pembalakan liar demi terciptanya ketaatan hukum analisis produk reject pembuatan pcb menggunakan metode the seven qc tools pt java persada elektrindo hubungan antara persepsi teknologi komputer perilaku disiplin motivasi belajar taruna polisi kontribusi sistem informasi manajemen akademik meningkatkan sistem pembelajaran institut teknologi bandung pengaruh fraksi volume core serbuk arang tempurung kelapa kekuatan bending impak komposit sandwich perancangan tangga kereta api ramp ergonomis aksesibel pengguna kursi roda kereta api prameks tinjauan tentang keunggulan kompetitif produk karton box divisi corrugated pt pindo deli pulp and paper karawang analisis formulasi strategi bank milik pemerintah daerah ( pd bpr bank pasar lamongan jawa timur) dasar program perencanaan perancangan arsitektur (dp3a ) out bound center obyek wisata curugsewu patean kendal hubungan antara kompetensi guru persepsi gaya kepemimpinan transformasional performansi kerja guru kontribusi sistem informasi manajemen akademik sistem pembelajaran institut teknologi bandung () pembuatan prototipe aplikasi wireless menggunakan teknologi java sistem informasi akademik politeknik caltex riau penerapan sistem pengendalian kualitas metode gugus kendali mutu upaya menurunkan persentase produk rusak pengaruh sistem pengendalian intern kepatuhan wajib pajak hotel memenuhi kewajibannya kota semarang pengelolaan air bersih rumah sakit sebagai upaya minimisasi limbah cair (rumah sakit umum daerah ungaran) peran orang tua mengatasi kesulitan belajar anak ( siswa kelas ii smu muhammadiyah 3 surakarta) analisis pengaruh gaya kepemimpinan situasional kepuasan kerja karyawan ptpln unit pelayanan bandung utara asuhan keperawatan tn a gangguan pernafasan asma bronkial bangsal cempaka rsud pandan arang boyolali hubungan antara stress kerja persepsi ketaatan aturan lalu lintas supir bus jurusan purwodadi-solo kesadaran hukum pengusaha melestarikan fungsi lingkungan hidup (studi pengrajin batik tamansari yogyakarta) model penilaian penerapan produksi bersih industri tekstil ( pt apac inti corpora &amp pengaruh kepemimpinan motivasi kerja prestasi kerja karyawan pt alfa retailindo kartasura surakarta globalisasi pendidikan studi deskriptif tentang wacana globalisasi pendidikan lingkungan universitas airlangga hubungan antara konsep diri kecemasan menghadapi masa depan narapidana lembaga pemasyarakatan ii b klaten motivasi wali santri menyekolahkan putera-puterinya ke madrasah diniyah awaliyah (mda) syarif makamhaji tahun 2008-2009 pengaruh fasilitas umum harga pokok tanah analisa kelayakaninvestasi perumahan puri gading puri gading pengaruh perubahan jumlah muatan refrigeran fraksi uap refrigeran masukan evaporator sistem refrigerasi peran babinkamtibmas menanggulangi penambangan pasir batu liar kecamatan tanjung agung kabupaten muara enim tingkat pengetahuan orang tua murid sltp tentang narkotika alkoho zat adiktif lainnya kotamadya depok tahun 2002 alasan pegawai pt bank negara indonesia (persero) tbk mengundurkan diri rangka program pensiun sukarela (pps) 2006 fenomena kemiskinan masyarakat pengaruh songket berada lokasi sentra industri songket palembang sumatera selatan pemakaian busana muslimah serta perilaku personal sosial mahasiswa universitas negeri malang ika fauziah rochmawati penambahan lensa konveks guna memperbesar keluaran daya dihasilkan oleh panel tenaga surya sebagai tenaga alternatif penerapan metode perencanaan peningkatan kinerja pelaksanaan proyek jembatan lingkungan dpu bina marga jawa timur pengaruh disiplin kerja komunikasi kepuasan kerja karyawan pt hamudha prima media pajang sukaharjo pengaruh kompensasi finansial kinerja karyawan bagian pemasaran allianz life indonesia cabang bouraq surabaya pengaruh konversi lahan kualitas hidup petani petani padi sawah kecamatan teluk jambe kabupaten karawang pengembangan strategi bauran pemasaran toyota corolla pasar kompetitif pt new ratna motor semarang perancangan strategi pelayanan instalasi rawat inap bedah rsud drsoetomo surabaya berdasarkan metode servqual ahp daya bunuh ekstrak - air daun buah kulit batang tumbuhan mindi (melia azedarach lien) - larva aedes aegypti hubungan tingkat religiusitas kecemasan tidak melaksanakan ajaran agama islam remaja akhir beragama islam kontribusi tutupan lahan suhu atmosfer rata-rata berdasarkan citra landsat tm-5 metode korelasi antar band pengujian pembangkit listrik tenaga surya posisi plat photovoltaic dipasang miring 35 horizontal menghadap ke utara analisis faktor-faktor berhubungan kinerja petugas pelaksanaan kegiatan klinik sanitasi puskesmas analisis kemungkinan pengembangan potensi hutan pinus rakyat menjadi gondorukem berbasis kemitraan kabupaten pekalongan hubungan antara kejadian diare status gizi anak balita kelurahan bekonang kecamatan mojolaban kabupaten sukoharjo hubungan persepsi pasien tentang sikap tenaga kesehatan kepatuhan ibu periksa hamil puskesmas i grogol sukoharjo manajemen kepemimpinan sekolah sekolah dasar islam terpadu (sdit) nur hidayah kerten surakarta tahun pelajaran 2008/2009 peluang-peluang produksi bersih industri tekstil finishing bleaching (pabrik tekstil finishing bleaching pt damaitex) pencegahan pengangkatan timah hitam tanpa izin perairan pulau panaitan taman nasional ujung kulon oleh polres pandeglang pengaruh dimensi penanaman respons dinamis pondasi mesin tipe blok eksitasi vertikal lateral rocking pengaruh perubahan penggunaan lahan unsur iklim mikro wilayah jakarta timur selama tahun 1985 -- 1995 perancangan pembuatan perangkat lunak home banking menggunakan teknologi web service diaplikasikan multi bank tingkat kepuasan pasien rawat jalan kualitas pelayanan apotek instalasi farmasi rumah sakit umum daerah sragen uji toksisitas akut oil spill dispersan bahan bakar minyak solar pertamina benur udang windu post larva 20 -25 upaya penanggulangan penambangan emas liar melalui pendekatan community policing wilayah polsek nanggung kabupaten bogor analisa karakteristik lalu lintas kinerja simpang empat bersinyal ( simpang empat bersinyal dawung surakarta) analisis prospek budidaya tambak kabupaten brebes (an analysis on the prospect of fishpond aquaculture in brebes regency) analisis faktor-faktor mempengaruhi konsumen keputusan pembelian biro perjalanan umum surakarta beberapa faktor berhubungan kepuasan pasien ruang rawat inap rsud lubuk basung kabupaten agam sumatera barat pembentukan lapisan tipis oksida logam partikel sic meningkatkan kompaktibilitas ikatan komposit isotropik al-sic perbedaan tindakan kekerasan orang tua anak ditinjau dari tingkat stres orangtua kondisi ekonomi lemah pilihan kebijakan akuisisi persenjataan indonesia tahun 1998-2004 merespon dinamika lingkungan strategis asia tenggara uji aktivitas minyak atsiri kulit durian (durio zibethinus murr) sebagai obat nyamuk elektrik nyamuk aedes aegypti analisa performansi skema intra-site automatic tunnel addressing protocol (isatap) interkoneksi jaringan ipv6 over ipv4 analisis regulasi implementasi kebijakan taman nasional kutai ( desa teluk pandan desa sangkima kutim) analisis pengaruh support based relationships pemberdayaan karyawan ( 5 bank umum kodya semarang) hubungan antara pola asuh orangtua religiusitas mahasiswa muslim fakultas kedokteran universitas muhammadiyah surakarta hubungan respon imun stres tingkat kekambuhan demam tifoid masyarakat diwilayah puskesmas colomadu karanganyar implementasi manajemen peningkatan mutu berbasis sekolah sekolah menengah atas (sma) negeri 3 boyolali kabupaten boyolali kebutuhan perilaku pencarian informasi mahasiswa pdpt fib ui 2007 metode problem-based learning (pbl) metode transfer nilai-nilai keislaman cerita wayang kulit ditinjau dari pendidikan akhlak (studi tentang lakon dewaruci) pengaruh pengulangan siklus pengeringan pemb ahasan kuat tekan tanah mengembang distabilisasi fly-ash perencanaan ketel uap pipa api kapasitas uap hasil 21 ton/jam tekanan kerja 145 n/mm2 bahan bakar batubara tugas akhir sintesis membran bio-urai selulosa asetat absorben super karboksimetilselulosa dari selulosa ampas tebu limbah pabrik gula sistem pelaksanaan kepegawaian tata usaha balai besar pendidikan pelatihan kesejahteraan sosial (bbppks) bandung analisis pengaruh faktor-faktor motivasi produktivitas kerja karyawan pt radio karya pancaran swara media boyolali aspek kepribadian tokoh raihana novel pudarnya pesona cleopatra karya habiburrahman el shirazy tinjauanpsykologi sastra faktor-faktor menyebabkan guru sltp kabupaten serang mengajukan permohonan pindah tempat tugas upaya penanggulangannya hubungan antara persepsi siswa layanan bimbingan konseling minat berkonsultasi siswa sma negeri 1 wirosari memudarnya demokrasi desapengelolaan tanah adat konversi implikasi sosial politik desa adat julah buleleng bali pengaruh motivasi belajar intensitas belajar prestasi belajar ekonomi siswa kelas vii smp n 2 gatak 2008/2009 pengembangan kawasan nelayan berdasarkan preferensi masyarakat nelayan lokasi studi desa puger kulon kecamatan puger - jember peranan kawasan industri kulit terpadu pt cahaya timur indah subang rangka strategi pengembangan industri kulit nasional prevalensi hipertensi terkait stres kerja faktor-faktor lain berhubungan karyawan rumah sakit x jakarta analisis risiko lingkungan aliran air lumpur lapindo ke badan air ( sungai porong sungai aloo kabupaten sidoarjo) efektivitas peran lembaga masyarakat desa hutan (ldkh) wana makmur pencegahan pencurian kayu jati hutan darupono kendal hakikat fungsi permainan ritual magis nini thowok bagi masyarakat pendukungnya sebuah desa banyumudal-gombong optimasi perencanaan lokasi service point distribusi pupuk pt petrokimia gresik pendekatan algoritma out of kilter pembinaan kepala urusan tata usaha kantor depdikbud kecamatan ( lingkungan kantor depdikbud kabupaten majalengka) penyidikan kasus pertambangan batu bara tanpa izin kabupaten tanah laut kalimantan selatan oleh sat reskrim polres tanah laut perbedaan penyesuaian diri stres belajar antara siswa kelas akselerasi siswa kelas reguler smu negeri 3 surakarta analisis sistem pelaksanaan keselamatan kerja berdasarkan persepsi karyawan pt industri sandang nusantara unit patal banjaran evaluasi penggunaan alat pemadam api ringan (apar) gedung b lantai v rumah sakit x berpedoman kepada sm 03 - 3987 -1995 faktor-faktor mempengaruiii efektivitas perijinan sebagai pengendali kelestarian lingkungan ( kota surakarta) implementasi tugas babinkamtibmas polsek cimalaka mendukung upaya reklamasi lahan kritis akibat aktivitas penambangan pasir kinerja pemerintah provinsi dki jakarta studi akuntabilitas pemerintah provinsi dki jakarta kebijakan pengendalian banjir pelaksanaan pendokumentasian asuhan keperawatan berdasarkan faktor motivasi supervisi pimpinan rsud dr moewardi surakarta penerapan data envelopment analysis mengukur efisiensi dinas-dinas penghasil pendapatan asli daerah (pad) kabupaten jombang analisis risiko lingkungan aliran air lumpur lapindo ke badan air ( sungai porong sungai aloo - kabupaten sidoarjo) evaluasi kualitas produktivitas lahan kering terdegradasi daerah transmigrasi wpp vii rengat kabupaten indragiri hulu riau evaluasi penentuan waktu sinyal simpang bersinyal gendengan sampai simpang novotel ( jalan slamet riyadi surakarta) hubungan antara persepsi sistem pengendalian manajemen dukungan sosial tempat kerja persepsi goal setting perusahaan mengukur mengevaluasi efisiensi produktivitas pelaksanaan program pascasarjana its metode data envelopment analysis perbedaan ketentuan pengaturan bidang hukum lingkungan indonesia uu no 9 tahun 1985 uu no 5 tahun 1990 upaya peningkatan efektivitas manajemen pendidikan pelatihan ( balai pendidikan pelatihan keagamaan medan) analisa kesenjangan antara harapan persepsi pedagang pengunjung kondisi pasar tradisional youtefa kota jayapura analisis kepuasan pasien rawat inap implikasinya peningkatan kualitas pelayanan rumah sakit rumah sakit agung kadar glukosa bioetanol fermentasi gaplek ganyong (canna edulis kerr) dosis ragi waktu fermentasi berbeda kajian eksperimental perbandingan pengaruh sistem tambat taut catenary gerakan spar tipe klasik akibat beban gelombang ketidaktepatan penggunaan kata pungtuasi karangan siswa kelas vii smp negeri ii grogol sukoharjo tahun pelajaran 2005 membangun aplikasi sistem koperasi lingkungan badan pengembangan sistem informasi telematika (bapesitelda) daerah jawa barat pengaruh motivasi kerja pemberian kompensasi partisipasi kerja karyawan rumah sakit islam surakarta tahun 2007/2008 pengaruh pemberian upah jaminan sosial motivasi peningkatan produktivitas kerja karyawan po rosalia indah palur pengaruh penggunaan limbah soda sebagai bahan campuran aggregat halus sifat fisik mekanik beton lingkungan normal pengembangan model pembelajaran terpadu jaring laba-laba sekolah dasar penelitian tindakan sd kotamadya bandar lampung perancangan analisis sistem peralatan pengolahan panas pengemasan santapan citra nusantara@ kemasan mangkok plastik tenaga kerja wanita industri kerajinan bordir kecamatan kawalu kabupaten tasikmalayakajian sosial ekonomi tahun 1970-1985 uji aktivitas minyak atsiri daun batang serai (andropogon nardus l) sebagai obat nyamuk elektrik nyamuk aedes aegypti analisis hubungan antara kepemimpinan komitmen motivasi kerja kepuasan kerja karyawan spbu pucangsawit surakarta efektivitas peraturan penggunaan pestisida lapangan petani kubis kabupaten bandung garut propinsi jawa barat pembangunan aplikasi online academic bbs (bulletin board sistem) berbasis ajax mendukung perkuliahan teknik informatika its pengaruh lama pemberian bedong perkembangan motorik bayi usia 4 buan desa jemowo kecamatan musuk kabupaten boyolali pengaruh spiritual leadership produktivitas financial consultant pt allianz life indonesia cabang bouraq ambengan surabaya valuasi ekonomi hutan mangrove usaha tambak perikanan (studi penerapan tambak pola tumpangsari ekosistem hutan mangrove) evaluasi pelaksanaan penetapan zonasi pengelolaan wadukpengkajian keanekaragaman plankton waduk gajah mungkur wonogiri jawa tengah hubungan antara jarak kelahiran dekat tingkat pekembangan anak usia 1-3 tahun wilayah kerja puskesmas andong boyolali pengaruh sumber belajar kemandirian prestasi belajar ekonomi siswa kelas x sma negeri 1 nogosari tahun ajaran 2008/2009 studi manajemen pengoperas1 an pom pa banjir upaya memlnlmalisir luas tinggi lama genangan sub sistem kalisimo surabaya analisis pengujian pengendalian intern penjualan penerimaan kas pt mondrian garment manufacture klaten aplikation of markov chain and time series model to predict mean period and magnitude of earthquake (case study eartquake in sumatera) penerapan metode rekayasa nilai penentuan peralatan trawl kapal pemilihan peralatan trawl km merawal ii ambon perbaikan kampung komprehensif dampaknya kesejahteraan sosial serta kemandirian masyarakat miskin kumuh kota surabaya asuhan keperawatan tn s gangguan sistem pernafasan asma bronkhial ruang anggrek bougenville rsud pandan arang boyolali hubungan pola asuh keluarga perilaku merokok remaja pria desa kenteng kecamatan nogosari kabupaten boyolali tahun 2007 simulasihidrodinamika transfer massa disertai reaks ikimia absorpsico 2 absorben larutan benfield didalam packed column faktor-faktor penentuan lokasi tempat penampungan sampah sementara (tps) berdasarkan aspirasi masyarakat kecamatan sukolilo surabaya faktor-faktor berhubungan timbulnya gangguan fungsi paru kejadian bisinosis karyawan pabrik tekstil x semarang implementasi teknologi javascript library ext java server pages aplikasi web customer support sistem multiple touchpoint kejuruan studi tentang manajemen pembelajaran pengembangan kreativitas siswa sekolah ( smk diponegoro salatiga) kelayakan sistem transmisi penyaluran air baku dam tilong penyediaan air bersih kota kupang study kasus operasi pemeliharaan pengelolaan sampan kawasan hutan mangrove suwung teluk benoa sebagai upaya kebersihan lingkungan pengembangan ekowisata mangrove penyisihan senyawa fendlik air limbah teknik ozonasi ( air limbah pabrik tekstil pt texmaco jaya karawang-jawa barat) peranan tim sar satuan brimob polda jabar melakukan pencarian pertolongan korban bencana tsunami pangandaran sekitarnya priority development project determination for fulfilment long terms electricity needs in bali until 2025 using analytic network process studi perbandingan kualitas hasil pengelasan struktur mikro material aluminium 5083 menggunakan proses gmaw ampere las tinggi asuhan keperawatan keluarga tna gangguan sistem pernafasanasma bronkial ny s puskesmas tanjung juwiring klaten dasar pogram perencanaan perancangan arsitektur kakaban water world wisata dunia air danau kakaban pulau kakaban kalimantan timur hubungan antara pemakaian masker dampak kesehatan akibat paparan pb transportasi studi polisi lalu lintas kota surabaya pengaruh motivasi kerja kompetensi kerja prestasi kerja pegawai kantor pelayanan pengawasan bea&amp pengelolaan sampan kawasan hutan mangrove suwung teluk benoa sei3agai upaya kebersihan lingkungan pengembangan ekowisata mangrove studi eksperimental kebutuhan dry chemical agent memadamkan kebakaran crude oil berdasarkan atas temperatur pusdiklat migas cepu eksplorasi senyawa bioaktif antifoulant bakteri berasosiasi avertebrata laut sebagai alternatif penanganan biofouling laut faktor risiko berhubungan seroprevalensi toksoplasmosis wanita usia subur kecamatan banjarmasin barat kota banjarmasin kebijakan hukum pidana penanggulangan tindak pidana narkotika psikotropika (studi wilayah hukum pengadilan negeri surakarta) kesulitan-kesulitan siswa menyelesaikan soal-soal matematika konsep operasi hitung siswa kelas vii smp 1 wadaslintang wonosobo kontribusi konsep diri siswa smk negeri 12 bandung jurusan avionic elektro/instrumen rencana karirnya bidang teknik elektro pendaftaran tanah pertama kali hak guna usaha (hgu) lingkungan pt perkebunan nusantara ix (persero) wilayah kabupaten pekalongan penerapan metode 5s proses produksi guna efisiensi waktu loading unloading ( pt tomoko daya perkasa palur solo) penerapan metode damodaran perhitungan nilai finansial merek menggunakan pendekatan pugh ahp ( lembaga vokasional x ) perencanaan pemilihan strategi alternatif bahan baku energi biodiesel sebagai pengganti bahan bakar minyak pendekatan ahp - bcr analisa strategi pemasaran menggunakan metode ahp (analytical hierarchy process) ( pt nojorono tobacco international) hubungan faktor pelayanan puskesmas keputusan pasien memanfaatkan rawat inap ulang puskesmas patuk i kabupaten gunungkidul kajian sifat kelistrikan permukaan bawah permukaan tanah daerah tempat pembuangan akhir sampah sukolilo benowo kodya surabaya optimisasi sistem pengolahan limbah cair kokon pendekatan goal programming (pengusahaan sutera alam (psa) regaloh pati) pengaruh konflik ambiguitas peran kinerja karyawan departemen call center pt excelcomindo pratama jakarta studi perbandingan tower baja sutt (saluran udara tegangan tinggi) tipe bb+12m modifikasi sistem bresing zona gempa 4 5 6 upaya orang tua membina nilai-nilai tabot lingkungan keluarga studi deskriptif dua keluarga tabot kotamadya bengkulu pas kecil bidang keselamatan lingkungan balai pengelolaan pelabuhan laut angkutan sungai danau penyeberangan dinas perhubungan evaluasi pengaruh konstruksi material tingkat isolasi suhu lingkungan sistem pemanas ruangan menggunakan simulasi kontinyu hubungan kadar debu total udara ambien kejadiaan ispa ringan balita kecamatan purbalingga kabupaten purbalingga tahun 2004 hubungan kadar total suspended particulate (tsp) fungsi paru lingkungan industri semen (studi semen cebinong pabrik cilacap) illegal logging modus penyelesaiannya oleh satuan reskrim polres lampung tengah ( tindak pidana illegal logging mujito cs) kadar glukosa bioetanol fermentasi gaplek ketela pohon (manihot utilissima pohl ) dosis ragi lama fermentasi berbeda strategi pemasaran produk simpanan dana masyarakat pt bank dagang negara (persero) mengantisipasi persaingan pasar industri perbankan studi deskriptif tentang perceraian akibat hukumnya bagi pegawai negeri sipil beragama islam dinas pendidikan kota pekalongan upaya perbaikan kualitas produk kain grey penerapan metode seven tools new seven tools ( pt lokatex pekalongan ) analisis dimensi groin sebagai alternatif pengendalian sedimentasi sisi timur pangkalan pendaratan ikan (ppi) paiton kabupaten probolinggo analisis pengaruh faktor-faktor kemampuan kerja motivasi kerja kinerja karyawan ( bank danamon semarang pemuda) hubungan kadar debu total udara ambien kejadiaan ispa ringan balita kecamatan purbalingga kabupaten purbalingga tahun 2004 pengembangan struktur organisasi pelayanan kebersihan kota jakarta menyongsong tahun 2005 ( dinas kebersihan dki jakarta ) penyesunan inspection checklist k3 area maching shop line crank case metode jsa hiraec ( pt kubota indonesia) bimbingan konseling pembinaan akhlaq siswa kelas vii madrasah tsanawiyah negeri (mtsn) bekonang sukoharjo tahun ajaran 2009/2010 keanekaragaman hymenoptera parasitoid beberapa tipe lanskap pertanian daerah aliran sungai (das) cianjur kabupaten cianjur jawa barat pengaruh indeks harga saham sektor infrastruktur indeks harga saham gabungan bursa efek jakarta periode januari sd desember 2003 peranan kemampuan membaca al-quran prestasi bahasa arab santri i'daad lughawy pesantren al-irsyad tengaran tahun pelajaran 2007/2008 studi tentang tingkat kepuasan pejabat struktural administras1 pelaksanaan program mutasi lingkungan universitas diponegoro semarang analisis pengendalian kualitas produk cacat kemasan air mineral 600 ml menggunakan the tradition seven tools methode pt ma'soem hubungan pengetahuan perilaku pemberantasan sarang nyamuk upaya pencegahan penyakit demam berdarah desa kliwonan masaran sragen pengaruh kecerdasan emosional tingkat pemahaman akuntansi ( mahasiswa akuntansi universitas muhammadiyah surakarta) perbaikan sistem kerja pendekatan ergonomi human reliability assessment ( pt indutri sandang nusantara unit patal lawang) studi pengembangan obyek wisata alam kabupaten lumajang penataan obyek wisata ranu klakah ranu pakis kabupaten lumajang ekowisata sebagai alternatif pengembangan pariwisata berkelanjutan desa wongaya gede kecamatan penebel kabupaten tabanan - bali implementasi penyidikan mengungkap jaringan perdagangan ilegal penyu hijau (chelonia mydas) oleh direktorat kepolisian perairan polda bali pengaruh malnutrisi saluran cerna tikus putihperhatian khusus perkembangan morfologis biokimiawi fisiologis terutama kolon peran serta masyarakat pengelolaan dana kontigensi pembangunan jalan lingkungan (kelurahan gedawang banyumanik semarang) analisis postur kerja menggunakan metode reba (rapid entire body assessment) ( pt makmur alam sentosa i stasiun rotari) efektivitas upaya penanggulangan tindak pidana penambangan pasir secara liar wilayah hukum kepolisian negara republik indonesia sektor cipatat faktor - faktor mempengaruhi perilaku kepatuhan tax professional pelaporan pajak badan perusahaan industri manufaktur surabaya hubungan antara penyediaan air bersih sarana pembuangan tinja kejadian kecacingan siswa sdn meteseh kecamatan tembalang semarang peluang-peluang produksi bersih industri tekstil finishing bleaching ( pabrik tekstil finishing bleaching pt damaitex semarang) pengaruh kualitas pelayanan tingkat kepuasan konsumen structural equation modelling ( rsud dr moewardi surakarta) pengaruh penambahan aditif struktur foam mikroseluler plastik diproses berbagai tekanan penjenuhan metode quick heating perlindungan hukum hak waris anak angkat warganegara indonesia keturunan tionghoa sehubungan surat waris dibuat oleh notaris studi tentang permohonan penetapana anak sipil sebagai alternatif penanganan kenakalan anak secara pidana pengadilan negeri sragen faktor-faktor mempengaruhi kepatuhan perawat penerapan protap perawatan luka post operasi ruang cendana rsud dr moewardi surakarta kajian kandungan logam merkuri (hg) kerang hijau (perna viridis) perairan pantai semarang ditetapkan secara spektrofotometri serapan atom pengembangan model kurikulum terpadu implementasinya sekolah dasar menggunakan bidang studi bahasa indonesia sebagai unsur pemandu penyisihan cod bod tss limbah industri pencelupan benang metode bioreaktor kayu apu (pistia stratiotes) koagulasi-flokulasi perbaikan layanan pengunjung obyek wisata taman satwa taru jurug (tstj) surakarta menggunakan metode qfd (quality function deployment) perlindungan hukum hak warts anak angkat warganegara indonesia keturunan tionghoa sehubungan surat warts dibuat oleh notaris aplikasi komunikasi data lingkungan jaringan komputer berbasis algoritma kompresi mbwca (modification burrows wheeler compression algorithm ) hubungan antara dukungan keluarga prestasi belajar anak retardasi mental ringan sekolah luar biasa c yayasan sosial setya darma surakarta pengaruh faktor lingkungan distribusi komoditas perdagangan kawasan pedalaman pesisir jambi abad xi-xiiisebuah tinjauan arkeologi pengaruh waktu tahan proses hot dipping baja karbon rendah ketebalan lapisan kekuatan tarik harga impak bahan pelapis aluminum pengukuran layak huni pengadaan perumahan sederhana sidoarjo perumahan tanggulangin anggun sejahtera pt bersatu sukses group pola epidemiologi toksoplasmosis surabaya (studi seroepidemiologi toksoplasmosis pekerja rumah pemotongan hewan penjual daging kambing) dampak migrasi sirkuler peningkatan status sosial ekonomi keluarga ditinggalkan ketiga desa sampel kabupaten wonogiri kerusakan daun tanaman sebagai bioindikator pencemaran udara ( tanaman peneduh jalan angsana mahoni pencemar udara no so2) pengaruh gaya kepemimpinan kinerja karyawan motivasi sebagai variabel pemoderasi dinas pekerjaan umum bina marga kabupaten sragen pengaruh tingkat pendidikan pendapatan pengalaman kerja peningkatan produktivitas tenaga kerja perusahaan kecap udang purwodadi pengembangan pertanian organik (kasus penerapan pupuk organik padi sawah kecamatan arga makmur perancangan pembuatan perangkat pengukuran propagasi gelombang radio gedung frekuensi 18 ghz komunikasi nirkabel pita lebar hubungan antara dukungan keluarga interaksi sosial penderita epilepsi kecamatan manyaran kecamatan jatipurno kabupaten wonogiri implementasi model resources based learning meningkatkan hasil belajar biologi kelas viic smp negeri 2 sawit boyolali tahun ajaran 2008 2009 kajian konsep clean production pengelolaan sampah kota sidoarjo peran serta masyarakat ( permukiman wilayah kota sidoarjo) pemanfaatan masjid sebagai media pendidikan islam tinjauan pendidikan islam non formal ( masjid al kautsar mendungan pabelan kartasura) pengaruh tingkat pendidikan masa kerja prestasi kerja karyawan pt kereta api (persero) daop vi yogyakarta stasiun solo balapan studi eksperimental pengaruh posisi jarak antar pembuluh koefisien perpindahan panas konveksi alamiah serpentine tube enclosure studi perilaku publik pengguna jalan berpengaruh kelancaran arus lalu lintas sepanjang ruas jalan setiabudi - mt haryono kota semarang analisis ergonomi rancangan fasilitas kerja stasiun kerja dibagian skiving antropometri orang indonesia pt senantiasa mandiri faktor faktor determinan berpengaruh kejadian pneumonia bayi (0 12 bulan ) desa pendem kecamatan janapria kabupaten lombok tengah hubungan antara tingkat pendidikan pengetahuan ibu dari anak taman kanak-kanak pemilihan multivitamin kecamatan laweyan kota surakarta pengaruh kecerdasan emosional tingkat pemahaman akuntansi sistem pendidikan tinggi akuntansi (survey perguruan tinggi surakarta) pengaruh tingkat pendidikan pengalaman persepsi manajer koperasi tentang informasi akuntansi penerapan psak no27 kabupaten grobogan dentifikasi kebocoran air sistem perpipaan pdam surabaya menggunakan parameter laju penurunan chlorine laju pertumbuhan bakteri coli faktor-faktor berhubungan motivasi keluarga melakukan program perilaku hidup bersih sehat desa mangunharjo jatipurno wonogiri hubungan antara persepsi pasien tentang perilaku caring perawat kecemasan pasien kemoterapi kanker payudara rsud dr moewardi surakarta kebutuhan perumahan sampai tahun 2000 serta pola penyebaran perumahan jabotabek pengeluaran perumahankonsumen btn botabek penerapan konsep learning organization oleh camat upaya meningkatkan kinerja pelayanan aparatur kecamatan cimahi tengah kota cimahi tahun 2005 pengaruh lamanya tahun pembukaan hutan beberapa sifat tanah podzolik merah kuning sumatera selatan kaitannya proses degradasi tanah pengaruh timah hitam (pb) kesehatan reproduksi wanita (studi kohort historis prospektif kelahiran bayi berat badan lahir rendah (bblr)) perbedaan tingkat kecemasan mahasiswa semester ganjil berprestasi kurang berprestasi fakultas kedokteran universitas muhammadiyah surakarta perlindungan korban kekerasan rumah tangga (kdrt) khususnya perempuan anak oleh unit ruang pelayanan khusus (rpk) polres metro depok pusat pelestarian pengembangan tanaman hias karanganyar (sarana pengembangan hobi bagi kalangan eksekutif) (konsep perencanaan perancangan) pendekatan agroekosistem upaya optimasi pemanfaatan lahan kering sub das jeneberang hulu kabupaten gowa propinsi sulawesi selatan pendekatan partisipatif rangka relokasi permukiman dibantaran sungai karang mumus kota samarinda permukiman jembatan v - jembatan vii pengaruh fasilitas kerja disiplin kerja pengawasan produktivitas kerja karyawan perusahaan pt paloma citra internasional sukoharjo usahawan kawasan pesisir menghadapi era perdagangan bebasstudi strategi peningkatan ekspor pengusaha mebel kerajinan jepara menghadapi afta 2003 faktor-faktor mempengaruhi kinerja dinas kebersihan dki jakarta peran serta masyarakat pengelolaan sampahpendekatan ekologi administrasi pengaruh kemampuan pemecahan masalah perhatian siswa prestasi belajar ekonomi siswa kelas viii smp negeri 7 purwodadi tahun ajaran 2009/2010 pengaruh kepemimpinan motivasi kerja disiplin kerja prestasi kerja pegawai bagian tata usaha dinas pendidikan kabupaten purworejo tahun 2005 studi karakter perancangan kota kawasan stasiun kereta api sebagai bagian dari konfigurasi kota lama (kasusstasiun tawang stasiun jakarta kota) analisa penentuan prioritas pekerjaan pemeliharaan jaringan irigasi berdasarkan fungsi sistem manfaat biaya( daerah irigasi kota bandung ) bajo bukan bajo studi tentang perubahan makna sama bagai masyarakat bajo desa sulaho kecamatan lasusua kabupaten kolaka sulawesi tenggara faktor faktor lingkungan fisik rumah berhubungan kejadian pneumonia anak balita wilayah kerja puskesmas kawunganten kabupaten cilacap faktor berhubungan kinerja petugas kesehatan diagnosis pneumonia balita sistem surveilans pneumonia kabupaten bangli tahun 2006 pencegahan kejahatan melalui desain lingkungansuatu analisis teoritis tentang penerapan konsep pencegahan kejahatan kompleks perumahan pesona depok i perancangan kegiatan preventive maintenance penentuan reliabilitas sistem seri pendekatan analisis markov ( pt semen gresik tbk) pengaruh budidaya ikan kualitas air waduk budidaya ikan keranba jaring apung ciganea waduk jatiluhur purwakarta jawa barat pengaruh faktor persepsi mahasiswa pengelolaan ruang rawat inap kepuasan mahasiswa praktek klinik keperawatan rsud ulin banjarmasin analisis faktor penyebab kepatuhan akuntan manajemen jawa timur menerapkan standar akuntansi pajak penghasilan (psak no 46 ) penelitian empiris asuhan keperawatan keluarga tn m masalah utama asma bronkhial ny h sogaten rt 3 rw 15 pajang laweyan wilayah puskesmas pajang surakarta hubungan kecerdasan emosi (emotional quotient) tingkat kecemasan mahasiswa angkatan 2006 fakultas kedokteran universitas muhammadiyah surakarta kajian dampak mangan limdah tapioka sungai suatu pengaruhnya kualitas air tambak desa bulumanis kidul kabupaten dati ii pati jawa tengah penatalaksanaan fisioterapi kondisi osteoarthritis knee dekstra modalitas micro wave diathermy terapi latihan rsud dr moewardi surakarta penentuan kadar pb (timbal) didalam rambut pekerja spbu kabupaten wonogiri berdasarkan lokasi spbu masa kerjanya secara spektrofotometri serapan atom pengaruh bahan starter efektivitas pengolahan limbah domestik limbah tangki septik asrama mahasiswa universitas indonesia depok pengaruh motivasi belajar prestasi belajar mata pelajaran ekonomi siswa kelas ix smp negeri 3 colomadu kabupaten karanganyar tahun ajaran 2008/2009 pengaruh pola kepemimpinan motivasi kepuasan kerja kinerja karyawan (studi staf keuangan pemerintah daerah se eks-karesidenan surakarta ) studi kepuasan pelanggan produk real estate sebagai fokus implementasi manajemen kualitas proyek pembangunan real estate pt araya bumi megah - malang analisis pola distribusi pengulangan sekuens nukleotida ttc mycobacterium leprae dari penderita kusta sumber air penduduk pulau poteran sumenep madura peranan sekolah dasar negeri rangka meningkatkan mutu pendidikan menghadapi era globalisasi (studi evaluatif mutu kepala sdn kecamatan cerenti) analisis profil kebutuhan fungsional pemeriksa pajak pengaruhnya motivasi kerja karikpa semarang satu karikpa semarang dua indentifikasi prefernsi wisatawan nusantara objek wisata agro perkebunan teh ( perkebunan teh malabar rancabali kabupaten bandung) penegakan hukum penambangan pasir ilegal wilayah kabupaten garut (studi penambangan pasir ilegal desa pananjung kecamatan tarogong kaler) pengaruh stratfikiasi sosial penggunaan bahasa upacara adat perkawinan masyarakat etnis karo ( etnik karo kota medan deli serdang) manajemen perubahan mahkamah konstitusi republik indonesiaserbuah sekretariat jendral kepaniteraan mahkamah konstitusi republik indonesia pengaruh emisi gas buang kendaraan bermotor struktur epidermis stomata daun tanaman pelindung jladi sucipto sampai terminal tirtonadi surakarta pengaruh partisipasi penyusunan anggaran kinerja manajerial pelimpahan wewenang sebagai variabel moderating (survey pt java messa sarana) peranan politeknik meningkatkan kualitas sumber daya manusia ditinjau dari perspektif ketahanan nasional ( politeknik universitas indonesia) persepsi kepala staf medik fungsional perubahan unit pelaksana fungsional menjadi staf medik fungsional rumah sakit umum pusat hasan sadikin bandung struktur tumbuhan spermatophyta diukur keanekaragaman (diversitas) kerapatan (densitas) tepi utara bagian atas waduk bade klego kabupaten boyolali gotongroyong pembangunan masyarakat desa rangka pembinaan ketahanan nasional tentang abri masuk desa kabupaten klaten propinsi jawa-tengah pengaruh emisi gas buang kendaraan bermotor struktur epidermis stomata daun tanaman pelindung jl adi sucipto sampai terminal tirtonadi surakarta pengembangan sistem inforiviasi sanitasi rumah mendukung upaya pencegahan penyakit diare tingkat puskesmas (stud! puskesmas batangan kabupaten pati) penggunaan brangkal beton sebagai pengganti agregat kasar mensubtitusikan semen abu dasar campuran beton (komunitas bidang ilmu rekayasa struktur) sintesis senyawa analog kurkumin 35-bis-(4 -hidroksi -metoksi benzilidin) hidroksi-3 benzilidin)-piperidin 4-on (monohidrat hidroklorida) on katalis hcl dasar pemrograman perencanaan perancangan arsitektur (d p 3 a ) penataan permukiman pemulung sekitar tpas mojosongo penekanan desain low cost housing pengembangan sistem informasi rumat' makan restoran sebagai pendukung kegiatan evaluasi grading rumah makan restoran dienias kesehatan kabupaten kudus analisis pengaruh tingkat pendidikan formal masa kerja pemberian gaji komitmen organisasional karyawan kantor wilayah perum pegadaian surakarta dampak proyek perbaikan perumahan pemukiman perdesaan perilaku masyarakat membangun rumah kecamatan batu putih kabupaten timor tengah selatan pemanfaatan kebun sekolah pembelajaran biologi hasil belajar siswa kelas vii semester ii smp n 1 tunjungan kabupaten blora tahun pelajaran 2007/2008 sikap sosial anak mengikuti pendidikan apresiasi seni (studi kualitatif siswa-siswi sd al-irsyad surakarta mengikuti pendidikan apresiasi seni) pengaruh gender locus of control kepuasan kerja komitmen organisasional keinginan berpindah kerja auditor (studi auditor kap pulau jawa) studi perbedaan nilai kapasitas fungsi paru pekerja penelitian tahun 1999 2006 industri pengasapan ikan kelurahan bandarharjo kecamatan semarang utara analisis tingkat komprehensivitas proses pengambilan keputusan strategik perusahaan berbentuk koperasi (studi koperasi kabupaten semarang) dampak peralihan tanah pertanian menjadi tanah industri kualitas hidup bekas pemilik tanahkasus kawasan industri pulo gadung kecamatan tambun-bekasi pengaruh kepemimpinan kepala sekolah fasilitas sekolah semangat kerja guru sekolah lanjutan tingkat pertama se kecamatan pringapus kabupaten semarang pengaruh tanggung jawab sosial tata kelola perusahaan reputasi rangka peningkatan kinerja jamsostek (studi peserta jamsostek kota semarang) uji karakteristik tentang pengaruh diameter nozzle diameter lubang kedalaman penetrasi material removal rate batu bata proses water jet machining analisis penerapan program keselamatan kerja usaha meningkatkan produktivitas kerja pendekatan fault tree analysis (cv permata 7 wonogiri) identifikasi pencemaran limbah cair industri berhubungan kualitas lingkungan sungai tenggang kelurahan tambakrejo kecamatan gayamsari semarang model sistem informasi manajemen berbasis komputer internet studi pengelolaan sistem informasi manajemen bidang dikmenjur kanwil depdiknas propinsi sumatera barat pengelolaan infectious myonecrosis virus (imnv) perairan pesisir teluk lampung sekitar unit pembenihan udang intensif pt centralpertiwi bahari l