Showing posts with label Layanan. Show all posts
Showing posts with label Layanan. Show all posts

Wednesday, February 10, 2016

Analisis Data

analisis pengaruh kebijakan hutang, kebijakan deviden, kepemilikan instutisional, resiko bisnis, ukuran perusahaan dan volatilitas pendapatan terhadap kepemilikan manajerial pada perusahaan go publi analisis data pengaruh kepemimpinan situasional terhadap kinerja karyawan melalui disiplin kerja sebagai variabel intervening studi kasus pada pt. madubaru yogyakarta analisis pengaruh faktor harga, produk, layanan, lokasi dan kenyamanan terhadap perilaku konsumen berbelanja di butik sakola analisis data kualitatif pengaruh experiential marketing terhadap kepuasan pelanggan (studi pada pelanggan legend coffee yogyakarta) identifikasi daya tarik dan kredibilitas sm*sh sebagai celebrity endorser kartu as (studi pada mahasiswa universitas muhammadiyah yogyakarta) analisis data adalah pengaruh kepemilikan manajerial, kepemilikan institusional dan kinerja keuangan terhadap struktur modal (studi pada perusahaan manufaktur yang terdaftar di bei periode 2010-2014) pengaruh stres terhadap prestasi kerja karyawan yang dimoderasi oleh variabel kepribadian pada karyawan pt. bri (persero),tbk cabang sleman analisis data kuantitatif pengaruh kepuasan kerja, komitmen organisasional, stres kerja dan kompensasi finansial terhadap turnover intention pada pt kusuma sandang mekarjaya yogyakarta analisis anteseden kinerja tenaga penjual dan kinerja pemasaran asuransi jiwa bersama bumi putera 1912 cabang kabupaten sleman daerah istimewa yogyakarta analisis data penelitian kualitatif pengaruh growth opportunity, profitabilitas, fixed asset ratio, risiko pasar, ukuran perusahaan dan pertumbuhan asset terhadap struktur modal studi pada perusahaan properti dan real estateyang terda pengaruh citra rumah sakit terhadap perilaku konsumen dalam menggunakan jasa rumah sakit pku muhammadiyah yogyakarta analisis data deskriptif pengaruh motivasi, persepsi, sikap konsumen terhadap keputusan pembelian sepeda motor kawasaki tipe sport di kabupaten purbalingga analisis perilaku mahasiswa umy dalam penggunaan website umy sebagai upaya untuk meningkatkan peringkat webometrik analisis data ptk pengaruh good corporate governance terhadap nilai perusahaan dengan kinerja keuangan sebagai variabel intervening (studi kasus pada perusahaan non keuangan periode 2010-2013) faktor-faktor yang mempengaruhi kedisiplinan dalam proses belajar mengajar "the factors that influencing the discipline in teaching and studying process" analisis data penelitian kuantitatif pengaruh kepuasan kerja, self efficacy dan self esteem terhadap kinerja karyawan cv. batik indah rara djonggrang pengaruh manfaat dan kemudahan terhadap perilaku nasabah bank dalam menggunakan internet banking dengan minat berperilaku sebagai variabel mediasi. analisis data statistik pengaruh gaya hidup, persepsi harga dan kelompok referensi terhadap keputusan pembelian smartphone samsung (studi pada mahasiswa universitas muhammadiyah yogyakarta pengaruh dividend payout ratio, assets growth, leverage, liquidity dan size terhadap resiko sistematik saham analisis data kualitatif dan kuantitatif pengaruh konflik pekerjaan-keluarga dan konflik keluarga-pekerjaan terhadap keinginan berpindah yang dimediasi oleh kepuasan kerja ( studi pada karyawan cv. cipta agrifarmerindo ) analisis pengaruh konsentrasi kepemilikan, leverage, kesempatan investasi dan ukuran dewan komisaris terhadap kualitas implementasi corporate governance analisis data kualitatif pengaruh ekuitas merek terhadap keputusan pembelian handphone sistem operasi android (studi pada mahasiswa universitas muhammadiyah yogyakarta) analisis pengaruh faktor-faktor bauran pemasaran terhadap kepuasan konsumen pengguna produk sepatu merek adidas di yogyakarta analisis data adalah usaha peningkatan kualitas pelayanan perpustakaan menggunakan metode servqual dan quality function deployment (qfd) pengaruh kualitas pelayanan terhadap loyalitas pasien dengan kepuasan pasien sebagai variabel intervening pada rumah sakit jogja analisis data kuantitatif perbaikan kualitas layanan jasa dengan model service quality (servqual) dimensi kepariwisataan dan metode quality function deployment (studi kasus di kids fun parcs yogyakarta) analisis faktor ekuitas merek program studi manajemen fakultas ekonomi universitas muhammadiyah yogyakarta analisis data penelitian pengaruh rasio likuiditas, rasio profitabilitas, rasio solvabilitas, dan rasio aktivitas terhadap kebijakan dividen pengaruh proceeds, earning per share, current ratio, umur perusahaan, ukuran perusahaan, rata-rata kurs, tingkat leverage dan return on equity terhadap tingkat underpriced yang terjadi di bursa analisis data penelitian kualitatif pengaruh kinerja keuangan terhadap nilai perusahaan dengan corporate social responsibility dan kepemilikan manajerial sebagai variabel pemoderasi (studi empiris pada perusahaan manufaktur di bursa e analisis pengaruh kualitas produk, harga, dan iklan terhadap keputusan pembelian motor honda analisis data deskriptif pengaruh free cash flow dan struktur kepemilikan saham terhadap kebijakan utang dengan investment opportunity set sebagai variabel moderating studi pada perusahaan manufaktur yang terdaftar di bei p analisis pengaruh persepsi kualitas pelayanan terhadap loyalitas konsumen (studi pada aqua splas kids fun parcs) analisis data ptk analisa pengaruh leader-member exchange terhadap turnover intention dengan kepuasan kerja sebagai variabel mediator (studi pada karyawan rskia bhakti ibu di yogyakarta) pengaruh kualitas pelayanan terhadap kepuasan nasabah kcp. bank btpn karanganyar analisis data penelitian kuantitatif pengaruh premi mitra mabrur dan inflasi terhadap profitabilitas perusahaan (studi pada perusahaan ajb bumiputera 1912 syariah kc tasikmalaya 2007-2014) analisis kinerja keuangan sebelum dan sesudah right issue pada perusahaan yang go publik di bursa efek indonesia analisis data statistik pengaruh stressor kerja terhadap prestasi kerja karyawan ( studi pada perusahaan pt. aseli dagadu djokdja) pengaruh profitabilitas, ukuran perusahaan, pertumbuhan aktiva, kepemilikan pemerintah dan kepemilikan asing terhadap struktur modal (studi empiris pada emiten syariah di bursa efek indonesia tahu analisis data kualitatif dan kuantitatif analisis faktor-faktor yang mempengaruhi struktur modal pada perusahaan manufaktur yang terdaftar di bursa efek indonesia (bei) (studi kasus pada perusahaan food and beverage 2009-2013) analisis asosiasi merek minuman isotonik merek pocari sweat, powerade isotonik dan vitazone di universitas muhammadiyah yogyakarta analisis data adalah pengaruh kedisplinan kerja, komunikasi interpersonal dan lingkungan kerja fisik terhadap kinerja karyawan di pt kusuma sandang mekarjaya (ksm) pengaruh arus kas dan laba akuntansi terhadap harga saham lq45 yang terdaftar di bursa efek indonesia analisis data anova analisis perilaku ramah lingkungan yang dipengaruhi oleh nilai, sikap dan gaya hidup konsumen serta pengetahuan sebagai variabel pemediasi (studi pada konsumen the body shop yogyakarta) pengaruh kreativitas iklan produk sabun lifebuoy terhadap loyalitas konsumen analisis data awal pengaruh profitabilitas dan growth opportunity terhadap nilai perusahaan dengan struktur modal sebagai variabel intervening pada perusahaan property dan real estete yang terdaftar di bursa efek indo pengaruh kepercayaan merek terhadap loyalitas merek (studi pada sepeda motor merek monda di umy). analisis data apbn 2013 pengaruh iklim organisasi terhadap komitmen organisasi dengan kepuasan kerja sebagai variabel mediasi pengaruh marketing mix layanan prabayar simpati terhadap loyalitas konsumen (studi pada mahasiswa umy). analisis data anova dengan spss pengaruh leader member-exchange dan pemberdayaan karyawan terhadap kinerja karyawan melalui komitmen organisasional sebagai variable mediasi (studi pada mulia toserba bantul) pengaruh faktor fundamental terhadap return saham pada perusahaan perbankan di bursa efek jakarta (bej). analisis data adalah menurut peran kemampuan adversitas (adversity quotient) dalam mempengaruhi konflik pekerjaan-keluarga (work-family conflict) dan kinerja dosen perempuan di universitas muhammadiyah yogyakarta identifikasi daya tarik dan predibilitas sm*sh sebagai celebrity endorser kartu as (studi pada mahasiswa umy). analisis data angket analisis perbandingan kinerja keuangan bank konvensional dengan bank syariah yang terdaftar di bank indonesia hubungan atribut iklan bersambung axis joni blak-blakkan dengan respon pemirsa televisi (studi pada mahasiswa di diy). analisis data asosiatif pengaruh pertumbuhan perusahan, ukuran perusahaan, dan profitabilitas terhadap nilai perusahaan dengan struktur modal sebagai variabel intervening (studi pada perusahaan manufaktur yang terdaftar di faktor-faktor yang mempengaruhi kedisiplinan dalam proses belajar mengajar. analisis data anova adalah pengaruh pertumbuhan perusahan, ukuran perusahaan, dan profitabilitas terhadap nilai perusahaan dengan struktur modal sebagai variabel intervening (studi pada perusahaan manufaktur yang terdaftar di bursa efek indonesia) analisis metode camels dalam penilaian kesehatan bank syariah dan bank konversional di indonesia yanh go public. analisis data asam basa faktor-faktor yang mempengaruhi kebijakan hutang (studi empiris pada perusahaan manufaktur yang terdaftar di bursa efek indonesia tahun 2010-2014) analisis tingkat kesehatanbank dengan mengunakan metode camels pada bank pemerintahan dan bank umum swasta nasinal. analisis data bivariat pengaruh kualitas layanan, risiko persepsian, dan harapan konsumen terhadap kepuasan konsumen yang dimediasi oleh nilai persepsian (studi pada pasien asri medical center yogyakarta) analisis hubungan antara kebijakan utang, kebijakan dividen dan profitabilitas dengan investment oprotunity set (ios) pada perusahaan manufaktur di bei. analisis data berkala pengaruh daya tarik celebrity endorser dan brand image terhadap keputusan pembelian shampoo pantene (studi pada mahasiswa s1 universitas muhammadiyah yogyakarta) analisis kualitas pelayanan apotek rawat jalan dan rawat inap di rsud kab. banyumas. analisis data bab 3 pengaruh kepemilikan managerial, kepemilikan institusional, kebijakan hutang, profitabilitas dan ukuran perusahaan terhadap kebijakan dividen pada perusahaan manufaktur yang terdaftar di bursa efek analisis faktor ekuitas merek program studi manajemen fakultas ekonomi umy. analisis data berkala ppt pengaruh kepemilikan manajerial, kepemilikan institusional, profitabilitas, dan ukuran perusahaan terhadap kebijakan dividen (studi empiris pada industri non keuangan yang terdaftar di bursa efek in analisis faktor-faktor yang menimbulkan kecenderungan minat beli konsumen sepeda (studi perilsku konsumen pada smp muhammadiyah di yogyakarta). analisis data bab 4 pengaruh kualitas produk, merek, harga dan desain terhadap keputusan pembelian produk dagadu ( studi pada konsumen produk dagadu di kotamadya yogyakarta) analisi pengaruh self-efficacy terhadap kinerja individu yang dimediasi oleh penetapan tujuan (goal setting). analisis data biostatistik pengaruh konflik intrapersonal dan konflik interpersonal terhadap semangat kerja pegawai dinas perindustrian perdagangan koperasi dan usaha kecil menengah propinsi yogyakarta analisis pengaruh atribut produk, atribut layanan dan atribut pembelian terhadap kepuasan konsumen waroeng steak and shake di kota yogyakarta. analisis data bblr pengaruh kualitas produk, merek, harga dan desain terhadap keputusan pembelian produk dagadu (studi pada konsumen produk dagadu di kotamadya yogyakarta) analisis kebijakan dividen suatu pengujian dividen signaling theory dan rent extraction hypothesis. analisis data berkala dengan metode semi average pengaruh kepemilikan manajerial, kepemilikan institusional, arus kas bebas dan ukuran perusahaan terhadap kebijakan hutang analisis asosiasi merek minuman isotonik merek pocari sweat, powerde isotonik dan vtazone di umy. analisis data berkala dengan metode moving average pengaruh kualitas produk terhadap loyalitas konsumen dengan kepuasan konsumen dan citra merek sebagai mediasi pada produk sepeda motor matic honda di daerah istimewa yogyakarta pengaruh keadilan kompensasi terhadap komitmen afektif pada karyawan kontrak universitas muhammadiyah yogyakarta analisis data banjir pengaruh tanggung jawab sosial terhadap loyalitas konsumen pada pengguna jasa penerbangan garuda indonesia di yogyakarta analisis faktor-faktor yang mempengaruhi underpricing pada perusahaan go public di bei pada priode tahun 2005-2009 analisis data curah hujan pengaruh word of mouth dan kelompok referensi terhadap keputusan pembelian item guide hero (studi pada user game dota 2) analisis rasio keuangan untuk memprediksi kondisi financial distress perusahaan manufaktur yang terdaftar di bursa efek indonesia (bei) analisis data chi square pengaruh bauran pemasaran terhadap keputusan pembelian konsumen di kosudgama yogyakarta pengaruh atribut produk, atribut layanan, dan atribut pembelian terhadap kepuasan konsumen produk kosmetik wardah di kota yogyakarta analisis data cross sectional pengaruh inflasi, indeks dow jones, jumlah uang beredar (m2), kurs rupiah terhadap indeks harga saham gabungan analisis kinerja keuangan dengan menggunakan metode camel modified pada perusahaan go publik ( perusahaan perbankan yang terdaftar di bei periode 2007-2009) analisis data cross section analisis kompensasi dan komitmen organisasional terhadap kinerja karyawan kantor pos besar yogyakarta analisis perkembangan kinerja keuangan koperasi jasa keuangan syariah di daerah istimewayogyakarta : studi pada kjks bmt bina ihsanul fikri yogyakarta analisis data contoh analisis pengaruh motivasi konsumen, persepsi kualitas, dan sikap konsumen terhadap keputusan pembelian produk ramah lingkungan pengaruh faktor fundamental terhadap return saham syariah (study perusahaan yang terdaftar di jakarta islamic index) analisis data creswell pengaruh kepribadian dosen terhadap kepuasan kerja dosen universitas muhammadiyah yogyakarta (studi pada dosen universitas muhammadiyah yogyakarta di yogyakarta) analisis camel modified (capital, asset quality, earnings, liquidity) sebagai prediksi kondisi bermasalah pada bank umum swasta nasional di indonesia analisis data case control pengaruh gaya kepemimpinan transformasional terhadap kinerja dengan komitmen organisi sebagai variabel intervening faktor - faktor yang mempengaruhi luas pengungkapan laporan tahunan dan implikasinya terhadap asimetri informasi (studi pada perusahaan-perusahaan sektor manufaktur yang go public di bursa efek ind analisis data cuaca analisis pengaruh stock selection skill dan market timing terhadap kinerja reksa dana saham (studi pada reksa dana saham di indonesia 2012-2014) faktor-faktor yang mempengaruhi mahasiswa dalam pembelian ponsel blackberry di univesrsitas muhammadiyah yogyakarta analisis data center analisis kualitas produk dan citra merek dalam mempengaruhi keputusan pembelian dan dampaknya terhadap loyalitas merek pengguna produk handhpone android samsung di daerah istimewa yogyakarta analisis sikap kaum muda dan norma subyektif terhadap minat beli produk - produk kecantikan (studi pada konsumen klinik natasha di jalan kaliurang yogyakarta) analisis data cross sectional adalah pengaruh kepuasan konsumen, kepercayaan merek, dan reputasi merek terhadap loyalitas merek (studi pada waroeng steak and shake cabang wirobrajan yogyakarta) reaksi pasar modal indonesia terhadap pengumuman penerbitan obligasi syariah tahun 2007-2010 analisis data deskriptif pengaruh labelisasi halal pada kemasan cokelat impor cadbury terhadap keputusan pembelian konsumen (studi pada mahasiswa fakultas ekonomi universitas muhammadiyah yogyakarta) pengaruh kepuasan terhadap loyalitas konsumen dengan switching cost sebagai variabel moderasi analisis data dalam penelitian pengaruh produk, harga, dan promosi terhadap keputusan pembelian konsumen pada smartphone iphone (studi pada mahasiswa universitas muhammadiyah yogyakarta) pengaruh return on equity (roe), price earning ratio (per), earning per share (eps) dan price to book value (pbv) terhadap return saham analisis data deskriptif kuantitatif pengaruh motivasi, persepsi dan sikap konsumen terhadap keputusan pembelian tshirt music merchandise di kota yogyakarta pengaruh kesadaran merek, asosiasi merek, dan persepsi kualitas terhadap keputusan pembelian (studi pada pembelian sepeda motor bebek honda di yogyakarta) analisis data dalam penelitian kualitatif pengaruh intellectual capital terhadap kinerja keuangan perusahaan perbankan yang terdaftar dibursa efek indonesia tahun 2009-2013 efektivitas penerapan price limit pada kondisi pasar bullish dan bearish di bursa efek indonesia analisis data deskriptif kualitatif pengaruh ukuran perusahaan, struktur aktiva , profitabilitas dan pertumbuhan aset terhadap struktur modal pada perusahaan manufaktur yang terdaftar di bursa efek indonesia periode 2010-2013 pengaruh sikap dan norma subyektif terhadap niat beli produk hand & body lotion vaseline (studi pada mahasiswa universitas muhammadiyah yogyakarta) analisis data dalam ptk pengaruh atribut supermarket terhadap motif belanja hedonik, motif belanja utilitarian dan loyalitas konsumen (studi pada konsumen carrefour yogyakarta) pengaruh modal intelektual terhadap kinerja perusahaan analisis data dalam penelitian kuantitatif pengaruh kepuasan kerja dan komitmen organisasional terhadap organizational citizenship behavior serta dampaknya terhadap kinerja karyawan (studi pada pt. pandu siwi sentosa semarang) pengaruh persepsi nilai, harapan, dan kepercayaan terhadap kepuasan konsumen pada penyedia jasa transportasi trans jogja analisis data dengan spss pengaruh motivasi, persepsi dan sikap konsumen terhadap keputusan pembelian smart phone merek “asus” di yogyakarta pengaruh faktor individu konsumen dan faktor marketing mix terhadap keputusan pembelian pelumas mesin prima xp di yogyakarta analisis data dan pembahasan pengaruh gaya kepemimpinan dan kompensasi terhadap kinerja karyawan ( pt. bank btn kantor cabang yogyakarta) pengaruh atribut produk terhadap keputusan pembelian handphone merek blackberry analisis data dalam sig pengaruh gaya kepemimpinan dan komitmen organisasi terhadap kinerja karyawan pengaruh atribut produk, atribut layanan, dan atribut pembelian terhadap kepuasan konsumen pada rm. pelak jaya ikan bakar dan seafood sleman yogyakarta analisis data eksperimen pengaruh motivasi kerja dan komitmen organisasi terhadap kinerja karyawandipt bank ntb cabang sumbawa pengaruh tipe keterlibatan konsumen terhadap kepercayaan merek dan dampaknya pada keputusan pembelian analisis data eksperimental faktor-faktor yang memengaruhi perilaku konsumen terhadap keputusan pembelian smartphone android pada mahasiswa universitas muhammadiyah yogyakarta analisis pengaruh citra terhadap loyalitas konsumen cokro tela cake yogyakarta analysis of the influence of image on customer loyalty cokro tela cake yogyakarta analisis data excel pengaruh kepercayaan, komitmen, komunikasi, penanganan konflik dan kepuasan terhadap loyalitas nasabah bank kalbar di pontianak pengaruh tipe keterlibatan konsumen terhadap kepercayaan merek dan dampaknya pada keputusan pembelian produk elektronika merek lg analisis data elektrolit pengaruh komunitas merek terhadap loyalitas merek pengaruh kebijakan pendanaan, kebijakan dividen, risiko dan profitabilitas perusahaan terhadap set kesempatan investasi (ios) pada perusahaan manufaktur di bursa efek indonesia (bei) analisis data elastisitas pengaruh job insecurity, kepuasan kerja, komitmen organisasional, serta kepercayaan organisasional terhadap turnover intention aplikasi theory of planned behavior pada niat mengikuti program mm-umy analisis data ekonomi makro pengaruh citra merek, kualitas produk, dan kepuasan konsumen terhadap loyalitas konsumen samsung galaxy series (studi pada mahasiswa universitas muhammadiyah yogyakarta) pengaruh citra merek terhadap loyalitas melalui kepuasan konsumen sebagai intervening analisis data ex post facto pengaruh sikap norma subyektif dan kontrol perilaku terhadap niat mahasiswa fakultas ekonomi universitas muria kudus untuk menjadi wirausaha pengaruh kepemimpinan transformasional terhadap kepuasan kerja karyawan analisis data eksploratori pengaruh kepemimpinan transformasional dan kepuasan kerja terhadap kinerja guru dengan mediasi komitmen organisasional pengaruh book value (bv), debt equity ratio (der) dan earning per share (eps) terhadap harga saham analisis data elektrolisis pengaruh self efficacy terhadap organizational citizen behavior (ocb) dimediasi oleh kepuasan kerja analisis pengaruh kualitas pelayanan terhadap kesetiaan pelanggan dimediasi oleh kepuasan pelanggan, citra perusahaan dan kepercayaan indomaret diy analisis data evaluasi pengaruh kualitas pelayanan terhadap kepuasan pasien askes di rsud wonosari gunungkidul yogyakarta pengaruh kepuasan konsumen terhadap kesetiaan merek pada london beauty centre yogyakarta analisis data fenomenologi pengaruh pemasaran relasional terhadap loyalitas nasabah bank analisis kinerja pegawai di dinas kesehatan kota tidore kepulauan sebelum dan sesudah pelatihan analisis data fisika analisis pengaruh kepemilikan manajerial, pertumbuhan perusahaan, ukuran perusahaan dan profitabilitas terhadap kebijakan dividen dan pengaruhnya terhadap nilai perusahaan pengaruh atribut produk, atribut layanan, dan atribut pembelian terhadap kepuasan konsumen pada pengrajin perak hs silver kotagede yogyakarta analisis data flow diagram pengaruh kepemilikan manajerial, kepemilikan institusional, kebijakan hutang, collateral assets dan aliran kas bebas terhadap nkebijakan divide pada perusahaan manufaktur yang terdaftar di bursa efe pengaruh periklanan terhadap minat membeli kerajinan batik kayu sanggar punokawan di yogyakarta analisis data faktorial pengaruh gaya kepemimpinan dan kompensasi terhadap kinerja karyawan.(pt bank btn kantor cabag yogyakarta). penilaian kinerja reksa dana saham dengan metode sharpe, treynor, dan jensen periode 2008-2009 analisis data frekuensi pengaruh return on asset, net profit margin , earning per share, price earning rasio, dan price to book value terhadap return saham perusahaan yang terdaftar di jakarta islamic index periode 2009- 2 pengaruh penerapan program corporate social responsibility (csr) terhadap brand loyalty susu sgm (studi kasus pada konsumen penerima program csr tss pt. sari husada di yogyakarta) analisis data ftir analisis pengaruh kepemilikan manajerial, kebijakan dividen, struktur aktiva, pertumbuhan penjualan, ukuran perusahaan dan profitabilitas terhadap strutur modal. pengaruh penggunaan celebrity endorser pada iklan sepeda motor honda vario terhadap keputusan pembelian di kabupaten wonosobo analisis data fgd pengaruh net profit margin, likuiditas, struktur aktiva, pertumbuhan perusahaan, ukuran perusahaan, dan return on assets terhadap struktur modal analisis pengaruh ekuitas merek terhadap keputusan pembelian (studi pada notebook merek acer) analisis data fotosintesis pengaruh laba bersih, arus kas operasi, profitabilitas dan hutang terhadap kebijakan dividen (studi pada perusahaan manufaktur yang terdaftar di bursa efek indonesia (bei) periode 2009-2012 ) analisis pengaruh elemen - elemen ekuitas merek terhadap pengambilan keputusan pembelian pada produk sepeda motor merek yamaha mio (studi pada mahasiswa universitas muhammadiyah yogyakarta) analisis data fenomenologis pengaruh gaya kepemimpinan dan kepuasan kerja terhadap komitmen organisasi : pendekatan transformasional leadership pengaruh persepsi kualitas pelayanan terhadap intensi pembelian konsumen yang dimoderasi oleh kepuasan pelanggan (studi pada pelanggan toko alfamart di pekalongan) analisis data fermentasi alkohol pengaruh kepemilikan manajerial, kepemilikan institusional, kebijakan dividen dan struktur aset terhadap kebijakan hutang pengaruh motivasi, persepsi konsumen dan sikap konsumen terhadap keputusan pembelian sepeda motor merek yamaha analisis data geografi “pengaruh profitabilitas, ukuran perusahaan dan resiko bisnis terhadap struktur modal perusahaan manufaktur di bursa efek indonesia” pengaruh kualitas pelayanan terhadap pembentukan intensi pembelian konsumen yang dimoderasi oleh kepuasan pelanggan analisis data gerak harmonik sederhana pengaruh faktor fundamental der, eps, npm, pbv dan roe terhadap return saham syariah (study perusahaan yang terdaftar di jakarta islamic index) pengaruh komponen arus kas dan laba akuntansi terhadap harga saham perusahaan industri pertambangan yang terdaftar di bursa efek jakarta analisis data gerak jatuh bebas pengaruh lingkungan kerja terhadap kinerja melalui kepuasan kerja sebagai variabel intervening studi kasus pada kantor wilayah bank bri yogyakarta pengaruh loyalitas kepada supervisor terhadap kepuasan kerja dan intent to stay analisis data glb dan glbb pengaruh keadilan organisasi dengan mediasi kepuasan kerja, dan komitmen organisasi terhadap organizational citizenship behavior (studi pada guru sekolah menengah pertama se-kecamatan sentolo,kabupa pengaruh economic value added dan market value added terhadap return saham pada perusahaan manufaktur di bursa efek indonesia periode 2005-2009 analisis data gaya gesek pengaruh return on equity, earning per share, dividend payout ratio dan suku bunga terhadap return saham pada perusahaan real estate dan properti yang terdaftar di bursa efek indonesia periode 2010 pengaruh motivasi kerja dan budaya organisasi terhadap kinerja pegawai disdikpora kabupaten gunungkidul analisis data gempa bumi pengaruh kemampuan intelektuldan motivasi terhadap kepuasan kerja pegawai dengan kinerja pegawai sebagai variabel intervening ( studi kasus pada badan perpustakaan dan arsip daerah yogyakarta pengaruh motivasi kerja terhadap prestasi kerja guru sekolah dasar dengan kepribadian sebagai variabel moderasi the influence of work motivation to work achievement of elementary school teacher analisis data golongan darah pengaruh profitabilitas, growth, operating cash flow (ocf) dan economic value added (eva) terhadap return saham. ( studi pada perusahaan properti yang terdaftar di bei 2012-2013) pengaruh kualitas layanan terhadap niat beli ulang konsumen di kafe g'bol dengan kepuasan sebagai variabel moderasi (studi pada kafe g'bol jln. sorowajan baru no.16 banguntapan, bantul) the inf analisis data gelombang berdiri analisis perbandingan kinerja keuangan bank devisa dan bank non devisa di indonesia an analysis of foreign bank and non-foreign bank financial performance in indonesia pengaruh keadilan distributif dan keadilan prosedural dalam penggajian terhadap kepuasan kerja guru dan karyawan (study di madrasah mu'allimaat muhammadiyah yogyakarta) analisis data guru pengaruh dana pihak ketiga (dpk), capital adequacy ratio (car), return on asset (roa), net interest margin (nim) dan non performing loan (npl) terhadap penyaluran kredit bank umum di indonesia pengaruh bauran penjualan eceran (retailing mix) terhadap citra matahari department store malioboro analisis data glb pengaruh citra merek dan kualitas persepsian terhadap keputusan pembelian produk kosmetik wardah analisis sikap konsumen terhadap atribut-atribut pasar swalayan dan pasar tradisional di kabupaten kulon progo analisis data hasil tes “pengaruh likuiditas, solvabilitas, ukuran perusahaan(size), dan pertumbuhan penjualan (growth) terhadap return saham pada perusahaan jasa dan investasi yang terdaftar dibei periode 2008-2013” analisis pengaruh it knowledge, it strategy dan it investment terhadap inovasi produk di perguruan tinggi yogyakarta analisis data hasil observasi pengaruh keadilan organisasional terhadap komitmen organisasi dengan kepuasan kerja sebagai variabel intervening ( studi pada karyawan universitas ahmad dahlan yogyakarta pengaruh kompensasi dan karakteristik pekerjaan terhadap kepuasan kerja karyawan universitas muhammadiyah yogyakarta analisis data hasil wawancara analisis pengaruh quality of work life terhadap kepuasan kerja dan kinerja karyawan (studi pada pt. aseli dagadu djokdja) pengaruh kepuasan kerja terhadap kinerja individual melalui variabel motivasi kerja sebagai intervening analisis data hukum hooke pengaruh kualitas layanan terhadap kepuasan dan positive word of mouth pada mahasiswa fakultas ekonomi universitas muhammadiyah yogyakarta analisis pengaruh manfaat dan kemudahan terhadap minat berperilaku mahasiswa dalam menggunakan situs jejaring sosial facebook dan twitter analisis data hasil belajar identifikasi kompetensi tenaga pendidik di lingkungan madrasah mu’allimin muhammadiyah yogyakarta pemakaian jasa penyewaaan tempat futsal di kota yogyakarta analisis data hipertensi “pengaruh gaya kepemimpinan, motivasi kerja dan disiplin kerja terhadap kinerja pegawai tenaga pendidik/dosen fakultas ekonomi universitas muhammadiyah yogyakarta” pengaruh kepercayaan merek terhadap loyalitas merek pada konsumen minuman pro biotik yakult (studi pada mahasiswa umy) analisis data hubungan “pengaruh kebijakan dividen, kebijakan utang, dan profitabilitas terhadap nilai perusahaan manufaktur periode 2009-2013” analisis minat pemanfaatan internet di sma n 4 yogyakarta dengan teori tam analisis data historis pengaruh pertumbuhan perusahaan, profitabilitas dan investment opportunity set terhadap kebijakan dividen (study kasus pada perusahaan manufaktur yang terdaftar di bursa efek indonesia (bei) periode pengaruh persepsi kualitas layanan terhadap loyalitas konsumen pada swalayan mirota godean di yogyakarta analisis data hujan pengaruh kepemilikan manajerial, kepemilikan institusional, kebijakan dividen, kebijakan hutang, dan corporate social responsibility (csr) terhadap nilai perusahaan (studi empiris pada perusahaan pr pengaruh reputasi perusahaan, karakteristik hubungan wiraniaga dan karakteristik wiraniaga terhadap kualitas hubungan (relationship quality) serta pengaruh terhadap loyalitas pelanggan pada bpr analisis data hasil penilaian pengaruh keputusan-keputusan keuangan dan good corporate governance terhadap nilai perusahaan (studi empiris pada perusahaan non keuangan yang terdaftar di bursa efek indonesia periode 2010-2013) pengaruh citra merek dan sikap merek terhadap ekuitas merek analisis data interaktif pengaruh return on equity, pertumbuhan earning per share, dividend yield dan economic value added terhadap return saham (studi empiris pada perusahaan manufaktur sektor consumer good yang terdaftar pengaruh persepsi kualitas layanan terhadap niat pembelian ulang pada markaz swalayan yogyakarta dengan kepuasan pelanggan sebagai variabel moderasi analisis data inferensial pengaruh rasio keuangan terhadap return saham (studi empiris pada perusahaan wholesale and retail trade di bei periode 2011-2013) pengaruh sikap dan norma subyektif terhadap niat beli produk sabun mandi cair merek lux (studi pada mahasiswa muhammadiyah yogyakarta) analisis data induktif pengaruh job insecurity terhadap turnover intention dengan kepuasan kerja dan komitmen organisasi sebagai variabel intervening (studi pada karyawan kontrak di perguruan tinggi muhammadiyah se-yogyak pengaruh kemahalan harga saham, likuiditas terhadap stock split dan implikasinya terhadap nilai perusahaan dan volume perdagangan analisis data inferensia pengaruh kepemimpinan transformasional terhadap komitmen organisasi melalui keadilan organisasi dan kepuasan kerja sebagai variabel mediasi pengaruh pertumbuhan penjualan, profitabilitas, likuiditas, struktur aktiva dan ukuran perusahaan terhadap struktur modal industri sektor ritel di bursa efek indonesia analisis data ian dey pengaruh pengembangan karir terhadap prestasi kerja karyawan (studi pada bank rakyat indonesia kantor cabang kebumen) pengaruh kualitas pelayanan terhadap kepuasan konsumen pada rumah makan yogya chicken analisis data induktif dan deduktif pengaruh profitabilitas, kebijakan dividen, kebijakan hutang dan kepemilikan manajerial terhadap nilai perusahaan pada perusahaan manufaktur yang terdaftar di bursa efek indonesia (bei) pengaruh manfaat dan kemudahan online shop terhadap minat berbelanja pengguna jejaring sosial facebook analisis data interview pengaruh kepuasan kerja terhadap keinginan berpindah dengan komitmen organisasi sebagai variabel intervening ( studi pada kantor badan perpustakaan dan arsip daerah yogyakarta ) pengaruh motivasi terhadap kinerja karyawan universitas muhammadiyah yogyakarta dengan kepuasan kerja sebagai variabel mediasi analisis data iklim pengaruh struktur kepemilikan, kebijakan dividen dan kebijakan hutang terhadap nilai perusahaan pada perusahaan manufaktur yang terdaftar di bursa efek indonesia (bei) pengaruh faktor eksternal dalam pengambilan keputusan pembelian handphone blackberry analisis data inflasi analisis faktor-faktor penentu kebijakan dividen (studi pada perusahaan manufaktur go public di bursa efek indonesia) analisis kepuasan pembeli perumahan dengan metode:hombsat pada perumahan villa andongsili asri analisis data instrumen penilaian “pengaruh stres kerja terhadap kinerja karyawan dengan kecerdasan emosi sebagai moderating variable” pengaruh faktor-faktor kepuasan pelanggan terhadap loyalitas pelanggan (studi kasus pada bengkel perkasa motor yogyakarta) the influence of customer satisfaction factors to customer loyalty (c analisis data jembatan wheatstone gambaran keinginanberpindah kerja karyawan berdasarkan stres, kepuasan kerja dan ketidakamanan kerja karyawan pengaruh profitabilitas dan investment opportunity set terhadap kebijakan dividen kas dengan likuiditas sebagai variabel moderat (studi pada perusahaan manufaktur yang terdaftar di bursa efek ind analisis data jarak fokus lensa tipis pengaruh intellectual capital dan corporate governance terhadap kinerja perusahaan (studi empiris pada perusahaan non keuangan yang terdaftar di bei dan cgpi periode 2010-2013) analisis tipe strategi usaha kecil dan menengah pada industri kerajinan di kabupaten bantul analisis data jamur tempe pengaruh karakteristik perusahaan terhadap kebijakan deviden di bursa efek indonesia periode 2011-2013 faktor-faktor yang mempengaruhi loyalitas merek pada konsumen shampo clear di yogyakarta. analisis data jangka sorong analisis pengaruh kesadaran merek, persepsian kualitas, dan harga terhadap keputusan pembelian smartphone apple (studi pada pengguna iphone di jl. malioboro kota yogyakarta) analisis variabel fundamental dan tekhnikal terhadap harga saham (studi di bursa efek indonesia) analisis data jaringan tumbuhan hubungan antara pioneer brand dan proses pemilihan brand minuman isotonik pocari sweat pengaruh kepuasan kerja dan keadilan organisasi terhadap komitmen organisasi pada karyawan pt. mondrian analisis data jumlah penduduk pengaruh kepuasan kerja dan komitmen organisasional terhadap kinerja karyawan pt. pura barutama unit offset kudus pengaruh faktor-faktor keagenan dan faktor-faktor biaya transaksi terhadap rasio pembayaran dividen di bursa efek indonesia analisis data jaringan hewan pengaruh citra merek, kualitas persepsian dan harga terhadap keputusan pembelian batik (studi pada konsumen di mirota batik yogyakarta) pengaruh kompensasi dan karakteristik pekerjaan terhadap kepuasan kerja karyawan di pt. madu baru bantul analisis data jurnal pengaruh lingkungan kerja terhadap kinerja karyawan melalui komitmen organisasi sebagai variabel intervening analisis pengaruh faktor bauran pemasaran, individu konsumen dan lingkungan terhadap pemakaian jasa warnet di sekitar kampus universitas muhammadiyah yogyakarta contoh analisis data jurnal pengaruh efikasi diri dan kepuasan kerja terhadap kinerja mengajar guru honorer sekolah dasar kecamatan blado kabupaten batang jawa tengah ( studi pada sekolah dasar kecamatan blado ) analisis faktor-faktor yang mempengaruhi keputusan membeli sepeda motor honda vario di kota yogyakarta jasa analisis data jogja analisis pengaruh camel terhadap prediksi kondisi bermasalah pada lembaga perbankan yang go public tahun 2010-2013 pengaruh dimensi-dimensi kepribadian organizational citizenship behavior (ocb) analisis data kualitatif pengaruh kepuasan kerja terhadap komitmen organisasi dan kinerja karyawan (studi pada guru sma muhammadiyah yogyakarta) perbandingan kinerja reksa dana syariah dengan reksa dana konvensional analisis data kuantitatif pengaruh rasio profitabilitas dan rasio solvabilitas terhadap return saham (studi pada perusahaan manufaktur yang terdaftar di bursa efek indonesia periode 2010-2013) analisis perbedaan tingkat stres dosen dilihat dari perbedaan gender dan kelompok pekerjaan analisis data kualitatif dan kuantitatif pengaruh total service quality management terhadap kepuasan pelanggan pada persewaan mobil mb rent car di yogyakarta analisis pengaruh kualitas layanan terhadap kepuasan pelanggan pada toko indomaret analisis data kualitatif menurut miles dan huberman pengaruh mekanisme good corporate governance terhadap nilai perusahaan (studi pada perusahaan manufaktur yang terdaftar di bursa efek indonesia periode 2010-2013) pengaruh keadilan terhadap kepuasan penilaian kinerja karyawan analisis data kualitatif adalah pengaruh profitabilitas, investment opportunity set (ios) terhadap kebijakan dividen dengan likuiditas sebagai variabel moderating (studi empiris pada perusahaan real estate dan properti yang terdaf analisis faktor - faktor yang mempengaruhi struktur modal pada perusahaan manufaktur yang telah go publik di bei tahun 2005 - 2008 analisis data kuantitatif adalah “pengaruh lingkungan kerja dan kompensasi terhadap kinerja pegawai melalui motivasi sebagai variabel intervening pada kantor desa kecamatan suralaga kabupaten lombok timur” analisis perbandingan kesadaran merek, asosiasi merek, persepsi kualitas merek, merek juice buavita analisis data kategorik pengaruh tingkat kesehatan bank terhadap return saham pada perusahaan perbankan yang terdaftar di bursa efek indonesia pengaruh kepuasan kerja dan motivasi kerja terhadap kinerja individual pegawai pdam kabupaten bantul analisis data kualitatif deskriptif pengaruh struktur aktiva, ukuran perusahaan, tingkat pertumbuhan, profitabilitas dan risiko bisnis terhadap struktur modal (studi pada perusahaan properti dan real estate yang terdaftar di bursa efe pengaruh kepuasan, perilaku kebiasaan, komitmen dan kesukaan merek terhadap kesetiaan merek pada konsumen air minum mizone analisis data kualitatif pdf analisis pengaruh likuiditas, kebijakan hutang, pertumbuhan perusahaan, profitabilitas, dan invesment opportunity set(ios) terhadapkebijakan dividen pada industri manufaktur di bei konsistensi risk-adjusted performance sebagai pengukur kinerja portofolio saham di pasar modal indonesia analisis data korelasi pengaruh kepuasan kompensasi terhadap kinerja dengan komitmen organisasi sebagai variabel mediator(studi kasus pada karyawan mirota batik yogyakarta). pengaruh motivasi dan budaya organisasi terhadap kinerja karyawan bank btpn di yogyakarta analisis data lanjutan pengaruh kepuasan kompensasi terhadap kinerja dengan komitmen organisasi sebagai variabel mediator(studi ksus karyawan mirota batik yogyakarta). pengaruh perbedaan individual dan karakteristik sistem terhadap penerimaan penggunaan teknologi informasi: replikasi model di bidang e-job vacancies analisis data larutan elektrolit pengaruh gaya kepemimpinan dan kepuasan kerja terhadap komitmen organisasi: pendekatan transformasional leadership. analisis positioning produk handphone merek sony ericsson berdasarkan persepsi konsumen analisis data laporan pengaruh kepemimpinan terhadap kinerja melalui motivasi sebagai variabel intervening(studi pada dinas perindrustrian perdagangan koperasi dan ukm diy). pengaruh motivasi terhadap produktivitas kerja karyawan pt telkom yogyakarta analisis data laju reaksi pengaruh keadilan organisasi dengan mediasi kepuasan kerja, dan komitmen organisasi terhadap organizational citizenship behavior(studi pada guru sekolah menengah pertama se-kecamatan sentolo, kabupt analisis perbandingan brand awareness, brand association, bran perceived quality minute maid pulpy orenge dan buahvita orange serta hubungannya dengan loyalitas konsumen analisis data likert pengaruh motivasi kerja dan komitmen organisasi terhadap kinerja karyawan di pt. bank ntb cabang sumbawa pengaruh kepemilikan saham institusional, kesempatan bertumbuh, kebijakan utang, profit dan tingkat risiko terhadap kebijakan dividen pada perusahaan analisis data laporan praktikum aplikasi tecnology acceptance model (tam) pada perilaku pembelian produk on-line shop, the application of technology accetance model (tam) on product purcchase behavior of online shop analisis pengaruh kebijakan pendanaan, deviden dan profitabilitas perusahaan terhadap set kesempatan investasi (ios) pada perusahaan manufaktur yang terdaftar di bursa efek indonesia (bei) analisis data lingkungan penerapan metode pembelajaran inside dan outside circle untuk meningkatkan keaktofan siswa pada materi al-islam kelas v sd muhammadiyah ambarketawang 3 gamping sleman. pengaruh dukungan sosial terhadap stres kerja pada wanita karir analisis data listrik statis pengendalian kualitas statistik guna mengendalikan tingkat kerusakan produk pt. adi tria abadi (asa). pengaruh kinerja keuangan terhadap keputusan pemberian kredit pada pd. bpr bank pasar temanggung analisis data lembar observasi komparasi kepuasan konsumen sepeda motor sport kawasaki ninja 250 r dan honda cbr 250 di yogyakarta. pengaruh leverage operasi, leverage finansial, dan profitabilitas perusahaan terhadap risiko sistematik saham analisis data longitudinal pengaruh citra merek dan kepercayaan merek terhadap loyalitas merek pada prisoner apparel. pengaruh kepemimpinan dan struktur organisasi terhadap inovasi organisasi analisis data menurut para ahli pengaruh set kesempatan investasi, profitabilitas dan kebijakan hutang terhadap kebijakan deviden pada perusahaan manufaktur yang terdaftar di bursa efek indonesia (bei) periode 2009-2013. pengaruh uklim organisasi terhadap kepuasan kerja karyawan universitas muhammadiyah yogyakarta analisis data menurut sugiyono pengaruh gaya kepemimpinan dan komitmen organisasi terhadap kinerja karyawan. pengaruh persepsi manfaat, kemudahan, dan ketidakpastian tugas dalam penggunaan digital journal online analisis data makro ekonomi analisis motivasi, kepemimpinan transformasional dan lingkungan kerja mempengaruhi kinerja mempengaruhi kinerja karyawan di rskia bhakti ibu kota yogyakarta. analisis perbedaan sikap konsumen terhadap status merek pionir analisis data menggunakan spss pengaruh keputusan investasi, keputusan pendanaan, kebijakan dividen dan tingkat suku bunga terhadap nilai perusahaan yang terdaftar di bursa efek indonesia periode 2009-2013. pengaruh motivasi, komitmen organisasional, dan kompetensi terhadap kinerja karyawan balai latihan pendidikan teknik (blpt) yogyakarta analisis data metode penelitian kualitatif pengaruh profitabilitas dan pengungkapan corporate social responsibility terhadap nilai perusahaan. pengaruh komitmen organisasi dan kepuasan kerja terhadap kinerja individual pada karyawan pt. arun ngl analisis data menurut arikunto 2006 persepsi kualitas produk dan harga terhadap minat membeli ulang sepeda motor bebek merek yamaha di kecamatan gamping yogyakarta. analisis faktor-faktor yang mempengaruhi tingkat pendapatan usaha counter pulsa di kecamatan gamping sleman analisis data model interaktif analisis pengaruh persepsi konsumen pada bauran pemasaran terhadap keputusan pembelian produk 'maybelline'. pengaruh manfaat dan kemudahan terhadap minat berperilaku mahasiswa dalam menggunakan database jurnal online hasil kerjasama perpustakaan umy dengan dikti analisis data model miles dan huberman pengaruh servant leadership terhadap prestasi kerja dengan komitmen organisasi dan organization citizenship behavior sebagai variabel intervening. analisis pengaruh asimetri informasi, nilai dividen, risiko terhadap periode kepemilikan saham biasa oleh investor pada perusahaan manufaktur yang terdaftar di bursa efek indonesia periode 2006-20 analisis data miles dan huberman analisis pengaruh motivasi, persepsi dan sikap konsumen terhadap keputusan pembelian kamera dslr merek canon di yogyakarta. pengaruh kesesuaian citra diri terhadap kesukaan merek dan kepuasan konsumen pada produk sepeda motor "honda" analisis data multivariat pengaruh persepsi good governance terhadap komitmen afektif, dengan kepercayaan kepada manajemen swbagai pemediasi. pengaruh computer anxiety terhadap keahlian karyawan dalam penggunaan komputer: tinjauan perspektif gender (survey pada kpp pratama yogyakarta) analisis data non parametrik pengaruh keputusan investasi, keputusan pendanaan dan kebijakan dividen terhadap nilai perusahaan. analisis faktor -faktor yang mempengaruhi price earning ratio (studi empiris pada perusahaan manufaktur yang terdaftar di bursa efek jakarta) analisis data nominal pengaruh kompetensi, kecerdasan spiritual dan kemampuan manajerial terhadap kinerja pengusaha di yogyakarta . pengaruh adversity quotient terhadap resistance to organizational change analisis data nyeri pengaruh kepercayaan merek terhadap loyalitas merek pada jasa reparasi nasmoco. pengaruh kinerja keuangan terhadap nilai perusahaan dengan corporate social responsibility dan good corporate governance sebagai variabel moderasi analisis data numerik pengaruh car, roa, bopo dan ldr terhadap npl pada bank umum konvensional yang terdaftar di bursa efek indonesia pengaruh profitabilitas dan investasi terhadap kebijakan dividen tunai dengan kecukupan kas dan likuiditas sebagai variabel moderat analisis data non statistik pengaruh profitabilitas, investment opportunity set dan debt to equity ratio terhadap kebijakan deviden tunai dengan likuiditas sebagai variabel moderasi the effect of profitablity, investment opportunity set, and debt to equity ratio on the policy of cash dividend with liquidity as moderate va pengaruh kepuasan terhadap kesetiaan konsumen (studi kasus pada konsumen rumah makan pasar senggol di kabupaten tegal) analisis data n-gain persepsi keadilan kompensasi terhadap komitmen organisasional melalui kepuasan kerja sebagai variabel intervening pada bmt bif yogyakarta. pengaruh manfaat dan kemudahan terhadap minat berperilaku (behavioral intention) dalam penggunaan tv berlangganan (tv cable) analisis data nominal dan nominal analisis positionning smartphone blackberry di yogyakarta. analisis minat berperilaku masyarakat dalam penggunaan teknologi internet-banking di kota yogyakarta analisis data nominal dan ordinal pengaruh car, bopo dan ldr terhadap npl pada bank umum konvensional yang terdaftar di bursa efek indonesia. pengaruh keputusan keuangan dan struktur kepemilikan terhadap nilai perusahaan analisis data nvivo pengauh komitmen organisasi dan kepuasan kerja terhadap kinerja individual pada karyawan bmt tamzis wonosobo. kepercayaan merek dan dampaknya pada keputusan pembelian laptop analisis data naratif pengaruh gaya kepemimpinan, motivasi kerja dan disiplin kerja terhadap kinerja karyawan. kajian penerimaan teknologi sms banking pada mahasiswa berdasarkan konsep technology acceptance model analisis data observasi pengadilan kualitas produk dengan menggunakan statistical process control (spc) di cv risma konveksi. pengaruh atribut produk terhadap keputusan pembelian laptop merek compaq di universitas muhammadiyah yogyakarta analisis data ordinal pengaruh total service quality management (tsqm) terhadap kepuasan pelanggan. analisis pengaruh struktur aktiva, ukuran perusahaan, profitabilitas, pertumbuhan penjualan, beban pajak dan operating leverage terhadap struktur modal pada perusahaan manufaktur di bursa efek analisis data one group pretest posttest design pengaruh selebriti pendukung, asosiasi merek, kepribadian merek dan karakteristik produk dalam menciptakan intensi pembelian. pengaruh economic value added (eva), market value added (mva) dan return on asset (roa) terhadap return saham pada perusahaan manufaktur yang terdaftar di bursa efek indonesia analisis data ordinal dan ordinal pengaruh market to book value, return on equity dan capital expenditures to book value of asset terhadap return saham. analisis pengaruh insentif, motivasi, dan disiplin kerja terhadap kinerja karyawan martha tilaar "salon and day spa" yogyakarta analisis data one way anova pengaruh dimensi totoal service quality management terhadap kepuasan pelanggan jasa transportari taksi jas. pengaruh konpensasi dan lingkungan kerja terhadap kepuasan karyawan analisis data observasi aktivitas siswa pengaruh struktur kepemilikan kebijakan dividen dan kebijakan hutang terhadap nilai perusahaan. citra trans jogja dan pengaruhya terhadap perilaku konsumen dalam menggunakan jasa angkutan di yogyakarta analisis data ordinal dengan spss analisis perbedaan kinerja keuangan bank umum swasta nasional yanag listed di bei dengan bank umum awata nasional yang tidak listed di bei. analisis faktor-faktor yang mempengaruhi minat pemanfaatan website analisis data ordinal dan nominal pengaruh keputusan investasi kebijakan dividen dan kinerja keuangan terhadap nilai perusahaan pada sektor perbankan di bursa efek indonesia. pengaruh manfaat dan kemudahan minat berperilaku dosen universitas muhammadiyah yogyakarta dalam penggunaan situs jejaring sosial pertemanan facebook analisis data outlier pengaruh kualitas layanan terhadap minat pembelian ulang dengan keputusan nasabah sebagai variabel intervening pada atm bri kcp sumpiuh banyumas. analisis pengaruh investment opportunity set (ios), kebijakan pendanaan, dan kebijakan deviden terhadap nilai perusahaan manufaktur di bursa efek indonesia210 analisis data osmosis pada kentang pengaruh kepuasan investasi, keputusan pendanaan dan kebijakan deviden terhadap nilai perusahaan. peran kepercayaan merek dan kepuasan dalam menjelaskan loyalitas pada merek (studi empirik pada konsumen laptop) analisis data penelitian analisis pengaruh retail mix terhadap kepuasan konsumen di swalayan menara yogyakarta. analisis variabel-variabel yang mempengaruhi fenomena underpricing pada penawaran saham perdana di bursa efek jakarta analisis data penelitian kualitatif pengaruh kepuasan kerja dan komitmen organisasional terhadap kualitas pelayanan di pt. bando indenesia tangerang. analisis sikap, norma subjektif dan niat berperilaku pengguna layanan bus transjogja analisis data ptk pengaruh motivasi dan disiplin kerja teehadap kinerja guru sma muhammadiyah 3 yogyakarta. pengaruh implementasi relationship marketing pada waroeng steak & shake analisis data penelitian kuantitatif pengaruh kepuasan konsumen terhadap minat berprilaku pada jasa bus efisiensi di yogyakarta. pengaruh kepuasan kongsumen terhadap kesetiaan merek pada rumah makan ayam goreng suharti di yogyakarta analisis data panel pengaruh ekuitas merek terhadap keputusan pembelian smartphone sony xperia di yogyakarta. implementasi relationship marketing pada pt kereta api di yogyakarta analisis data penelitian deskriptif pengaruh kepemilikan saham manajerial, kepemilikan sahan intitusional, set kesempatan investasi dan arus kas bebas terhadap kebijakan utang. analisis penilaian konsumen terhadap ekuitas merek bakery shops di yogyakarta analisis data penelitian kualitatif pdf pengaruh keputusan inverstasi, keputusan pendanaan dan kebijakan dividen terhadap nilai perusahaan. pengaruh kemudahan dan kebutuhan informasi terhadap minat berperilaku para mahasiswa dalam menggunakan internet (studi kasus di daerah godean) analisis data penelitian eksperimen pengaruh kinerja keuangan dan risiko terhadap return saham perusahaan sektor pertambangan di bei periode 2005-2011 analisis pengaruh etika kerja islam terhadap komitmen organisasi dan kepuasan kerja analisis data pdf pengaruh kinerja keuangan perusahan terhadap likuiditas sahan. analisis faktor-faktor yang mempengaruhi struktur modal: studi empirik pada perusahaan manufaktur di bursa efek indonesia periode 2004 - 2008 analisis data penelitian pdf kajian pemeliharaan gedung di universitas muhammadiyah yogyakarta. analisis abnormal return pada perusahaan yang melakukan stock split di indonesia analisis data kualitatif pengaruh likuiditas, profitabilitas, struktur aktiva, ukuran perusahaan, risiko bisnis, pertumbuhan perusahaan dan kepemilikan manajerial terhadap struktur modal. analisis sistem pengendalian persediaan bahan baku dengan metode mrp produk tas model sport collection pada usaha kerajinan tas enstein di kabupaten kebumen analisis data questioner pengaruh keputusan investasi, keputusan pendanaan, kebijakan deviden stuktur kepemilikan institusional dan kepemilikan insider terhadap nilai perusahaan. pengaruh promotional mix terhadap peningkatan volume penjualan pada pt. kharisma mataram jaya gemilang yogyakarta analisis data kuasi eksperimen pengaruh kompensasi finansial dan non finansial terhadap motovasi kerja karyawan universitas muhammadiyah yogyakarta. pengaruh manfaat dan kemudahan terhadap minat berperilaku para mahasiswa dan mahasiswi yang bertempat tinggal di wates yogyakarta dalam menggunakan internet qualitative data analysis pengaruh capital adequacy ratio (car) non performing loan (npl), beban operasional/ pendapatan operasional (boko), dan ldr terhadap pertumbuhan laba pada perbankan yang terdahtar di bei pengaruh pengetahuan tentang taktik pemasangan iklan, penghargaan diri, kerentanan konsumen, dan pengetahuan produk konsumen pada skeptisme orang dewasa terhadap iklan televisi analisis data quantitative pengaruh mekanisme good corporate governance terhadap kinerja sektor perbankan. pengaruh leverage operasi, leverage finansial, price earning ratio dan total asset turnover terhadap risiko sistematik saham yang termasuk dalam indeks lq-45 di bursa efek indonesia analisis data penelitian kuasi eksperimen pengaruh ekuitas merek sepeda motor honda terhadap keputusan pembelian. pengaruh budaya kerja terhadap motivasi dan kinerja teknik analisis data quasi eksperimen pengaruh kepemilikan manajerial, kepemilikan institusional, kebijakan deviden, profitabilitas, pertumbuhan perusahaan dan struktur assets terhadap kebijakan utang pada perusahaan manufaktur yang ter pengaruh struktur aktiva, ukuran perusahaan, investment opportunity set (ios), profitabilitas, dan resiko terhadap keputusan struktur modal pada industri manufaktur di bursa efek jakarta teknik analisis data qualitative analisis deskriptif praktek learning organization di lingkungan perusahaan kecil menengah sentra industri kerajinan tangan desa bangunjiwo kabupaten bnatul yogyakarta. analisis dampak service performance terhadap loyalitas nasabah dengan kepuasan sebagai moderating variabel teknik analisis data penelitian quasi eksperimen identifikasi perbedaan persepsi siawa terhadap kompentensi pendidik yang berasal dari indonesia dan turki di sman sbbs (sragen bilingual boarding school). analisis faktor yang dipertimbangkan nasabah dalam mempersepsikan kualitas layanan bank datanalisis quito pengaruh kompensasi dan motivasi keja, terhadap kometmen organisasional melalui kepuasan kerja sebagai variabel intervening pada rs pku muhammadiyah yogyakarta unit ii. analisis elemen brand equity pada produk minuman sirup marjan analisis data regresi pengaruh return on asset (roa) debet to equity ratio (der) earning per share (eps) price to book value (pbv) dan deviden payout ratio (dpr) terhadap return saham. dampak faktor-faktor keagenan dan faktor-faktor yang mempengaruhi biaya transaksi terhadap rasio pembayaran dividen analisis data regresi berganda pengaruh kompensasi tadak langsung , motivasi motivator factors dan motivasi hygiene factors terhadap kinerja karyawan bmt al huda wonosoba. analisis pengaruh fairness terhadap kepuasan pengguna atas unit sistem informasi analisis data regresi linier identifikasi tingkat pemahaman, sikap serta perilaku para pengguna sepeda motor dalam upaya mengurangi pencemaran udara akibat emisi gas buang di kota yogyakarta pengaruh kualitas pelayanan terhadap kepuasan pelanggan pada bengkel mandiri motor variasi analisis data regresi sederhana pengaaruh ukuran perusahaan, profitabilitas, keputusan investasi, keputusan pendanaan, dan kebijakan deviden terhadap nilai perusahaan. pengaruh faktor fundamental terhadap return saham pada perusahaan perbankan di bursa efek jakarta analisis data rpl pengaruh citra merek terhadap pemasaran word of mouth dengan kepuasan konsumen sebagai variabel intervening. pengaruh citra dan kepuasan terhadap loyalitas anggota (studi pada bmt al ikhlas yogyakarta) analisis data regresi linier berganda pengaruh kesadaran merek, kualitas persepsian dan kepercayaan merek terhadap minat beli produk hijau pada kaum muda terdidik. pengaruh current ratio, quick ratio, leverage, return on investment dan return on equity terhadap abnormal return pada perusahaan manufaktur di bursa efek indonesia (bei) analisis data regresi logistik pengaruh profitabilitas straktur aktiva, pertumbuhan penjualan dan likuiditas terhadap struktur modal pada perusahaan lq45 di bursa efek indonesia. analisis perbedaan kinerja keuangan perusahaan sebelum dan sesudah pengumuman right issue pada perusahaan go publik di bursa efek indonesia periode 2004-2006 analisis data rasio analisis perdedaan kineja keuangan bank sebelum dan sesudah initial public offering (ipo). analisis faktor-faktor yang mempengaruhi struktur modal pada perusahaan manufaktur di bursa efek indonesia analisis data rating scale identifikasi tingkat kinerja karyawan di fakultas ekonomi universitas muhammadiyah yogyakarta. analisis pengaruh citra rumah sakit dan kepuasan pelanggan terhadap loyalitas pelanggan pada rsud kabupaten pekalongan analisis data raster pengaruh profitabilitas, leverage, set kesempatan investasi dan aliran kas bebas terhadap kebijakan dividen. pengaruh kepuasan kerja dan komitmen organisasi terhadap turnover intention analisis data statistik pengaruh capital adequancy ratio (car) non performing loan (npl) biaya operasional terhadap pendekatan operasional (bopo), return on asset (roa) dan net interest margin (nim) thd (ldr). analisis harga saham pt telkomsel tbk: pendekatan model autoregressive integrated moving average (arima) analisis data spss zona si kawasan terpapar eropsi gunung merapi 2010 di desa kepuhharjo sebagai dasar penentuan tingkst kesuburan lahan untuk tanaman jagung (zea mays l.). pengaruh komitmen organisasi dan kompetensi terhadap kinerja individual analisis data statistik deskriptif analisis pengaruh kualitas layanan terhadap kepuasan konsumen maskapai garuda indonesia. analisis pengaruh citra markaz swalayan terhadap loyalitas konsumen di yogyakarta analisis data skala likert pengaruh citra merek kualitas persepsian dan nilai persepsi terhadap kepuasan konsumen mister buger. analisis pengaruh citra dan kepuasan terhadap loyalitas pasien dirumah sakit umum tidar magelang analisis data sederhana analisis elemen-elemen brand equity pada jasa angkutan merek "efiensi". analisis pengaruh citra rumah sakit dan kepuasan terhadap loyalitas pasien rumah sakit umum sardjito analisis data spasial analisis pengaruh manfaat dan kemudahan terhadap minat berperilaku dalam penggunaan sms banking the analysis of perceived usefulness and perceived ease of use effect toward behavioral intention in using sms banking pengaruh corporate social responsibility terhadap citra pt telkom kandatel yogyakarta menurut persepsi mitra binaan (studi kasus pada pt telkom tbk kandatel yogyakarta) analisis data sekunder analisis faktor-faktor yang mempengaruhi minat pelanggan menggunakan jasa lapangan semar futsal pengaruh kreativitas iklan terhadap loyalitas konsumen produk pasta gigi pepsodent dan close-up analisis data secara deskriptif adalah perbedaan gender dalam penggunaan gaya kepemimpinan transformasional: suatu pengujian dari prespektif atasan, bawahan, rekan kerja, dan diri sendiri dalam lingkungan universitas muhammadiyah yogyaka analisis dampak restrukturisasi terhadap job insecurity dan kepuasan kerja analisis data studi kasus robert k yin pengaruh ekuitas merek terhadap keputusan pembelian minuman isotonik merek mizone pengaruh ketidakpuasan konsumen, karakteristik kategori produk dan kebutuhan mencari variasi terhadap keputusan perpindahan merek kartu selular prabayar analisis data skripsi pengaruh atribut produk terhadap sikap konsumen pada green product cosmetics pengaruh jumlah tenaga kerja, jam kerja, modal usaha, dan lama usaha terhadap tingkat pendapatan pedagang berskala kecil (studi empiris di pasar beringharjo yogyakarta) analisis data time series pengaruh kualitas pelayanan terhadap kepuasan nasabah dalam membentuk loyalitas nasabah pada bank kantor kas umy di yogyakarta analisis kinerja keuangan perusahaan publik sebelum dan sesudah akuisisi analisis data t test analisis pengaruh celebrity endorser terhadap citra merek pada iklan produk simcard gsm prabayar kartu as di kota yogyakarta analisi elemen-elemen brand equity untuk menentukan kekuatan produk minuman ringan merek teh botol sosro (studi kasus pada mahasiswa uninersitas muhammadiyah yogyakarta) analisis data tidak normal pengaruh emotional branding terhadap perilaku brand switching pada konsumen waroeng steak and shake (studi kasus pada mahasiswa universitas muhammadiyah yogyakarta) pengaruh lokasi, layout dan atmosfer ritel pada respon emosional dan perilaku (studi pada konsumen di supermarket giant yogyakarta) analisis data tabulasi silang pengaruh katalog produk terhadap minat beli kembali konsumen indomaret di yogyakarta pengaruh keterlibatan konsumen terhadap kepercayaan merek acer di universitas muhammadiyah yogyakarta analisis data tematik faktor-faktor yang mempengaruhi luas pengungkapan corporate governance dalam laporan tahunan perusahaan manufaktur yang terdaftar di bursa efek indonesia analisis faktor-faktor marketing mix yang menimbulkan minat beli konsumen sepatu futsal (studi perilaku konsumen sepatu futsal di umy) analisis data tentang banjir pengaruh return on equity, growth, dividend payout ratio dan beta terhadap return saham pengaruh atribut produk terhadap keputusan pembelian sepeda motor bajaj di yogyakarta analisis data tabel kontingensi pengaruh kepercayaan merek terhadap loyalitas merek pada produk citra hand & body lotion analisis pengaruh penerapan good corporate governance, profitabilitas, ukuran perusahaan terhadap nilai pasar perusahaan pada perusahaan yang terdaftar di bursa efek indonesia analisis data tematik adalah analisis faktor-faktor yang berpengaruh terhadap tingkat penyaluran dana pada bank umum syariah pengaruh informasi asimetri terhadap kebijakan dividen pada industri manufaktur yang terdaftar di bursa efek indonesia (bei) analisis data tegangan permukaan 1 pengaruh struktur kepemilikan, kebijakan dividen, kebijakan utang terhadap nilai perusahaan pada perusahaan manufaktur yang terdaftar di bursa efek indonesia (bei) strategi survival usaha mikro-kecil (studi empiris pedagang ritel pasar sentul di jl. sultan agung, yogyakarta) analisis data tentang korosi analisis pengaruh return on assets, debt to equity ratio, cash position dan firm size terhadap dividend payout ratio (studi pada perusahaan manufaktur yang terdaftar di bursa efek indonesia 2007-2 analisis pengaruh kualitas pelayanan dan kepuasan pelanggan terhadap intensi pembelian konsumen mediko swalayan di yogyakarta analisis data univariat analisis pengaruh harga, kualitas produk, dan lokasi terhadap keputusan pembelian (studi kasus di kosmo factory outlet yogyakarta) evaluasi kelayakan bisnis toko alat olahraga dan musik (kasus pada toko alat olahraga dan musik sahara, di sewon, bantul, diy) analisis data uji makanan pengaruh citra merek terhadap loyalitas konsumen olive fried chicken di yogyakarta studi kemampuan usaha kedai kopi "plat 'r' zone" di yogyakarta analisis data uji t pengaruh kesenangan konsumen (customer delight) terhadap loyalitas konsumen (studi pada fakultas ekonomi universitas muhammadiyah yogyakarta) pengaruh sikap. norma subyektif dan kontrol keperilakuan terhadap niat beli konsumen pada produk sabun mandi shinzu'i analisis data univariat dan bivariat pengaruh rasio keuangan terhadap tingkat bagi hasil simpanan mudharabah pada bank syariah di indonesia fleksibilitas infrastuktur teknologi iinformasi pada pt. bank rakyat indonesia (persero) tbk dan pt. bank central asia tbk cabang bengkulu: sisi teknis dan sumber daya manusia analisis data untuk penelitian eksperimen faktor-faktor yang mempengaruhi mahasiswa dalam keputusan pembelian ponsel berbasis android analisis faktor-faktor yang mempengaruhi keputusan beli konsumen terhadap produk sayuran organik di kabupaten sleman daerah istimewa yogyakarta analisis data uji hidup pengaruh sikap dan norma subyektif terhadap niat beli masyarakat sebagai konsumen potensial produk vaseline men face wash di kotamadya yogyakarta analisis pengaruh kualitas pelayanan terhadap efektifitas sistem informasi analisis data usaha pengaruh investment opportunity set (ios) terhadap harga saham dengan devidend per share (dps) sebagai variabel pemoderasi pengaruh kualitas pelayanan dan kepuasan pelanggan dalam pembentukan intensi pembelian konsumen di maga swalayan analisis data uji asumsi klasik pengaruh laba dan arus kas terhadap kondisi financial distress pada perusahaan bukan bank yang terdaftar dibursa efek indonesia analisis pengaruh kualitas jasa terhadap loyalitas konsumen (studi pada jasa transportasi kereta api daop vi yogyakarta) analisis data uji normalitas identifikasi dan implementasi nilai-nilai etos kerja karyawan dalam perspektif islam pengaruh corporate social responsibility, persentase kepemilikan manajemen dan tipe industri terhadap nilai perusahaan (studi empiris pada perusahaan yang terdaftar di bursa efek indonesia) analisis data untuk judul pengaruh analisis korelasi investment opportunity set (ios) terhadap return saham pada perusahaan manufaktur yang terdaftar di bursa efek indonesia (bei) tahun 2009-2011 evaluasi terhadap program waralaba (franchise) (studi kasus tela tela di yogyakarta) analisis data vegetasi analisis pengaruh bauran pemasaran terhadap keputusan konsumen dalam memilih warung internet ilalang faktor-faktor yang berpengaruh pada ketepatan waktu penyajian laporan keuangan (studi empiris perusahaan manufaktur yang terdaftar di bei) analisis data vektor analisis pengaruh media iklan terhadap pengambilan keputusan membeli air minum dalam kemasan, merek aqua pada masyarakat kota pemalang pengaruh budaya organisasi terhadap kepercayaan dan komitmen organisasi pada rumah sakit pku muhammadiyah yogyakarta. analisis data variabel intervening pengaruh motivasi dan disiplin kerja terhadap kinerja guru sma muhammadiyah yogyakarta pengaruh keadilan distributif dan keadilan prosedural dalam penggajian terhadap kepuasan kerja karyawan analisis data variasi kontinu pengaruh kepemimpinan dan disiplin kerja terhadap kinerja karyawan di radio republik indonesia cabang madya yogyakarta analisis faktor-faktor yang mempengaruhi minat pemanfaatan sistem informasi manajemen akademik (simak) di universitas muhammadiyah yogyakarta analisis data variabel dummy analisis strategi pemasaran industri rumah tangga kerajinan ukir shodikul mebel jepara analisis perbandingan kinerja keuangan bank syariah dengan bank konvensional berdasarkan rasio keuangan analisis data viskositas pengaruh entrepreneural self efficacy dan proactive personality terhadap entrepreneural intention analisis faktor- faktor yang mempengaruhi kepuasan pemakai dalam pengembangan sistem informasi (studi empiris pada pegawai di universitas gadjah mada yogyakarta) analisis data voltmeter dan amperemeter pengaruh kualitas produk dan harga terhadap keputusan pembelian produk (studi pada produk telpon seluler "nokia"). analisis pengaruh soft skills terhadap perilaku mahasiswa fakultas ekonomi universitas muhammadiyah yogyakarta analisis data viskositas fluida faktor-faktor yang mempengaruhi perilaku konsumen dalam memilih bank syariah di yogyakarta (studi kasus bank syariah mandiri di umy). pengaruh manfaat dan kemudahan terhadap minat berperilaku dalam penggunaan situs google dan yahoo analisis data verifikatif analisis pengaruh daya tarik iklan, kualitas pesan iklan dan frekuensi penayanagn iklan terhadap efektivitas iklan televisi axis (survei pada mahasiswa umy). pengaruh partisipasi dalam pengembangan sistem informasi terhadap kinerja sistem informasi: ketidakpastian tugas sebagai variabel moderasi analisis data validitas dan reliabilitas analisis perbadingan tingkat kesehatan bank syariah dan bank konvensional periode 2008-2011. analisis perilaku konsumen pada produk shampoo pantene dan rejoice di yogyakarta (pendekatan sikap dan norma subjektif) analisis data wikipedia pengaruh good corporate governance, growth opportunity, size terhadap kinerja perbankan. pengaruh kepemilikan manajerial, dividen, kepemilikan institusional, ukuran perusahaan, risiko, dan struktur asset terhadap kebijakan utang analisis data wawancara pengaruh motivasi konsumen, persepsi konsumen dan sikao konsumen terhadap keputusan pembelian sepeda motor merek yamaha sport di kota yogyakarta. problematika dan dinamika usaha pada sektor informal di yogyakarta (studi empiris pedagang pasar klithikan di pakuncen, yogyakarta) analisis data warehouse pengaruh iklan, citra merek dan kepuasan konsumen terhadap loyalitas konsumen sabun shinzu'i di kota yogyakarta. reaksi pasar pada penetapan saham yang tergabung dalam jakarta islamic index (jii) pada bursa efek indonesia tahun 2006-2008 analisis data wilcoxon pengaruh persepsi nilai harapan dan kepercayaan terhadap kepuasan konsumen pada penyedia jasa internet di yogyakarta (studi kasus pada warnet ilalang). analisis faktor-faktor yang mempengaruhi minat pemanfaatan sistem informasi analisis data wawancara mendalam pengaruh ukuran perusahaan, leverage, profitabilitas dan kebijakan dividen terhadap nilai perusahaan (studi pada perusahaan manufaktur yang terdaftar di bei 2007-2011). skripsi pengaruh manfaat dan kemudahan terhadap minat berperilaku (behavioral intention) dalam penggunaan sistem portal (studi empiris pada siswa di sma muhammadiyah 2 yogyakarta) data analysis wiki pengaruh leverage dan growht terhadap kebijakan dividen dengan corporate gavernance sebagai variabel intervening pada perusahaan yang terdaftra di bei. analisis elemen-elemen ekuitas merek minuman air mineral aqua analisis data waduk jatiluhur pengaruh kecerdasan intelektual terhadap kinerja yang dimoderasi oleh locus control. analisis pengaruh kebijakan hutang, kesempatan investasi, insider ownership, profitability, dan risk terhadap kebijakan dividen analisis data wirausaha pengaruh konflik pekerjaan-keluarga terhadap kinerja dosen wanita di universitas muhammadiyah yogyakarta. pengujian reaksi pasar pada peristiwa dimasukkannya saham dalam daftar indeks lq45 analisis data wilcoxon signed rank test pengaruh kualitas produk dan harga terhadap loyalitas melalui kepuasan konsumen pada produk sepada motor merek honda di pt. nusantara sakti mertoyudan magelang. pengaruh kualitas pelayanan dan marketing mix terhadap keputusan konsumen untuk menjadi nasabah di bank bpd diy analisis data deret waktu pengaruh non debt tax shields, likuiditas. profitabilitas dan investasi terhadap keputusan pendanaan pada perbankan syariah di indonesia. pengaruh komitmen organisasi terhadap turnover intention pada karyawan non edukatif universitas muhammadiyah yogyakarta analisis data xrd reaksi pasar terhadap pergantian menteri keuanagan republik indonesia tahun 2013. analisis perbedaan kebutuhan akan prestasi, afiliasi, otonomi, dominasi pada karyawan wanita dan entrepreneur wanita serta faktor yang mempengaruhinya cara analisis data xrd pengaruh karakteristik perusahaan terhadap struktur modal (studi empiris pada perusahaan yang terdaftar di bei preode 2007-2011). pengaruh ketidakpuasan konsumen, karakteristik kategori produk dan kebutuhan mencari variasi terhadap keputusan perpindahan merek pelumas mesin (oli) kendaraan bermotor analisis data yaitu pengaruh citra merek terhadap loyalitas konsumen breadtalk di kota yogyakarta. analisis faktor-faktor yang mempengaruhi price earning ratio pada perusan manufaktur yang terdaftar di bursa efek indonesia analisis data yang digunakan pengaruh kebijakan dividen, kebijakan investasi, dan kebijakan pendanaan terhadap nilai perusahaan (studi pada industri mnufaktur yang terdaftar di bursa efek indonesia). pengaruh manfaat dan kemudahan terhadap minat berperilaku siswa sman i teladan yogyakarta dalam menggunakan e-learning analisis data yang digunakan dalam penelitian ilmiah pengaruh profitabilitas, likuiditas, leverage, growth dan size terhadap kebijakan dividen pada perusahan lq 45 yang terdaftar di bursa efek indonesai. pengaruh kepuasan konsumen terhadap kesetiaan merek produk pemutih wajah pond's white beauty analisis data yang digunakan dalam penelitian pengaruh ekuitas merek terhadap loyalitas pelanggan hanphone berbasis android merek samsung. pengaruh kinerja keuangan terhadap tingkat bagi hasil simpanan mudharabah bank syariah survei pada bri syariah cabang yogyakarta tahun 2003-2008 analisis data yang baik faktor-faktor yang mempengaruhi mahasiswa dalam pembelian laptop acer. pengaruh economic value added dan debt equity ratio terhadap harga pasar saham pada perusahaan manufaktur di bursa efek indonesia analisis data yuridis kualitatif kemampuan rasio leverage, likuiditas, profibilitas, produktivitas dan ukuran perusahaan dalam mempredeksi peringkat obilgasi (studi kasus pada industri non keuangan dan jasa yang terdaftar di bei) pengaruh ekspektasi kinerja, ekspektasi usaha dan faktor sosial terhadap minat pemanfaatan website (studi empiris pada ikm yang memiliki showrom di kasongan) analisis data yang tidak homogen pengaruh motivasi konsumen, persepsi konsumen dan sikap konsumen terhadap keputusan pembelian sepeda motor merek "honda". (sudi pada staf umy). pengaruh keadilan dalam penggajian terhadap kepuasan karyawan analisis data yang hilang pengaruh eva dan rasio-rasio profitabilitas terhadap harga saham. analisis faktor-faktor yang mempengaruhi nasabah menyimpan dana di baitul maal wat tamwil (bmt) kota yogyakarta analisis data ya dan tidak pengaruh tingkat suku bunga sbi, bond rating, ukuran perusahaan, der (debt to equity ratio) terhadap yield to maturity obligasi korporasi yang terdaftar di bursa efek indonesia. pengaruh kebijakan hutang, kebijakan dividen dan profitabilitas perusahaan terhadap set kesempatan investasi (ios) teknik analisis data yang digunakan analisis perbandngan kinerja keuangan pt. bank syariah mandiri dan pt muamalat indonesia dengan metode rgec (risk profil, good corporate governance, earning, capital) tahun 2012. pengaruh nilai saham, struktur modal, risiko pasar dan suku bunga terhadap return saham di bursa efek indonesia analisis data kekentalan zat cair analisis komparasi kepuasan konsumen dan pengaruhnya terhadap loyalitas konsumen pada produk hendphone branded dan non branded di yogyakarta. analisis variabel marketing mix yang mempengaruhi keputusan pembelian produk pemutih wajah pond's white beauty di diy analisis data uji zat makanan analisis kinerja harga saham setelah penawaran perdana pada bursa efek indonesia. pengaruh faktor-faktor keagenan dan faktor-faktor yang mempengaruhi biaya transaksi terhadap rasio pembayaran dividen analisis data koefisien pergeseran zat cair pengaruh gaya kepemimpinan transformasional terhadap kinerja karyawan yang dimediasi oleh komitmen organisasi analisis pengaruh consideration set dalam perspektif epistemik terhadap perilaku pencarian variasi : studi empirik pada pengguna telepon selular di umy analisis data panas jenis zat padat pengaruh keputusan investasi, keputusan pendanaan, dan kebijakan dividen terhadap nilai perusahaan faktor-faktor yang mempengaruhi underpricing pada penawaran umum perdana di bursa efek indonesia analisis data kalor jenis zat padat pengaruh total service quality manajemen terhadap kepuasan pelanggan analisis pengaruh kinerja keuangan dengan alat ukur eva (economic value added) dan roa (return on assets) terhadap return saham analisis data koefisien kekentalan zat cair pengaruh atribut produk terhadap sikap konsumen muda dalam menggunakan pemutih wajah pond's white beauty (studi pada mahasiswa muhammadiyah yogyakarta) analisis faktor-faktor yang mempengaruhi stock split dan pengaruhnya terhadap kinerja perusahaan analisis data percobaan koefisien pergeseran zat cair pengaruh right issue terhadap kinerja keuangan perusahaan manufaktur yang go public di bursa efek indonesia analisis faktor-faktor yang mempengaruhi minat pemanfaatan website otobursa tvri (the analysis of the factors that influence the utilized intention of otobursa tvri website analisis data 1 pengaruh citra merek terhadap loyalitas konsumen donuts & coffee di yogyakarta pengaruh rasa manfaat dan kemudahan terhadap minat berperilaku para mahasiswa umy dalam penggunaan digital library analisis data 1 variabel pengaruh sikap konsumen pada merek pionir dan merek pengikut terhadap keputusan pembelian (studi pada minuman isotonic pocari sweat dan mizone di yogyakarta) analisis persamaan simultan keputusan investasi, dividen dan utang serta faktor-faktor yang mempengaruhinya analisis data spss 16 analisis pengaruh tipe keterlibatan konsumen terhadap keputusan pembelian dengan kepercayaan merek sebagai variabel mediasi analisis pengumuman right issue terhadap reaksi pasar dan volume perdagangan saham di bursa efek indonesia pengertian analisis data 1 pengaruh kepercayaan merek terhadap loyalitas merek (studi kasus pada sepeda motor merek honda di universitas muhammadiyah yogyakarta) analisis persamaan simultan insider ownership, utang dan kebijakan dividen beserta faktor-faktor yang mempengaruhinya analisis data spss 17 pengaruh profitability dan investment opportunity set terhadap kebijakan dividen tunai dengan likuiditas sebagai variabel moderasi pengaruh kepuasan konsumen terhadap kesetiaan merek pada percetakan eria grafika analisis data untuk 1 variabel pengaruh ekuitas merek terhadap respon konsumen pada sepatu merek converse analisis pengaruh tingkat pertumbuhan, likwiditas, profitabilitas dan ukuran perusahaan terhadap kebijakan dividen. analisis data dengan spss 16 hubungan atribut iklan bersambung axis joni blak-blakkan dengan respon pemirsa televisi. (studi pada mahasiswa di daerah istimewa yogyakarta) analisis kecanggihan investor terhadap ketepatan reaksi pasar dalam merespon pengumuman dividen meningkat analisis data dengan spss 17 pengaruh emotional quotient, intelectual quotient, dan spiritual quotient terhadap kinerja karyawan pengaruh computer playfulness dan personal innovativeness terhadap cognitive absorption dalam intensi pengaplikasian e - business pada pemilik usaha kecil dan menengah (ukm) di yogyakarta analisis data dengan spss 18 analisis pengaruh kesadaran merek, asosiasi merek, dan persepsi kualitas terhadap keputusan pembelian smartphone blackberry (studi pada mahasiswa universitas muhammadiyah yogyakarta) analisis pengaruh lokasi terhadap kesuksesan bisnis swalayan di kabupaten sleman analisis data menggunakan spss 16 pengaruh kepemimpinan dan budaya organisasi terhadap kinerja karyawan yang dimediasi kepuasan kerja karyawan identifikasi daya tarik (attractiveness), kepercayaan (trustworthiness) dan keahlian (expertise) pada perilaku sosial fans slank analisis data 2 variabel analisis pengaruh self-efficacy terhadap kinerja individu yang dimediasi oleh penetapan tujuan analisis pengaruh kesesuaian citra diri terhadap kesukaan merek dan kepuasan konsumen pada produk laptop analisis data 2 pengaruh kebijakan deviden terhadap leverage dengan investment opportunity set (ios) dan provitabilitas sebagai variabel moderasi pada perusahaan manufaktur yang terdaftar di bursa efek indonesia (b analisis variabel-variabel yang mempengaruhi struktur keuangan dan pengaruh bersama beban bunga roa terhadap rentabilitas modal sendiri pada industri makanan dan minuman yang go publik di bei analisis data sdki 2007 pengaruh karakteristik selebriti endorser terhadap citra merek produk pengaruh faktor personal dan lingkungan terhadap keinginan berwirausaha (penelitian pada mahasiswa fakultas ekonomi program studi manajemen umy di yogyakarta) analisis data guru 2009 ditjen pmptk 2009 analisis faktor-faktor yang menimbulkan kecenderungan minat beli konsumen sepeda (studi perilaku konsumen sepeda pada smp muhammadiyah di yogyakarta) analisis faktor-faktor sosial yang berpengaruh terhadap adopsi inovasi usaha perikanan laut di desa pantai selatan kabupaten bantul, daerah istimewa yogyakarta analisis data spss 20 pengaruh pengendalian diri dan struktur penundaan terhadap keputusan penundaan konsumsi over reaksi pasar terhadap harga saham perbankan di bursa efek indonesia analisis data apbn 2013 analisis pengaruh atribut produk, atribut layanan dan atribut pembelian terhadap kepuasan konsumen waroeng steak and shake di kota yogyakarta pengaruh total service quality management terhadap kepuasan pelanggan bus ramayana the influence of total service quality management to customer satisfaction ramayana's bus analisis data apbn 2012 pengaruh atribut eksternal produk terhadap minat pembelian yang dimediasi oleh persepsi nilai analisis pengaruh motivasi kebutuhan terhadap kesuksesan usaha gerabah di kasongan yogyakarta analisis data apbn 2011 pengaruh kepuasan terhadap kesetiaan merek pada warung sop ayam pak min klaten (studi pada pelanggan warung sop ayam pak min klaten di yogyakarta) analisis kinerja keuangan berdasarkan pedoman penilaian tingkat kesehatan bank umum berdasarkan prinsip syariah (studi perbandingan bank muamalat dan bank syariah mandiri) analisis data apbn 2010 analisis pengaruh tingkat pertumbuhan, laverage operasi, profitabilitas, dan struktur aktiva terhadap struktur keuangan analysis of the influence of growth, operating leverage, profitability, and "pemanfaatan situs website pariwisata pemerintah daerah istimewa yogyakarta dalam optimasi promosi program visiting jogja yang berbasis e-tourism". analisis data deskriptif 2010 analisis pengaruh disclosure, roe, roa, eps, dan der terhadap cost of equity pada perusahaan manufaktur yang terdaftar di bursa efek indonesia pengaruh kepuasan konsumen terhadap kesetiaan merek (penelitian pada pt. jogja tugu trans yogyakarta) analisis data 3 variabel pengaruh kebijakan manajemen keuangan terhadap nilai perusahaan analisis faktor motivasi menjadi pengusaha pada pengusaha event organizer di yogyakarta analisis data bab 3 analisis pengaruh dividen payout ratio, tingkat suku bunga, rasio profitabilitas dan capital structure terhadap beta saham (studi pada saham syariah yang terdaftar di jakarta islamic index) ekuitas merek telepon seluler berdasarkan perspektif konsumen teknik analisis data 3 variabel analisis kebijakan dividen: suatu pengujian dividend signaling theory dan rent extraction hypothesis pengaruh persepsi dimensi kualitas layanan terhadap niat pembelian ulang (studi pada swalayan pamela 1 yogyakarta) analisis data dengan 3 variabel pengaruh modal sendiri, modal asing, dan dana pihak ketiga (dpk) terhadap pembiayaan pada perbankan syariah (studi kasus bank umum syariah di indonesia) peran atribut produk dalam keputusan pembelian pada mobil toyota avanza di pt sumber bahtera motor yogyakarta analisis data untuk 3 variabel pengaruh kepemimpinan transformasional terhadap kinerja karyawan yang dimediasi oleh pemberdayaan analisis perbedaan gender, pendapatan dan frekuensi pembelian terhadap perilaku pembelian impulsif analisis data kuantitatif 3 variabel pengaruh kompensasi terhadap kinerja karyawanyang dimediasi oleh kepuasan kerja karyawan analisis perbedaan penggunaan animasi pada iklan komersial di televisi berdasarkan kelompok acara, tipe program, kelas produk dan kategori produk teknik analisis data bab 3 pengaruh kepercayaan merek terhadap loyalitas merek maskapai penerbangan lion air (studi pada pelanggan lion air di yogyakarta) pengaruh pengetahuan tentang taktik pemasangan iklan, penghargaan diri, kerentanan konsumen, dan pengetahuan produk konsumen terhadap skeptisme remaja pada iklan televisi metode analisis data bab 3 pengaruh profitabilitas, likuiditas dan leverage terhadap kebijakan dividen pada industri manufaktur yang terdaftar di bursa efek indonesia (bei) analisis perilaku brand switching produk flashdisk di kotamadya yogyakarta contoh analisis data bab 3 analisis hubungan antara kebijakan utang, kebijakan dividen, dan profitabilitas dengan investment opportunity set (ios) pada perusahaan manufaktur di bursa efek indonesia (bei) evaluasi kelayakan usaha meubel jmg (jepara meubel group) di godean teknik analisis data untuk 3 variabel pengaruh laba akuntansi, komponen arus kas, dan total arus kas terhadap return saham pada perusahaan manufaktur yang terdaftar di bursa efek indonesia pengaruh manfaat dan kemudahan terhadap minat berperilaku dosen dalam memanfaatkan personal web analisis data bab 4 analisis tingkat kesehatan bank dengan menggunakan metode camels pada bank pemerintah dan bank umum swasta nasional pengaruh keterlibatan konsumen terhadap kepercayaan merek ( studi kasus pada kosmetik cream pemutih ) contoh analisis data bab 4 analisis metode camels dalam penilaian kesehatan bank syariah dan bank konvensional di indonesia yang belum go publik pengaruh total service quality management terhadap kepuasan pelanggan 4 analisis data analisis kualitas pelayanan apotek rawat jalan dan rawat inap di rsud kabupaten banyumas dampak size perusahaan terhadap kandungan informasi dan efek intra industri pengumuman stock split metode analisis data 5w1h pengaruh citra merek, nilai pelanggan, kualitas persepsian dan kepuasan pelanggan terhadap loyalitas konsumen pada jamu tolak angin sidomuncul di yogyakarta dampak size perusahaan terhadap kandungan informasi dan efek intra industri pengumkuman stock split analisis data panel dengan eviews 7 pengaruh faktor-faktor ekuitas merek handphone samsung galaxy (android) terhadap keputusan pembelian analisis pengaruh kebijakan dividen dan aliran kas bebas terhadap tingkat leverage dengan set kesempatan investasi sebagai moderasi pada perusahaan manufaktur di bursa efek jakarta data analisis faktor 8 variabel analisis faktor-faktor yang mempengaruhi tingkat pendapatan pedagang pasar tradisional di pasar beringharjo, kota yogyakarta analisis data iso 9001 analisis pengaruh aktiva, ukuran perusahaan, pertumbuhan penjualan, beban pajak dan laba ditahan terhadap struktur pendanaan dan pengaruh struktur pendanaan bersama return on asset (roa) terhadap rentabilitas modal sendiri pada sektor industri real estate dan property di bursa efek jakarta analisis pengaruh lokasi terhadap kesuksesan bisnis warung internet di yogyakarta aplikasi theory of planned behaviour dalam penelitian sikap-niat siswa-siswi man i yogyakarta untuk melanjutkan studi di universitas muhammadiyah yogyakarta pengaruh hari perdagangan terhadap return saham: pengujian monday effect, week-four effect, dan rogalski effect pada perusahaan lq45 yang listed di bursa efek jakarta (bej) analisis pengaruh rasio keuangan terhadap return awal perusahaan pasca initial public offering (ipo) di bursa efek jakarta (bej) analisis faktor-faktor yang mempengaruhi orientasi pasar pengembangan usaha kecil dan menengah (studi pada ukm di desa sinduadi) analisis perbedaan abnormal return dan volume perdagangan saham terhadap peristiwa sebelum dan sesudah stock split pada perusahaan go public di bursa efek jakarta periode 2000-2004 pengaruh citra produk, fitur produk dan accessibility terhadap loyalitas merk pada produk kartu sellular pengaruh iklan televisi terhadap pengambilan keputusan pembelian sepeda motor suzuki smash (studi pada konsumen di kabupaten temanggung) pengaruh karateristik individu (gender)terhadap hubungan antara komitmen organisasi dengan keinginan untuk pindah kerja pengaruh periklanan, ketidakpuasan konsumen, karakteristik kategori produk, dan kebutuhan mencari variasi terhadap keputusan perpindahan merek analisis sikap penolakan terhadap perubahan pada pegawai kantor pelayanan terpadu satu pintu (kptsp) kabupaten lampung selatan analisis kepuasan konsumen perumahan pesona bugisan yogyakarta dengan instrumen hombsat analisis elemen-elemen brand equity untuk menentukan kekuatan produk minuman ringan merek teh botol sosro (studi kasus pada mahasiswa universitas muhammadiyah yogyakarta) analisis efektifitas iklan televisi produk sabun mandi lifebuoy analisis pengaruh partisipasi pemakai terhadap kepuasan pemakai dalam pengembangan sistem informasi dengan tingkat pekerjaan sebagai variabel moderasi pengaruh kepuasan konsumen terhadap loyalitas pengguna implementasi relationship marketing pada industri perhotelan (studi kasus pada hotel luas indah pemalang) analisis faktor-faktor yang mempengaruhi stock split dan dampak yang ditimbulkannya analisis elemen brand equity produk sepeda motor metic mio analisis pengaruh earning per share (eps), return on equity (roe), return on invesment (roi), net profit margin (npm) terhadap harga saham pengaruh implementasi proses relationship marketing pada pt. sumber bahtera motor (studi empiris pada pt. sumber bahtera motor di yogyakarta) hubungan antara nilai perusahaan, underpricing, dan ownership retention pada perusahaan yang baru go public di bursa efek jakarta (2000-2005) pengaruh ekuitas merek terhadap loyalitas mahasiswa di universitas muhammadiyah yogyakarta analisis preferensi wisatawan terhadap obyek wisata: sebuah aplikasi conjoint analysis pengaruh hari libur nasional terhadap return saham di bursa efek indonesia tahun 2004-2008 analisis faktor-faktor yang mempengaruhi kepuasan konsumen di swalayan mega bumi yogyakarta pengaruh kualitas pelayanan dan kepuasan pelanggan dalam pembentukan intensi pembelian konsumen pada jasa layanan transportasi bus trans jogja analisis pengaruh kepemilikan institusional, resiko pasar dan kesempatan investasi terhadap kebijakan deviden pada perusahaan go public di bursa efek jakarta pengaruh satisfaction, habitual behavior, commitment dan liking of the brand terhadap loyalitas merek pada konsumen extra joss di yogyakarta pengaruh company reputation, sales persons characteristics dan sales persons relationship terhadap relationship quality (studi kasus kualitas hubungan dalam jssa penjualan asuransi jiwa pt. bumi asih jaya yogyakarta) evaluasi kinerja keuangan dengan menggunakan metode rasio camel pada perusahaan perbankan pra dan pasca initial public offering di bursa efek indonesia (bei) analisis dampak iklan teh botol sosro dalam proses pembelajaran konsumen analisis elemen-elemen brand equity pada produk handphone merek sony ericsson pengaruh faktor eksternal perilaku konsumen terhadap pengambilan keputusan pembelian shampo lifebuoy analisis perilaku pengguna sistem informasi dengan pendekatan technology acceptance model (tam) di fakultas ekonomi jurusan manajemen universitas muhammadiyah yogyakarta analisis pengaruh economic value added (eva), return on equity (roe), return on investment (roi), dan dividend per share (dps) terhadap harga saham pada perusahaan manufaktur yang tercatat di bursa efek jakarta (bej) analisis pengaruh faktor-faktor kompensasi finansial dan non finansial terhadap kinerja karyawan pada pt. antar penjuru indonesia di yogyakarta analisis pengaruh kualitas pelayanan terhadap kepuasan pelanggan pada warung internet intersat pengaruh financial leverage, investasi, liquidity, profitability, ukuran perusahaan dan variability of earnings terhadap dividend payout ratio analisis pengaruh gitra rumah sakit dan kepuasan terhadap loyalitas pelanggan pada rumah sakit islam banjarnegara pengaruh dimensi kualitas jasa terhadap loyalitas konsumen pada kartu pra bayar xl bebas analisis pengaruh struktur aktiva, tingkat pertumbuhan, profitabilitas, dan operating leverage terhadap struktur modal perusahaan yang termasuk dalam lq 45 segmentasi pasar produk sabun mandi merek lifebuoy di daerah kabupaten natuna analisis pengaruh kualitas layanan terhadap kepuasan anggota bmt arrohmah bandongan magelang peran sistem informasi e-learning dalam menciptakan keunggulan daya saing pada universitas muhammadiyah yogyakarta analisis penentuan portofolio saham optimal pada perusahaan yang terdaftar di bursa efek jakarta analisis kemampulabaan bisnis seluler di kecamatan kampar kabupaten kampar riau analisis pengaruh profitabilitas, leverage operasi, besaran perusahaan, operating profit margin, risiko terhadap praktik perataan laba pada industri manufaktur di bursa efek jakarta faktor-faktor yang mempengaruhi kesetiaan merek pada konsumen shampo clear pengaruh interaksi motivasi terhadap kerja dan kepribadian terhadap prestasi kerja karyawan di pabrik putra makmur abadi temanggung reaction of market publication corporate governance perception index in company which listed in jakarta stock exchange analisis pengaruh variabel makro terhadap beta saham pada perusahaan go public di bursa efek jakarta analisis pengaruh marketing mix terhadap minat beli konsumen pada meubel ud. sukron jaya jepara pengaruh antara kepuasan pelanggan dan kualitas jasa terhadap loyalitas pelanggan pada perusahaan rahayu travel pengaruh budaya organisasi, motivasi dan kepuasan kerja terhadap kinerja karyawan universitas muhammadiyah yogyakarta faktor-faktor yang mempengaruhi praktik perataan laba pada perusahaan manufaktur yang terdaftar di bursa efek jakarta analisis quality function deployment (qfd) pemanfaatan the voice of customer untuk menghasilkan kualitas jasa di koperasi kpri guru pedes, karawang, jabar pengaruh hari perdagangan saham terhadap return saham di bursa efek jakarta analisis elemen-elemen brand equity untuk menentukan kekuatan dan kelemahan produk pada produk kartu cellular cdma e-sia di yogyakarta analisis efektivitas iklan "molto" di yogyakarta dengan menggunakan consumer decision model analisis perbandingan tingkat kesehatan bank sebelum merger dan setelah merger pada pd.bpr bkk taman dengan menggunakan sistem camel modified analisis faktor-faktor yang mempengaruhi loyalitas konsumen pada air mineral aqua analisis leverage dan dividen dalam lingkungan ketidakpastian pendekatan pecking order theory pengaruh dividend per share, price earning ratio dan return on equity terhadap harga saham pada perusahaan manufaktur di bursa efek jakarta analisis faktor-faktor marketing mix yang menimbulkan minat konsumen sepatu futsal. (studi perilaku konsumen futsal di umy) analisis faktor-faktor yang mempengaruhi pertumbuhan modal sendiri pada perusahaan manufaktur di bursa efek jakarta analisis pembentukan disonansi kognitif konsumen pemilik motor yamaha mio di kota yogyakarta perbandingan underpricing penerbitan saham perdana perusahaan keuangan dan non-keuangan di bursa efek jakarta: pengujian hipotesis asimetri informasi pengaruh kepemimpinan demokratis, motivasi, dan kualitas komunikasi terhadap produktivitas kerja karyawan analisis faktor-faktor yang mempengaruhi status perusahaan pasca ipo dengan analisis multinomial logit analisis pengaruh kualitas pelayanan terhadap kepuasan pelanggan restoran ayam bakar wong solo yogyakarta analisis pengaruh biaya keagenan, risiko pasar dan kesempatan investasi terhadap kebiajakan dividen pada perusahaan manufaktur di bursa efek jakarta komitmen organisasi dosen ditinjau dari pendidikan dan jenis kelamin analisis optimasi percepatan durasi proyek pada pembangunan pelebaran kantor dprd lampung timur dengan metode least cost analysis analisis pengaruh biaya keagenan, risiko pasar dan kesempatan investasi terhadap kebijakan deviden pada perusahaan manufaktur di bursa efek indonesia analisis kualitas pelayanan parkir kendaraan roda dua di depan gedung fai umy faktor-faktor marketing mix yang di pertimbangkan nasabah dalam melakukan transaksi pada bank syari'ah di yogyakarta analisis faktor-faktor yang mempengaruhi struktur pendanaan analisis relationship marketing pada upscale retailing (studi pada waspada tailor yogyakarta) analisis pengendalian kebutuhan bahan baku dengan metode material requirement planning (mrp) pada sain's craft wiswa gebang di yogyakarta pengaruh kepuasan konsumen terhadap kesetiaan merek pada rumah makan soto kadipiro di yogyakarta struktur organisasi sebagai variabel moderator pada pengaruh penyususnan anggaran partisipatif terhadap kinerja manajerial (studi pada universitas muahammadiyah yogyakarta) analisis persepsi konsumen ramayana department store jalan malioboro yogyakarta theory of planned behavior dalam penelitian sikap-niat siswa-siswi sma muhammadiyah 2 yogyakarta dalam memilih kuliah di universitas muhammadiyah yogyakarta analisis pengendalian kualitas produksi leather rectangular box w/lid & handle set of 4 cv. eny. n (leather dan natural handicraft) pengujian efisiensi pasar bentuk setengah kuat secara keputusan: analisis pengumuman dividen meningkat di bursa efek jakarta analisis faktor-faktor yang mempengaruhi kesetiaan merek pada konsumen pasta gigi close up pengaruh kepuasan pelanggan terhadap niat berperilaku konsumen di hotel brongto yogyakarta analisis kepuasan konsumen pembeli rumah perumahan griya palem hijau peran pemoderasian modal sosial terhadap hubungan antara motivasi dan kepemimpinan dengan kinerja individu (survey di badan kepegawaian daerah pemerintah kota yogyakarta) analisis faktor-faktor yang mempengaruhi kepuasan konsumen di swalayan braja cirebon analisis pengaruh marketing mix terhadap kesetiaan pelanggan di klub ade rai jogja analisis pengaruh gaya hidup sehat terhadap permintaan konsumen alat kebugaran di yogyakarta analisis faktor pembeda persepsi kualitas jasa layanan pendidikan perluasan tam (technology acceptance model) dan model ttf (task-technology fit) untuk mengukur penerimaan penggunaan internet (studi empiris pada mahasiswa fakultas ekonomi umy) analisis elemen-elemen brand equity untuk menentukan kekuatan dan kelemahan produk pada produk mie goreng merek sedaap analisis komparasi tingkat preferensi konsumen terhadap pemilihan kafe di kota yogyakarta analisis pengaruh biaya keagenan, risiko pasar dan kesempatan investasi terhadap kebijakan dividen pada perusahaan go public di bursa efek jakarta faktor-faktor yang memotivasi perwirausaha gerabah di kasongan analisis perbandingan kinerja reksa dana saham dengan kinerja pasar pengaruh kualitas pelayanan kesehatan terhadap kepuasan pasien rawat inap rsu banjarnegara citra produk pond's: pengaruhnya terhadap perilaku konsumen analisis pengaruh kualitas pelayanan dan kepuasan pelanggan terhadap intensi pembelian konsumen matahari mall di daerah istimewa yogyakarta perbandingan underpricing penerbitan saham perdana industri keuangan dan industri non-keuangan di bursa efek jakarta: pengujian hipotesis asimetri informasi analisis pemberian kredit investasi dan penyelesaian kredit bermasalah (studi kasus pada bank bpd diy) pengaruh ketidakpuasan konsumen, karakteristik kategori produk, dan kebutuhan mencari variasi terhadap keputusan perpindahan merek studi eksperimentasi reference price dan faktor yang berperan dalam keputusan konsumen tentang harga pada perguruan tinggi analisis pengaruh kualitas pelayanan terhadap kepuasan konsumen pada perusahaan penerbangan merpati nusantara di yogyakarta pengaruh perubahan nilai tukar rupiah terhadap return saham melalui perubahan arus kas dan perubahan earning per share (eps): bukti empiris pada perusahaan manufaktur yang terdaftar di bej analisis pengaruh budaya organisasi dan konflik peran terhadap kepuasan kerja pegawai pengaruh ukuran perusahaan, profitabilitas, leverage, dan tipe kepemilikan perusahaan terhadap luas voluntary disclosure laporan keuangan tahunan pada perusahaan manufaktur analisis pengaruh motivasi dan kepemimpinan terhadap kinerja karyawan kospin jasa pekalongan pengaruh pengetahuan tentang taktik pemasang iklan, penghargaan diri, kerentanan konsumen, dan pengetahuan produk konsumen pada skeptisme remaja terhadap iklan televisi analisis faktor-faktor (profitabilitas, leverage keuangan , prosentase saham yang dipegang oleh pemilik saham lama, ukuran perusahaan dan umur perusahaan) terhadap underpricing pada saat perusahaan melakukan initial publik offering (ipo) di bursa efek jakarta (bej) faktor-faktor yang mempengaruhi kelengkapan pengungkapan laporan keuangan pada perusahaan manufaktur yang terdaftar di bursa efek jakarta. reaksi harga dan volume perdagangan saham di bursa efek jakarta terhadap peristiwa tewasnya dr azahari di malang jawa timur 9 november 2005 perencanaan persediaan dan bahan baku dengan metode material requirement planning (mrp) pada pt. bintang kupu-kupu di tangerang reaksi pasar modal terhadap peristiwa pemilu legislatif 5 april 2004, dan pemilu presiden 5 juli 2004 : kajian terhadap return saham lq-45 di pt. bursa efek jakarta pengaruh manfaat dan kemudahan pada minat berperilaku mahasiswa umy menggunakan e-learning strategi bersaing pada perusahaan mebel pt. amalia surya cemerlang klaten analisis sistem pengendalian persediaan bahan baku dengan metode mrp pada isaha kerajinan variasi tas bapak haryadi di patangpuluhan yogyakarta. the analyze of control systek on material for producing stock with mrp methods on bag variation craft company " haryadi" in patangpluhan residence yogyaka reaksi harga dan volume perdagangan saham di bej terhadap peristiwa penandatanganan nota kesepahaman (mou) antara ri dan gam di helsinki finlandia 15 agustus 2005 pengaruh keterlibatan konsumen terhadap kepercayaan merk sepeda motor honda (study pada : pt. nusantara sakti yogyakarta, dealer resmi honda) pengaruh sikap manajemen menengah dalam penerapan total wuality managemen terhadap kinerja manajerial anteseden dan konsekuensi kepuasan konsumen terhadap produk pemutih wajah (pengujian model kognitif) antesedent and consistency consumer satisfaction about bleaching face product (cognitive examination mode) analisis pengaruh kecepatan pelayanan keramahan pelayanan dan fasilitas pelayan terdap kepusan konsumen analisis karakteristik bintang idola iklan (celebrity endorser) terhadap minat beli konsumen pada multi beli vitamin kuku bima ener-g1 (studi pada konsumen di kec. sleman yogyakaer) pengaruh citra dan kepuasan terhadap loyalitas pelanggan analisis elemen brand equity produk makanan cepat saji kfc analisis pengaruh pengumuman laba terhadap asimetri informasi pada perusahaan yang termasuk indeks lq-45 anteseden dan konsekuensi kepuasan konsumen terhadap produk pemutih wajah (pengujian model kognitif) analisis pengaruh periode pengumuman laba (price transaksi, varian dan depth)terhadap asimetri informasi pada perusahaan go public yang tercatat di bursa efek jakarta (bej) pengaruh kreativitas iklan terhadap keputusan pembelian konsumen pada kosmetik merek tje fuk pengaruh kondisi pasar, auditor, umur perusahaan dan ukuran perusahaan terhadap underpricing saham pada perusahaan go public di bursa efek jakarta respon strategik perguruan tinggi dalam menghadapi globalisasi dengan strategi bisnis, kematangan ti dan ukuran perguruan tinggi sebagai variabel anteseden pengujian perbedaan gender terhadap pengalaman organisasi, evaluasi kinerja dan hasil karir karyawan pada pt pos indonesia (persero) kantor pos yogyakarta 55000 pengaruh insider ownership, resiko pasar dan kebijakan hutang terhadap kebijakan dividen analisis hubungan kebijakan utang, kebijakan dividen, dan profitabilitas perubahaan terhadap set kesekpatan investasi (ios) pengaruh partisipasi dalam mentoring program dan dukungan organisasi untuk pengembangan karir terhadap kepuasan kerja analisis pengaruh kualitas pelayanan terhadap kepuasan konsumen pada counter million cell di ramai mall yogyakarta atribut produk yang dipertimbangkan dalam pembelian produk minyak rambut merek gatsby dan pengaruhnya pada kepuasan konsumen di wirobrajan yogyakarta. analisis size dan fungsi dengan kultur organizational perusahaan manufaktur di kota yogyakarta analisis pengaruh right issue terhadap return saham setelah cumdate pengaruh eksternal dalam pengambilan keputusan melanjutkan studi di perguruan tinggi swasta analisis reaksi pemegang saham terhadap pengumuman dividend cut dan dividend omission di bursa efek indonesia (bei) analisis model antrian untuk meningkatkan sistem pelayanan kepada penerima taspen pada pt pos magelang respons lingkungan berbelanja sebagai stimulus pembelian tidak terencana pada toko serba ada (toserba) pamela yogyakarta dampak stabilitas keamanan nasional terhadap kinerja keuangan perusahaan pariwisata dan perhotelan di indonesia pengaruh variabel keuangan terhadap return awal dan return 15 hari setelah ipo "the influence of financial variables on initial return and after 15 days after ipo" tingkat underpricing pada penawaran saham perdana serta faktor-faktor yang mempengaruhi di bursa efek jakarta (th.1999-2004) pengaruh kepuasan kerja dan komitmen organisasi terhadap organizational citizenship behavior (ocb) pada bpk yogyakarta faktor-faktor marketing mix yang dipertimbangkan mahasiswa dalam memilih perguruan tinggi swasta reaksi pasar berlebihan dan pengaruh ukuran perusahaan terhadap pembalikan harga saham di bursa efek jakarta. pengaruh citra dan kepuasan pelanggan terhadap loyalitas pelanggan bengkel resmi honda mlati motor sleman yogyakarta analisis minat beli konsumen trehadap produk sepeda motor bebek honda supra x 125 di kotamadya yogyakarta pengaruh exposure iklan, pengenalan merek, keyakinan konsumen dan sikap kkonsumen terhadap niat beli konsumen dengan menggunakan consumer deciiiiiiision model analisis pengumuman right issue terhadap reaksi pasar dan volume perdagangan saham di bursa efek indonesia pengaruh hari perdagangan terhadap return lq-45 di bursa efek jakarta pengaruh variabel akuntasi, variabel pasar dan arus kas operasi kuartalan terhadap bid-ask spread pada industri manufaktur di bursa efek jakarta analisis pengaruh kepemilikan manajerial earning share (eps) dan leverage, terhadap dividend payout ratio (dpr) pada perusahaan go public yang terdaftar di bursa efek jakarta pengrauh kompetensi sumber daya manusia terhadap kinerja karyawan bagian marketing di pt. sido muncul semarang analisis model antrian untuk meningkatkan sistem pelayanan pada bpd diy cabang sleman di jalan magelang km. 11 tridadi sleman yogyakarta pengaruh kompensasi dan lingkungan kerja terhadap produktifitas kerja karyawan pada pt. primissima analisis faktor-faktor yang mempengaruhi minat beli konsumen terhadap produk sepeda motor honda supra di kabupaten bantul yogyakarta pengaruh kepuasan konsumen terhadap kesetiaaan merek pada warung pempek ny kamto yogyakarta analisis kualitas pelayanan bengkel honda (ahass) terhadap image pengaruh kepuasan kerja dan komitmen organisasi terhadap turnover intention analisis perbedaan volume perdagangan saham perusahaan yang terdaftar di bursa efek jakarta sebelum dan sesudah publikasi laporan arus kas pengaruh gaya kepemimpinan transaksional dan gaya kepemimpinan transformasional terhadap organization citizenship behavior dengan psychological empowerment sebagai variabel moderasi atribut produk, bauran promosi serta implikasinya terhadap struktur keputusan pembelian kartu prabayar mentari pengaruh asset growth, debt to equity ratio, return on equity, dan earning per share terhadap beta saham pada perusahaan manufaktur di bursa efek jakarta periode 2003-2005 pengaruh faktor-faktor keagenan dan faktor-faktor yang mempengaruhi biaya transaksi terhadap rasio pembayaran dividen di bursa efek jakarta analisis positioning mie instant merek mie sedaap di yogyakarta faktor-faktor yang mempengaruhi praktik perataan laba pada perusahaan asing dan non asing di indonesia analisis the day of the week effect terhadap return saham di bursa efek jakarta analisis reaksi pasar terhadap pengumuman right issue di bursa efek jakarta pengaruh variabel keuangan terhadap initial return pada perusahaan yang melakukan initial public offering (ipo) di bursa efek jakarta kemampuan laba dan arus kas dalam memprediksi laba dan arus kas analisis rasio keuangan terhadap laba pada perusahaan manufaktur di bej analisis pengaruh citra dan kepuasan terhadap loyalitas pelanggan pada rumah sakit pku muhammadiyah sruweng di kabupaten kebumen analaisis pengaruh kualitas pelayanan terhadap kepuasan konsumen pada hotel santika di yogayakarta faktor-faktor yang mempengaruhi kepuasan pelanggan perusahaan daerah air minum (pdam) kabupaten wonosobo analisis faktor-faktor kepuasan konsumen pada produk nisan perusahaan candi luhur wonosari faktor-faktor yang mempengaruhi kepuasan pelanggan perusahaan daerah air air minum (pdam) kabupaten wonosobo analisis pengaruh kualitas pelayanan terhadap kepuasan dan loyalitas konsuemen pada po. ezri pekalongan analisis faktor-faktor yang mempengaruhi underpricing saham pada perusahaan go public di bursa efek jakarta analisis persepsi konsumen pada mobil merek honda "jazz" di daerah istimewa yogyakarta pengaruh arus kas operasi dan laba akutansi terhadap tingkat keuntungan dan likuiditas saham pada perusahaan manufaktur di bursa efek jakarta analisis market overraction pada saat initial public offering (ipo) di bursa efek jakarta periode 2000-2004 pengaruh kualitas jasa terhadap loyalitas konsumen pada "kirei"skin care analisis konsekuensi perilaku konsumen terhadap kualitas layanan pada hotel norobudur yogayakarta analisis pengaruh kualitas pelayanan terhadap kepuasan nasabah pada bmt natura di yogyakarta analisis optimalisasi proyek pembangunan perumahan griya tirtanirmala asri oleh pt. bumu kusuma santosa yogyakarta analisis iklim organisasi komitmen dan tingkat absensi karyawan pada universitas surryakancana cianjur analisis hombsat (home-buyer satisfaction) sebagai instrument pengukur kepuasan pembeli rumah di perumahan pesona merapai yogyakarta analisis pengaruh struktur aktiva, ukuran perusahaan, pertumbuhan penjualan, beban pajak dan laba ditahan terhadap struktur modal pada perusahaan manufaktur tyang terdaftar di bursa efek jakarta aplikasi quality function deployment pada pt. mitra indra sejahtera pengaruh eksternal dalam pengambilan keputusan pembelian sepeda motor yamaha jupiter-mx di kota yogyakarta analisis minat beli ulang konsumen terhadap produk sepeda motor bebek merek "honda" di kotamadya yogyakarta analisis keputusan pemecahan saham berdasarkan tingkat kemahalan harga saham dan kinerja keuangan perusahaan dengan analisis diskriminan pengaruh gaya kepemimpinan transformasional, budaya organisasi, dan konflik peran terhadap kepuasan kerja dan komitmen organisasi pengaruh motivasi spiritual terhadap kinerja religius studi pada universitas muhammadiyah yogyakarta analisis kesenjangan dimensi kualitas layanan berdasarkan persepsi manajemen dan persepsi penunggu pasien pada unit rawat inap di rumah sakit pku muhammadiyah yogyakarta pengaruh kepemilikan saham institusional dan kesempatan bertumbuh terhadap kebijakan diveden analisis pengaruh inovasi terhadap pengembangan produk baru pada perusahaan makanan dan minuman di jawa analisis segmentasi pasar produk rokok sampoerna a mild di yogyakarta analisis positioning sabun mandi kesehatan (lifebuoy, dettol, nuvo dan nedicare) berdasarkan persepsi konsumen di kota yogyakarta analisis tuntutan penggan dan kinerja marketing mix, terhadap nilai pelanggan jasa telekomunikasi cdma analisis elemen-elemen ekuitas merek pada produk minuman air mineral aqua pengaruh keterlibatan konsumen terhadap pemilihan produk lipstick revlon di yogyakarta analisis kandungan informasi stock split dan likuiditas saham analisis pengaruh beberapa faktor fundamental dan resiko sistematik terhadap harga saham pada industri manufaktur di bursa efek jakarta dampak faktor-faktor keagenan dan faktor-faktor yang mempengaruhi biaya transaksi terhadap rasio pembayaran dividen pengaruh citra operator selular dan kepuasan pelanggan terhadap loyalitas pelanggan telkomsel yogyakarta analisis moderasi set kesempatan investasi terhadap hubungan antara kebiajakan dividen dan aliran kas bebas dengan tingkat leverage perusahaan faktor-faktor yang mempengaruhi dividend payout ratio pada perusahaan perbankan yang terdaftar di bursa efek jakarta analisis pengawasan kualitas dalam hal keterlambatan dosen mengajar fakultas ekonomi di universitas muhammadiyah yogyakarta analisis pengaruh kepemilikan manajerial dan kepememilikan institusional terhadap kebijakan hutang pengaruh motivasi dan kepemimpinan pada kinerja individu (survey terhadap perusahaan bumn telkom jepara) dampak faktor-faktor keagenan dan faktor-faktor yang mempengaruhi biaya transaksi terhadap rasio pembayaran dividen pengaruh tingkat bagi hasil, suku bunga dan pendapatan terhadap simpanan peran keadilan distributif dan keadilan prosedural terhadap perilaku retaliasi di tempat kerja pengaruh kepuasan kerja dan motivasi kerja terhadap kinerja karyawan di badan pemeriksa keuangan daerah istimewa yogyakarta analisis hubungan antara gabungan proksi investment opportunity set dan real growth dengan menggunakan pendekatan confimatory factor analysis pengaruh pengumuman merger dan akuisisi terhadap abnormal return saham perusahaan akuisitor di bursa efek jakarta analisis pengaruh return on asset, financial leverage ukuran perusahaan dan persentase penawaran saham terhadap tingkat underpricing pada initial public offering di bursa efek jakarta faktor-faktor marketing mix yang dipertimbangkan pelanggan dalam memilih salon kecantikan analisis faktor-faktor yang mempengaruhi loyalitas merek pengaruh kualitas pelayanan terhadap tingkat kepuasan konsumen cv. citra adhi sahara yogyakarta dengan servqual instrument faktor-faktor yang mempengaruhi underpricing di bursa efek jakarta tahun 2000-2004 analisis minat konsumen untuk berbelanja kembali di ramai mall yogyakarta analisis pengaruh kesesuian citra diri terhadap kesukaan merek dan kepuasan analisis minat konsumen untuk berbelanja kembali di ramai mall yogyakarta pengaruh kualitas jasa pengiriman barang terhadap kepuasan pelanggan pada cv. surya cargo yogyakarta analisis sikap, norma subyektif dan perilaku masa lampau terhadap minat konsumen pada produk sony ericson minat konsumen dalam membeli produk berwawasan lingkungan 9green product) analisis minat beli konsumen terhadap pupuk phosfat pada ud alam perkasa di gunung kidul pengaruh efektifitas kepemimpinan terhadap kinerja karyawan di pt mondrian klaten analisis perubahan nilai tukar rupiah terhadap return saham melalui perubahan arus kas dan perubahan earning per share (eps) analisis stok split dan likuiditas saham analisis persepsi konsumen terhadap customer service pada pt bank jabar (persero) kantor cabang majalengka analisis beli kembali konsumen terhadap produk sepeda motor honda supra x125 di kotamadya yogyakarta analisis pengaruh iklan televisi terhadap pengambilan keputusan pembelian telepon seluler (studi pada konsumen di kecamatan sanden kabupaten bantul yogyakarta) analisis likuiditas saham dan kinerja keuangan perusahaan yang melakukan right issue di bursa efek jakarta analisis positioning produk tabungan perbankan di yogyakarta pengaruh perilaku karyawan terhadap partisipasi kerja karyawan pada kantor arsip daerah propinsi diy pengaruh karakteristik kategori produk, ketidakpuasan konsumen dan kebutuhan mencari variasi terhadap keputusan perpindahan merek analisis hubungan anatara investment opportuity set dengan kebijakan diveden dan kebijakan pendanaan pada perusahan-perusahaaan yang listing di bursa efek jakarta pengaruh insider ownership, free cash flow, collaterizable assets, kepemilikan institusional dan tingkat pertumbuhan terhadap kebijakan dividen analisis hubungan antara ivestment opportunity set dengan kebijakan diveden dan kebijakan pendanaan pada perusahan-perusahaan yang listing di bursa efek jakarta pengaruh budaya organisasi dan konflik terhadap kepuasan kerja karyawan rs pku muhammadiyah yogyakarta anlisis minat beli kembali konsumen terhadap produk sepeda motor honda supra x125 di kotamadya yogykarta pengaruh ketidakpuasan konsumen, karakteristik kategori produk, dan kebutuhan mencari variasi terhadap keputusan perpindahan merek pasta gigi pepsodent analisis segmentasi pada universitas muahammadiyah yogyakarta(umy) hubungan investment opportunity set (ios) terhadap kebijakan pendanaan, deviden dan realisasi pertumbuhan pada perusahaan manufaktur di bej analisis segementtasi pada universitas muhammadiyah yogyakarta (umy) analisis sistem antrian di bank bni cabang pembantu banjarnegara analisis faktor-faktor yang mempengaruhi keputusan pendanaan perusahaan pengujian pecking order hypotesis analisis faktor-faktor yang berpengaruh terhadap keputusan konsumen membeli jasa warnet di yogyakarta analisis kepuasan dan loyalitas konsumen oli meisn top 1 (one) terhadap keputusan perpindahan merk pengaruh kemasan dan materi poin pembelian (pop) terhadap keputusan pembelian parfum casabalnca di kamila swalayan analisis abnormal return dan risiko investasi atas pengumuman laba pada perusahaan perata laba dan bukan perata laba pengaruh perputaran piutang dan perputaran persediaan terhadap profitabilitas pada pt. sumber kreasi cipta logam di jakarta analisis pengaruh kebujakan deviden, kebijakan hutang dan profitabilitas perusahaan terhadap set kesempatan investasi pengaruh insider ownership, net organizational capital, collaterizable assets dan resiko pasar terhadap kebijakan dividen pengaruh kualitas komunikasi, kepemimpinan demokratis dan motivasi terhadap kinerja karyawan pada industri sandang nusantara unit patal secang analisis pengaruh kepemimpinan transaksional dan kepemimpinan kharismatik terhadap usaha ekstra bawahan pt. jepro meubel antik di jepara tingkat underpricing pada penawaran saham perdana di bursa efek jakarta dan faktor-faktor yang mempengaruhinya pengaruh pangsa pasar, rasio leverage, rasio intensitas modal dan modal kerja terhadap profitabilitas industri manufaktur di bej analisis kinerja keuangan sebelum dan sesudah right issue pada perusahaan manufaktur di bursa efek jakarta (bej) analisis motivasi kehadiran mahasiswa fakultas ekonomi universitas muhammadiyah yogyakarta (pendekatan teori pengharapan) pengaruh kompensasi terhadap kinerja karyawan pada pt cipta karya agung analisis pengaruh motivasi kerja dan iklim organisasi terhadap kepuasan kerja karyawan pada kantor dinas pendidikan nasional propinsi bengkulu penggunaan analisis cpm sebagai model peningkatan efisiensi proyek (studi kasus pada batik miranda yogyakarta) analisis pengaruh insider ownship, shareholder dispersion, free cash flow, collaterizable asset, institutional own ship, risiko perusahaan dan tingkat pertumbuhan terhadap kebijakan dividen di bursa efek jakarta pengaruh kompensasi terhadap kinerja karyawan pada pt cipta karya agung abadi transfer informasi intra industri dalam pengumuman dividen (stusi empiris pada sektor manufaktur di bej) pengaruh kepuasan kerja terhadap komitmen organisasional informasi terhadap kinerja sistem informasi (studi empirik terhadap mahasiswa/i fakultas ekonomi universitas muhammadiyah yogyakarta) pengaruh kompetisi dan motivasi terhadap kinerja pegawai pada dinas perindustrian dan perdagangan kota cirebon pengaruh kandungan informasi komponen laporan arus kas, laba kotor dan size perusahaan terhadap expected return saham analisis pengaruh citra perusahaan dan kepuasan pelanggan pada industri perbankan. analisis asosiasi merek motor "honda, yamaha dan suzuki" (studi empiris pada mahasiswa universitas muhammadiyah yogyakarta) analisis pengaruh faktor fundamental terhadap return saham. analisis pembeda faktor persepsi kualitas jasa pendidikan di fakultas kedokteran di universitas muhammadiyah yogyakarta pengaruh rasio keuangan terhadap initial return pada perusahaan yang melakukan initial public offering (ipo) di bursa efek jakarta. analisis minat beli konsumen terhadap sepeda motor yamaha mio di kodya yogyakarta analisis perbandingan perceived quality pada pelanggan maskapai peerbangan merpati nusantara airlines adam air dan lion air di kota yogyakarta. analisis faktor - faktor yang mempengaruhi kesetiaan konsumen pada merek pasta gigi close up (studi pada mahasiswa universitas muhammadiyah yogyakarta) pengaruh ketidak puasan konsumen, karakteristik kategori produk dan kebutuhan mencari variasi terhadap keputusan perpindahan merk analisis loyalitas pelanggan terhadap pasta gigi merk pepsodent (studi kasus kec. gamping, kab. sleman, daerah istimewa yogyakarta) pengaruh faktor-faktor eksternal dalam pengambilan keputusan pembelian ponsel nokia pengaruh ketidakpuasan konsumen, karakteristik kategori produk, dan kebutuhan mencari variasi terhadap keputusan perpindahan merek sabun mandi lifebouy analisis niat konsumen untuk berbelanja kembali diramai supermaket jl. a. yani 73 yogyakarta analisis pengaruh citra, kualitas persepsian, nilai dan kepuasan konsumen terhadap loyalitas konsumen pada rumah makan waralaba di yogyakarta analisis sumbe-sumber keunggulan bersaing bidang pemasaran perusahaan penerbit surat kabar harian umum nasional di indonesia analisis faktor - faktor yang mempengaruhi stock split dan dampak yang ditimbulkannya pada perusahaan go public yang terdaftar di bursa efek jakarta analisis pengaruh kualitas pelayanan terhadap kepuasan konsumen pada pemella tiga swalayan yogyakrta. pengaruh faktor - faktor keagenan dan faktor - faktor yang mempengaruhi biaya transaksi terhadap rasio pembayaran dividen analisis faktor-faktor yang mempengaruhi struktur modal pada industri manufaktur go public di bursa efek jakarta. pengaruh eps, dpr, roe, per, beta terhadap harga saham pada perusahaan manufaktur di bursa efek jakarta pengarug variabel-variabel religiusitas terhadap komitmen organisasi: studi pada karyawan rumah sakit muhammadiyah darulistiqomah kecamatan kaliungu, kabupaten kendal, jawa tengah. pengaruh karakteristik individu, karakteristik pekerjaan dan kinerja karyawan terhadap komitmen organisasi (studi pada hotel quality yogyakarta) analisis faktor-faktor yang mempengaruhi minat konsumen untuk berbelanja kembali di surya swalayan temanngung. analisis pengaruh bid-ask spread, market value dan risk of return saham terhadap holding period pada saham teraktif yang tercatat di bursa efek jakarta periode 2003 - 2005 analisis faktor-faktor yang mempengaruhi kepuasan pelanggan pt. pos indonesia (persero) di yogyakarta. analisis pengaruh kompensasi dan motivasi kerja terhadap kinerja karyawan di pt. pabrik gula dan spritus madukismo yogyakarta citra asuransi mobil, kepuasan dan loyalitas pelanggan studi pada asuransi garda oto yogyakarta. kepuasan pelanggan dan price acceptance (studi pada penumpang kereta api eksekutif lodaya malam di yogyakarta) analisis citra rumah sakit, kepuasan dan loyalitas pelanggan (studi pada rumah sakit ciremai cirebon. pengaruh ketidakpuasan konsumen, karakteristik kategori produk, pencarian pengecer dan kebutuhan mencari variasi terhadap keputusan perpindahan merek hand phone (studi kasus pada mahasiswa universitas muhammadiyah yogyakarta) segmen pasar produk shampo clear (studi empiris konsumen kota wonosobo). analisis faktor - faktor yang mempengaruhi kepuasan pelanggan pada produk kecantikan natasha (studi kasus pada mahasiswa universitas muhammadiyah yogyakarta) analisis faktor-faktor (harga saham, frekuensi perdagangngan saham, price to bokk value, prince earning ratio dan aearning per share) yang mempengaruhi stock split pada perusahaan sektor industri di indonesia. analisis segmentasi yang mendukung strategi pemasaran untuk transaksi bisnis di internet pada wilayah yogyakarta prersepsi pelanggan terhadap implementasi proses relationship marketing pada pt telkom yogyakarta pengaruh kebijakan dividen, profitabilitas, pertumbuhan penjualan, pertumbuhan total aktiva terhadap kebijakan pendanaan pada perusahaan manufaktur di bej (pendekatan pecking order theory hypothesis) pengaruh faktor - faktor keagenan dan faktor - faktor yang mempengaruhi biaya transaksi terhadap rasio pembayaran dividen di bursa efek jakarta analisis minat beli ulang konsumen terhadap produk sepeda motor honda vario di kotamadya magelang analisis faktor - faktor yang mempengaruhi bid-ask spread dengan model koreksi kesalahan pada perusahaan lq45 di bursa efek jakarta (bej) analisis pengaruh citra supermarket terhadap loyalitas konsumen pada pamela swalayan i yogyakarta pengaruh kepemilikan manajerial dan kepemilikan institusional terhadap kebijakan hutang perusahaan dalam perspektif teori keagenan pengaruh ciri pemimpin dan komitmen organisasi terhadap kepuasan kerja karyawan analisis faktor-faktor perilakuk konsumen yang berpengaruh terhadap keputusan membeli pada mini market circle di jalan parangtritis yogyakarta analisis pengaruh sikap dan norma subyektif terhadap minat beli konsumen kartu pra bayar mentari indosat (survey pada konsumen mentari indosat di kota yogyakarta) efek word of mouth terhadap sikap dan kemungkinan membeli pada produk dengan keterlibatan rendah di smk n 1 yogyakarta analisis elemen - elemen ekuitas merek produk rokok merek djarum black (survey terhadap masyarakat perokok di kota yogyakarta) pengaruh eksternal dalam pengambilan keputusan pembelian honda jazz di daerah istimewa yogyakarta pengaruh kepemimpinan transformasional dan kharismatik terhadap kinerja karyawan pada rumah sakit pku muhammadiyah yogyakarta analisis kinerja reksa dana syariah analisis hubungan gaya pengambilan keputusan konsumen dengan gaya pembelajaran individual di universitas muhammadiyah yogyakarta organizational citizenship behavior karyawan ditinjau dari persepsi kualitas interaksi atasan-bawahan, persepsi dukungan organisasional dan persepsi iklim organisasi di sekretariat daerah kota bengkulu analisis faktor - faktor perilaku konsumen yang berpengaruh terhadap keputusan membeli pada swalayan mirota godean analisis kepuasan dan loyalitas pelanggan c & o auto car wash yogyakarta analisis pengaruh citra dan kepuasan terhadap loyalitas pelanggan pada apotek medono pekalongan analisis pisitioning produk mobil mini mpv (studi : honda jazz, toyota yaris, suzuki swift, dan chevrolet aveo) berdasarkan persepsi konsumen di kota yogyakarta pengaruh kepuasan konsumen dan kualitas produk terhadap loyalitas merek dampak faktor - faktor keagenan dan faktor - faktor biaya transaksi terhadap rasio pembayaran dividen pada perusahaan go public di bursa efek jakarta pengujian stabilitas struktural pengaruh harga saham, return saham, varian return saham dan volume perdagangan saham terhadap bid-ask spread pra dan pasca pengumuman laporan keuangan pengaruh kreativitas iklan di media televisi terhadap loyalitas konsumen mie sedaap di universitas muhammadiyah yogyakarta analisis faktor pembeda persepsi kualitas jasa layanan pendidikan di fakultas ekonomi universitas muhammadiyah yogyakarta analisis pengaruh kualitas pelayanan terhadap kepuasan pelanggan pada reyssa salon dan spa (jl. poncowinatan 46 yogyakarta) analisis pengaruh kepemilikan institusional, resiko pasar dan kesempatan investasi terhadap kebijakan dividen pada perusahaan go public di bursa efek jakarta analisis pengaruh citra dan kepuasan pelanggan terhadap loyalitas pelanggan pada hotel seno yogyakarta analisis pengaruh bid - ask spread, market value dan risk of return terhadap holding period pada saham teraktif yang tercatat di bursa efek jakarta periode 2004 - 2005 analisis pengaruh produk dan pelayanan terhadap kepuasan konsumen (studi empiris pada kartu telepon seluler simpati di kota yogyakarta) pengaruh persepsi konsumen atas harga, kualitas dan ilai terhadap keputusan berbelanja di karita busana muslim pengaruh eksternal dalam pengambilan keputusan pembelian sepeda motor honda supra fit di kota purwokerto analisis pengaruh persepsi konsumen atas iklan, kualitas produk dan harga produk terhadap keputusan pembelian konsumen (studi kasus pada produk minuman merk "mizone") analisis pengaruh laba, arus kas dan interaksi laba dengan arus kas terhadap return saham (studi pada perusahaan manufaktur di bursa efek jakarta) pengaruh mutu pelayanan rumah sakit dan kepuasan konsumen terhadap kesetiaan pasien pada rumah sakit umum daerah banjarnegara profitabilitas, debt equity ratio (der) serta umur perusahaan terhadap harga saham pada perusahaan manufaktur yang terdaftar di bursa efek jakarta pengaruh harga saham volume perdagangan, volatilitas harga saham dan bid-ask spread perusahaan-perusahaan yang melakukan stock split pengaruh corporate governance dan kinerja perusahaan terhadap perataan laba pengaruh citra rumah sakit dan kepuasan terhadap loyalitas pelanggan pada rumah sakit umum daerah purworejo biaya transaksi terhadap rasio pembayaran dividen analisis pengaruh citra, nilai dan kepuasan terhadap loyalitas konsumen (studi empiris pada hotel sokanandi di banjarnegara) pengaruh hari perdagangan saham terhadap return indeks lq45 di bursa efek jakarta evaluasi proyek pembangunan rumah tinggal tahan gempa pada proyek penanggulangan kemiskinan di perkotaan (p2kp) yogyakarta analisis pengaruh kebijakan pendanaan, dividen dan profitabilitas perusahaan terhadap set kesempatan (ios) analisis pengaruh citra damai indah swalayan terhadap loyalitas konsumen di yogyakarta analisis day of the week effect terhadap return saham lq 45 di bursa efek jakarta analisis minat beli konsumen shampoo sunsilk dan dove di kabupaten bantul ditinjau dari pengaruh sikapnya setelah melihat iklan di televisi dan norma subyektif pengaruh kepuasan kompensasi terhadap komitmen organisasi pada karyawan bmt bina dhuafa beringharjo yogyakarta pengaruh faktor-faktor eksternal dalam mengambil keputusan pembelian sabun mandi nuvo (studi pada konsumen di kelurahan patang puluhan) analisis faktor-faktor bauran pemasaran yang mempengaruhi konsumen untuk berbelanja di pasar modern (studi empirik pada mal malioboro) analisis faktor-faktor mix yang mempengaruhi minat konsumen untuk bebrbelanja di supermarket alfa di yogyakarta analisis faktor-faktor yang mempengaruhi struktur modal pada industri manufaktur yang terdaftar di bursa efek jakarta analisis faktor-faktor marketing mix yang mempengaruhi minat konsumen untuk berbelanja di supermarket alfa yogyakarta pengaruh tingkat religiositas terhadap etos kerja karyawan pengujian rasio eltman untuk memprediksi kebangkrutan perusahaan perbankan analisis free cash flow dan kepemilikan manajerial terhadap kebijakan utang pada perusahaan publik di indonesia analisis kandungan informasi stock split, perbedaan beta dan perbedaan likuiditas saham di bursa efek jakarta periode januari 2002 - desember 2005 pengaruh economic value added (eva), return on equity (roe), return on asset (roa), net profit margin (npm), earning per share (eps), dividen per share (dps) terhadap return saham pada perusahaan manufaktur di bursa efek jakarta pengaruh ketidakpuasan konsumen dan pengetahuan produk terhadap keputusan beralih merek handphone (studi empiris pada mahasiswa universitas muhammadiyah yogyakarta)20000410161 pengaruh dimensi struktur terhadap efektivitas organisasi di upy analisis faktor-faktor yang mempengaruhi manajemen laba dalam initial public offerings (ipo) analisis optimalisasi pada proyek pembangunan rumah dinas wakil bupati kabupaten bangka tengah analisis kebijakan privatisasi dalam rangka peningkatan kinerja keuangan bumn analisis pengaruh bid-ask soread, market value, dan risk of return saham terhadap hoding period pada saham teraktif yang tercatat di bursa efek jakarta periode 2003-2004 analisis positioning produk dalam persaingan shampo clear (studi kasus pada mahasiswa fakultas ekonomi universitas muhammadiyah yogyakarta) analisis pengaruh deviden payout ratio, deviden per share, earning per share, return of assets, net profit margin terhadap harga saham pada perusahaan manufaktur di bursa efek jakarta analisis kinerja protofolio dengan model indeks sharp di bursa efek jakarta analisis kebangkrutan pada industri otomotif di bursa efek jakarta dengan menggunakan metode z-score altman periode 1999 - 2003 analisis niat konsumen untuk berbelanja kembali di swalayan hero jl.godean yogyakarta pengaruh motivasi spiritual karyawan terhadap kinerja religius pada karyawan rumah sakit daerah (rsd) dr. raden soedjati kabupaten grobogan analisis elemen-elemen brand equity yang mempengaruhi keputusan beli konsumen pada produk pasta gigi pepsodent di kecamatan danurejan pengaruh laba per lembar saham (eps) financial leverage, return on asset (roa), dan besaran perusahaan terhadap penentuan harga saham pada saat initial public offering di bursa efek jakarta pengaruh kepuasan kerja dan komitmen organisasional terhadap turnover intention pada rsia aisyiyah klaten analisis pengaruh citra dan kepuasan terhadap loyalitas nasabah bri syariah cabang yogyakarta pengaruh right issue terhadap kinerja keuangan perusahaan manufaktur di bursa efek jakarta pengaruh variabel - variabel keuangan dan non keuangan terhadap initial return pada perusahaan yang listing di bursa efek jakarta pengaruh risiko sistematis dan likuiditas saham diukur dengan bid-ask spread terhadap tingkat pengembalian saham badan-bahan usaha yang go-public di bursa efek jakarta pada periode januari-juni 2005 analisis pengaruh citra rsud dr soesilo slawi kabupaten tegal terhadap loyalitas pelanggan analisis pengaruh current ratio, asset size dan earnings variability terhadap beta pasar tahun 2004 pengaruh laporan kauangan terhadap peringkat hutang (bond rating) (studi empiris pada perusahaan di bursa efek jakarta) analisis segmentasi pasar produk shampoo sunsilk analisis pengaruh kualitas pelayanan terhadap kepuasan konsumen di stasiun kereta api cirebon pengaruh manajemen laba (earning management) terhadap kinerja operasi dan return saham di sekitar ipo analisis minat konsumen menggunakan kartu simpati dari telkomsel analisis faktor-faktor yang mempengaruhi struktur modal (studi di bursa efek jakarta tahun 1999-2004) analisis faktor - faktor yang mempengaruhi minat beli konsumen sarung (studi perilaku konsumen sarung di kabupaten kulonprogo) analisis kualitas kehadiran kuliah mahasiswa fakultas ekonomi universitas muhammadiyah yogyakarta analisis faktor-faktor yang mempengaruhi keputusan pendanaan perusahaan manufaktur aplikasi theory of planned behaviour (tpb) dalam pengujian sikap-niat siswa-siswi smu muhammadiyah 1 yogyakarta untuk masuk kuliah di umy pengaruh rasio keuangan dalam memprediksi pertumbuhan laba dimasa yang akan datang pada perusahaan manufaktur di bursa efek jakarta profil dan motivasi enterpreneur wanita di yogyakarta analisis perbedaan kinerja keuangan sebelum dan sesudah right issue pada perusahaan manufaktur di bej over reaksi pasar terhadap harga saham perusahaan manufaktur di bursa efek jakarta analisis faktor-faktor yang mempengaruhi loyalitas konsumen pada rokok merek sampoerna a mild kandungan informasi dan keakurasian respon investor atas pengumuman dividen pengukuran tingkat kepuasan mahasiswa terhadap kualitas pelayanan pusat pelatihan bahasa (ppb) universitas muhammadiyah yogyakarta analisis pengaruh persepsi kualitas, pengetahuan merek dan loyalitas merek terhadap brand equity (studi kasus pada bri syariah cabang yogyakarta) strategi bersaing pada perusahaan otobis raharja yogyakarta pengaruh variabel-variabel keuangan dan signaling terhadap penentuan harga pasar saham setelah penawaran umum perdana faktor - faktor yang mempengaruhi kualitas pelayanan kesehatan terhadap kepuasan pasien pada rsd panembahan senopati bantul yogyakarta penerapan six sigma dalam pengendalian kualitas produksi pada perusahaan gula madukismo analisis sikap konsumen sepeda motor yamaha jupiter mx 135 lc di kabupaten banjarnegara analisis niat konsumen untuk berbelanja kembali di swalayan hero jl. godean yogyakarta analisis niat konsumen untuk berbelanja kembali di mal galeria yogyakarta analisis pengaruh hari perdagangan terhadap return saham: pengujian week four effect dan rogalsky effect di bursa efek jakarta analisis strategi bersaing pada perusahaan hanggar billiard yogyakarta pengaruh struktur kepemilikan terhadap kebijakan hutang dalam mengontrol konflik keagenan citra rumah sakit, kepuasan dan loyalitas pelanggan (studi pada rumah sakit umum muntilan) analisis pengaruh faktor-faktor marketing mix terhadap keputusan mahasiswa untuk menjadi nasabah bank bni 46 analisis pengaruh citra dan pelayanan terhadap loyalitas konsumen pada balai pengobatan / rumah bersalin dan kesehatan ibu dan anak "harapan insani" moyudan sleman pengaruh citra warnet dan kepuasan terhadap loyalitas pelanggan strategi bersaing pada perusahaan kaos "in" t-shirt di yoghyakarta pengaruh kepemilikan saham institusional dan investment opportunity set terhadap kebijakan deviden pengaruh variabel keuangan dan non-keuangan terhadap initial return dan return 7 hari setelah ipo pengaruh leverage terhadap risiko sistematik saham pada industri manufaktur di bursa efek jakarta analisis pengaruh iklan televisi terhadap pengambilan keputusan pembelian sepeda motor (studi pada konsumen di kecamatan kalasan, kabupaten sleman, yogyakarta) aplikasi konsep quality function deployment di rumah sakit umum r.a. kartini jepara pengaruh ketidakpuasan konsumen, karakteristik kategori produk dan kebutuhan mencari variasi terhadap keputusan perpindahan merek detergen analisis reaksi pasar atas pengumuman informasi laba (studi komparasi antara perusahaan yang melakukan perataan laba dan perusahaan yang tidak melakukan perataan laba) reaksi pasar modal indonesia terhadap peristiwa peledakan bom kuningan 9 september 2004 (studi empiris return saham pada lq_45) analisis pengaruh konsep konvensional dan konsep value based terhadap harga saham pada industri manufaktur di bursa efek jakarta pengaruh kinerja keuangan perusahaan terhadap return saham studi pada perusahaan food and bavarages di bursa efek jakarta periode 1999-2003 analisis faktor-faktor yang mempengaruhi keputusan membeli di gardena dan supermarket strategi bisnis rumah sakit islam hidayatullah yogyakarta strategi diferensiasi produk dan pengaruhnya terhadap image konsumen pada air minum aqua pengaruh nilai tukar rupiah, tingkat suku bunga (sbi) dan indeks dow jones di new york stock exchange terhadap indeks harga saham gabungan di bej analisis strategi marketing mix pada toserba laris di klaten pengaruh stock split terhadap harga saham, volume perdagangan dan persentase spread reaksi harga dan volume perdagangan saham di bursa efek jakarta terhadap perubahan kepemimpinan nasional reaksi harga dan volume perdagangan saham di bursa efek jakarta terhadap pilihan presiden 20 september 2004 (studi empiris pada perusahaan lq-45) analisis kinerja keuangan perusahaan dan menghitung bonus manajemen dengan menggunakan metode eva di pt. ramayana lestari sentosa analisis percepatan proyek dengan metode cpm pada pembangunan rumah tinggal di perumahan griya wates asri analisis kualitas pelayanan dan implementasi konsep quality function deployment di universitas muhammadiyah yogyakarta pengaruh pola pendidikan, pola pelatihan, pengorganisasian pendidikan dan pelatihan terhadap kualitas sumber daya manusia pada kantor dinas kesehatan kabupaten purworejo pengujian efisiensi pasar bentuk setengah kuat secara keputusan akibat pengumuman dividen meningkat di bursa efek jakarta tahun 2002 perbedaan pengaruh pengumuman dividen terhadap abnormal return saham dan volume perdagangan saham di bursa efek jakarta pengaruh pengaruh persepsi kualitas, pengetahuan merek dan loyalitas merek terhadap keputusan perpindahan merek handphone (studi kasus pada mahasiswa jurusan manajemen fakultas ekonomi universitas muhammadiyah yogyakarta) analisis sikap konsumen terhadap sepeda motor suzuki smash di kabupaten gunungkidul yogyakarta hubungan antara risiko dan tingkat keuntungan di bursa efek jakarta dengan model pasar analisis pembentukan portofolio saham optimal di bursa efek jakarta (studi komparatif penggunaan model indek tunggal dan model random pada saham-saham indek lq 45 pada tahun 2004) pengaruh ketidakpuasan konsumen, karakteristik produk dan kebutuhan mencari variasi terhadap keputusan perpindahan merek pada produk lotion analisis pengaruh citra selebriti periklanan terhadap citra produk yang diiklankan (studi kasus putri patricia dan tama blezynski, untuk periklanan produk kosmetik viva) analisis perbandingan kinerja porto folio dengan menggunakan model indeks sharpe analisis kandungan informasi stock split dan likuiditas saham pada perusahaan yang go public di bej analisis pengaruh kualitas layanan terhadap kepuasan pelanggan pada suzuki indojaya dongkelan yogyakarta analisis hubungan antara arus kas dengan return saham pada perusahaan manufaktur di bursa efek jakarta (studi empiris pada bursa efek jakarta) pengaruh religiositas terhadap personality study kasus karyawan pt. taspen (persero) daerah istimewa yogyakarta pengaruh budaya organisasi dan religiusitas terhadap komitmen organisasi (studi kasus pada karyawan non edukatif universitas muhammadiyah yogyakarta) pengaruh earning per share, debt to equity ratio, deviden per share dan return on equity terhadap harga saham pada perusahaan manufacturing di bursa efek jakarta analisis dampak iklan televisi dalam proses pembelajaran konsumen (studi kasus indomie rasa pecel) analisis positioning pada produk kartu pra bayar telepon seluler (simpati, mentari, pro xl, im3) berdasarkan persepsi konsumen di kota yogyakarta pengaruh bom kuningan terhadap harga dan volume perdagangan saham di bursa efek jakarta analisis pengaruh pengumuman right issue terhadap abnormal return dan aktivitas volume perdagangan saham di bursa efek jakarta analisis break aven point sebagai alat perencanaan laba pada perusahaan pt. kusumatex yogyakarta analisis pengaruh konflik peran, stres kerja terhadap kinerja karyawan pt. ja wetie di jeruk legi - cilacap citra supermarket: pengaruhnya terhadap perilaku konsumen faktor-faktor yang berpengaruh terhadap perataan laba pada perusahaan sektor keuangan di bej evaluasi kualitas pelayanan (perspektif gender) pada warnet intersat di yogyakarta analisis aplikasi quality function deployment (qfd) pada hotel bugisan yogyakarta analisis kepuasan kerja, konflik peran, komitmen organisasional dan keinginan untuk pindah kerja pada pt. indocement tunggal prakarsa, tbk cirebon analisis pengaruh kualitas pelayanan terhadap kecenderungan perilaku (studi kasus pada bengkel resmi honda jawa motor di kebumen) pengaruh komitmen organisasi terhadap kepuasan kerja dan keinginan karywan untuk berpindah (studi empiris pada staf pengajar universitas muhammadiyah yogyakarta) pengaruh ketidakpuasan konsumen, karakteristik kategori produk dan kebutuhan mencari variasi terhadap keputusan perpindahan merek (studi kasus pada produk shampo) analisis loyalitas konsumen terhadap kartu selular simpati (studi kasus pada mahasiswa fakultas ekonomi umy) analisis konsep quality function deployment (qfd) pada universitas janabadra yogyakarta analisis pengaruh pengumuman right issue terhadap abnormal return saham di bursa efek jakarta identifikasi faktor-faktor yang dipertimbangkan mahasiswa dalam memilih fakultas ekonomi universitas muhammadiyah yogyakarta kinerja saham sebelum dan sesudah right issue: refleksi sikap oportunistik manajemen analisis pengaruh kualitas pelayanan terhadap kepuasan pelanggan di unit pemeliharaan sentral yamaha ii yogyakarta analisis sikap konsumen terhadap produk pencuci piring cair merek sunlight di kotamadya yogyakarta analisis kepuasan konsumen perumahan taman kuantan di yogyakarta analisis strategi bersaing pada perusahaan jasa quality hotel yogyakarta analisis reaksi pasar terhadap pengumuman dividen yang menurun di bursa efek jakarta analisis pengaruh citra supermarket terhadap loyalitas konsumen di matahari department store klaten kandungan informasi pelaporan kerugian dan hubungannya dengan pergerakan return saham analisis perbedaan kinerja keuangan, likuiditas perdagangan saham, commulative abnormal return sebelum dan sesudah stock split di bursa efek jakarta analisis rasio keuangan untuk menilai kebangkrutan perusahaan food and baverage di bursa efek jakarta dengan hasil penelitian diskriminan altman analisis pengaruh kualitas jasa terhadap kepuasan pelanggan pada hotel sahid raya yogyakarta analisis pengaruh kinerja atribut produk terhadap kepuasan konsumen sepeda motor merk "yamaha" di kabupaten banjarnegara analisis kepuasan pelanggan pada perusahaan jasa travel grage transport di yogyakarta pengaruh persepsi kualitas pelayanan, kepuasan, konsumen dan intensitas pembelian analisis dampak faktor-faktor keagenan dan faktor-faktor yang mempengaruhi biaya transaksi terhadap rasio pembayaran dividen analisis pengaruh prosentase saham yang ditawarkan ke publik, ukuran perusahaan, umur perusahaan, solvability ratio, profitabilitas perusahaan, dan leverage keuangan terhadap underpricing penawaran perdana(ipo) yang listing di bursa efek jakarta periode 2000-2003 analisis pengaruh stres kerja, konflik, dan dukungan sosial terhadap kepuasan kerja guru sekolah dasar negeri kecamatan imogiri fenomena the day of the week effect dan january effect di bursa efek jakarta analisis segmentasi pasar produk pasta gigi pepsodent (studi pada mahasiswa fakultas ekonomi universitas muhammadiyah yogyakarta) analisis sikap terhadap keputusan beli dan kepuasan konsumen pada bauran pemasaran di dm mini market bantul yogyakarta analisis pengaruh kualitas pelayanan terhadap kepuasan pelanggan pada restaurant ayam goreng suharti di jl. laksda adisucipto yogyakarta pengaruh pengumuman merger dan akuisisi terhadap return saham perusahaan bidder di bursa efek jakarta analisis sistem antrian untuk meningkatkan sistem pelayanan pada bank rakyat indonesia unit piyungan di jalan yogya-wonosari km.14 piyungan bantul yogyakarta analisis kepuasan konsumen dengan metode hombsat pada perumahan pelem sewu baru yogyakarta analisis strategi bersaing pada perusahaan properti pt. intantunggal kharisma yogyakarta analisis pengaruh struktur kepemilikan terhadap agency costs pada perusahaan manufaktur di bursa efek jakarta analisis pengaruh kualitas pelayanan terhadap kepuasan nasabah pada central asia, tbk. kantor cabang utama purwodadi analisis kepuasan konsumen pada perusahaan parangtritis (grahayasa i) yogyakarta analisa karakteristik sumber daya manusia yang dibutuhkan lembaga keuangan mikro bmt analisis pengaruh leverage operasi dan leverage finansial terhadap risiko sistematik saham pada perusahaan manufaktur di bursa efek jakarta analisis perbedaan abnormal return dan volume perdagangan saham terhadap peristiwa sebelum dan sesudah stock split pada perusahaan go public di bursa efek jakarta pengaruh resiko sistematis dan likuiditas terhadap tingkat pengembalian saham badan-badan usaha yang go-public di bursa efek jakarta pada periode februari-juli tahun 2004 analisis abnormal return dan volume perdagangan saham, studi pengumuman right issue di bursa efek jakarta periode 2001-2003 pengaruh return dan volume perdagangan terhadap bid-ask spread saham pada perusahaan telekomunikasi di bursa efek jakarta pengaruh citra pamella swalayan i terhadap perilaku konsumen di yogyakarta analisis pengawasan kualitas produk pada sanggar kerajinan batu linang sayang di magelang analisis pengaruh kandungan informasi stock split terhadap abnormal return pada perusahaan go public di bej analisis faktor-faktor perilaku konsumen internal yang berpengaruh terhadap keputusan membeli pada swalayan menara di yogyakarta analisis pengaruh kualitas jasa terhadap kepuasan anggota pada bmt natura yogyakarta analisis pengaruh citra supermarket terhadap loyalitas konsumen pada pamella iv swalayan di yogyakarta analisis pengaruh core quality, relational quality dan perceived value terhadap customer satisfaction pada salon jhonny yogyakarta analisis optimasi percepatan durasi proyek pada pembangunan sd model kabupaten kuningan dengan metode least cost analysis reaksi harga dan volume perdagangan saham di bursa efek jakarta terhadap pemilu legislatif 5 april 2004 pengaruh role conflict, locus of control dan perubahan organisasi terhadap job insecurity pada karyawan pt. para multi finance yogyakarta aplikasi konsep quality function deployment (qfd) pada persewaan wk grup di yogyakarta analisis kepuasan pembeli rumah dengan metode hombsat (home buyer satisfaction) pada perumahan nandan griya idaman yogyakarta analisis perbandingan kinerja reksa dana saham dengan kinerja pasar (periode oktober 2003-september 2004) analisis pengumuman right issue terhadap perubahan harga saham dan volume perdagangan saham di bursa efek jakarta analisis pengaruh citra fakultas ekonomi universitas muhammadiyah yogyakarta terhadap loyalitas konsumen analisis persepsi konsumen pada produk pesawat televisi di yogyakarta pengaruh stabilitasi penjualan, roa, struktur aktiva, besaran perusahaan, dan dol terhadap struktur modal pada perusahaan manufaktur di bursa efek jakarta analisis sikap konsumen terhadap sepeda motor suzuki shogun (studi kasus si dealer suzuki indojaya dongkelan, bantul) analisis perbandingan citra lembaga pendidikan bahasa inggris di yogyakarta analisis pengaruh kualitas pelayanan terhadap kepuasan konsumen rumah sakit islam wonosobo analisis faktor-faktor yang mempengaruhi keputusan pendanaan perusahaan:pengujian packing order hypotesis aplikasi quality function deployment pada ahass tri karya sakti di yogyakarta analisis kredit bpr-bkk pada usaha kecil di kecamatan jatibarang kabupaten brebes tahun 2002-2004 analisa loyalitas konsumen terhadap operator telepon seluler di pacitan analisis strategi bersaing pada perusahaan meubel, cv, anugerah alam jepara analisis pengaruh rasio keuangan terhadap beta saham perusahaan manufaktur yang tercatat di bursa efek jakarta (bej) pengaruh interaksi motivasi kerja dan kepribadian terhadap prestasi kerja perawat di rsud wates yogyakarta analisis kualitas pelayanan terhadap kepuasan pelanggan pada perusahaan ritel hero supermarket tbk godean di yogyakarta hubungan kualitas pelayanan dengan tingkat kepuasan pelanggan sepeda motor honda pada bengkel ahass surya mataram analisis pengaruh kualitas pelayanan terhadap kecenderungan berperilaku pada jasa bank analisis pengaruh earning per share (eps), price earning ratio (per), debt to equity ratio (der)dan return on equity (roe) terhadap harga saham pada perusahaan manufaktur yang terdaftar di bursa efek jakarta analisis kualitas pelayanan terhadap kepuasan nasabah pada pd bpr bank pasar kabupaten bantul pengaruh motivasi kerja dan budaya kerja terhadap kinerja karyawan rumah sakit umum daerah wates kulon progo analisis posisi produk sabun detergen merk rinso, soklin, attack dan daia menurut presepsi konsumen di yogyakarta analisis fktor-faktor yang mempengaruhi kepuasan konsumen di swalayan jodo purworejo pengatuh relationship marketing terhadap kepuasan pelanggan pada rumah sakit islam surabaya reaksi pasar modal indonesia terhadap peristiwa politik dalam negeri pengaruh komunikasi dari ulut ke mulut terhadap sikap pembelian produk ponsel nokia pengaruh pengumuman dividen tunai naik dan dividen tunai turun terhadap abnormal return saham di bursa efek jakarta analisis faktor-faktor yang mempengaruhi dividen pada perusahaan manufaktur yang terdaftar di bej analisis hubungan investmen opportunity set dengan kebijakan pendanaan dan kebijakan dividen pada industri manufaktur dan asuransi di bursa effk jakarta analisis citra supermarket dan loyalitas konsumen di yogyakarta analisis sikap mahasiswa terhadap kualitas pelayanan di fakultas ekonomi unversitas muhammadiyah yogyakarta analisis perbandingan return antara portofolio model indeks tunggal dan random analisis informasi keuangan untuk memprediksi perubahan laba pada perusahaan go public yang terdaftar di bursa efek jakarta analisis abnormal return saham perusahaan bidder dengan adanya pengumuman baik sebelum maupun sesudah marger dan akuisisi di bursa efek jakarta penggunaan analisis cpm sebagai model peningkatan efisiensi proyek faktor-faktor marketing mix yang dipertimbangkan nasabah dalam menggunakan fasilitas atm di pt bank negara indonesia(persero)tbk analisis sikap konsumen terhadap toko swalayan di kecamatan mantrijeron yogyakarta pengaruh pelayanan, lokasi harga, dan fasilitas terhadap kepuasan konsumen dalam melakukan pengobatan di rumah sakit umum tidar magelang faktor-faktor yang menpengaruhi kepuasan konsumen pada rumah sakit kharisma paramedika di kulon progo reaksi modal terhadap kebijakan pemerintah tentang kenaikan harga bahan bakar minyak 1 maret 2005 analisis pengendalian bahan baku dengan metode mrp (manajerial requirement planing)pada cv.arica jati furniture di yogyakarta analisis positioning produk handphone berdasarkan perspektif mahasiswa universitas muhammadiyah yogyakarta analisis faktor-faktor yang mempengaruhi keputusan beli konsumen di texas chicken yogyakarta analisis reaksi pasar modal indonesia terhadap peristiwa politik dalam negeri perbedaan pengaruh kelompok referensi terhadap pembelian sepeda motor merek suzuki di yogyakarta pemanfaatan suara pelanggan (the voice of customer) dengan metode quality function deployment untuk menghasilkan jasa analisis pengaruh kualitas jasa terhadap kepuasan pada perguruan tinggi swasta analisis pengaruh program relationship marketing melalui membercard terhadap loyalitas pelanggan pada matahari department storev yogyakarta analisi faktor presentasi saham yang memiliki pemegang saham lama (present), return on asset (roa) financial leverage (lev) dan price earing ratio (per) terhadap tingkat underprincing di bursa efek jakarta analisis sikap dan perilaku konsumen terhadap produk ponsel nokia di kodya yogyakarta image pasar swalayan dan pengaruhnya terhadap pembelian produk convenience di yogyakarta analisis pengaruh variabel fundamental terhadap harga saham pada industri manufaktur di bej dengan periode penelitian 2001-2003 penerapan konsep quality function deployment hotel yudistira pekalongan analisis pengaruh kualitas pelayanan terhadap kepuasan konsumen pada rumah sakit umum pku muhammadiyah bantul analisis implementasi peran sumber daya manusia sebagai mitra strategik, ahli administratif, pejuang pekerja dan agen perubahan :( studi pada perguruan tinggi di yogyakarta) analisis konsumen dalam berbelanja kembali di supermarket dedy jaya plasa ketanggungan brebes pengaruh nilai tukar rupiah terhadap dolar amerika dan indeks dow jones di yewyork stock exchange pada indeks harga saham gabungan penggunaan analisis critical path method(cpm) pada proyek pembangunan perumahan oleh pt.bumi kusuma santosa yogyakarta. analisis pegaruh pengumuman right issue terhadap perubahan harga saham di bej periode tahun 1997-2004. analisis faktor-faktor yang mempengaruhi struktur modal pada perusahaan manufaktur sektor industri otomotif dan suku cadangnya yang telah go public di bej. analisis positioning kartu gsm (global system for mobile communication) pra bayar mentari di kecamatan tegal timur, kota tegal jawa tengah analisis variabel-variabel yang mempengaruhi struktur pendanaan dan pengaruhnya bersama return on asset terhadap rentabilitas modal sendiri motivasi konsumen dalam pengambilan keputusan berbelanja di toko buku islam sari weleri kendal analisis faktor-faktor yang mempengaruhi perilaku pembelian produk makanan kesehatan pada pt. cni (centra nusa insan cemerlang) wilayah yogyakarta analisis pengaruh citra supermarket terhadap loyalitas konsumen pada swalayan maga di yogyakarta analisis perbedaan pioneer-status sebuah merek terhadap sikap konsumen dalam kategori produk minuman teh botol pengaruh gaya kepemimpinan transformasional dan kepuasan kerja terhadap komitmen organisasi pengaruh sikap manajemen menengah dalam penerapan total quality managemen terhadap kinerja manajerial pengaruh ukuran perusahaan, profitabilitas, keputusan investasi, keputusan pendanaan, dan kebijakan deviden analisis perilaku perpindahan merek analisis kecanggihan investor terhadap ketepatan reaksi pasar dalam merespon pengumuman dividen meningkat pengaruh asimetri informasi terhadap praktik manajemen laba pada perusahaan yang termasuk dalam indeks lq-45 di bursa efek indonesia periode 2005 - 2008 analisis pengaruh kesesuaian citra diri terhadap kesukaan merek dan kepuasan konsumen pada produk sepeda motor "yamaha" variabel - variabel yang mempengaruhi fenomena underpricing pada penawaran saham perdana di bursa efek jakarta overreaksi pasar terhadap harga saham industri manufaktur di bursa efek jakarta dengan metode pengujian short - run analisis sistem antrian di bank bni cabang pembantu banjarnegara faktor-faktor yang mempengaruhi fenomena underpricing pada penawaran saham perdana di bursa efek jakarta tahun 2002-2006 penerapan six sigma dalam pengendalian kualitas produksi pada perusahaan gula madukismo analisis pengaruh struktur aktiva, tingkat pertumbuhan, profitabilitas dan operating leverage terhadap struktur modal perusahaan yang termasuk dalam lq 45 analisis faktor-faktor yang mempengaruhi struktur modal (studi di bursa efek jakarta tahun 1999 - 2004) analisis pengaruh earning per share (eps) return on equity (roe) return on invesment (roi) net profit margin (npm) terhadap harga saham ( studi kasus pada perusahaan real estate dan property di bursa efek jakarta th 2002 - 2004 ) peran keadilan distributif dan keadilan prosedural terhadap perilaku retaliasi di tempat kerja ( kasus pada pt. philips sea food indonesia pemalang ) analisis pengaruh persepsi kualitas, pengetahuan merek dan loyalitas merek terhadap brand equity (studi kasus pada bri syariah cabang yogyakarta) pengaruh variabel-variabel keuangan dan signaling terhadap penentuan harga pasar saham setelah penawaran umum perdana analisis faktor-faktor yang mempengaruhi struktur modal pada industri manufaktur go public di bursa efek jakarta analisis kepuasan membeli rumah dengan instrumen hombsat pada perumahan bhakti sentosa asri kulonprogo pengaruh kepemimpinan demokratis, motivasi dan kualitas komunikasi terhadap prestasi kerja karyawan di badan diklat i propinsi diy evaluasi sistem manajemen mutu standar iso 9001:1994 dan kesiapan penerapan sistem mutu standar iso 9001:2000 pt. sucofindo (persero) cabang bandung relevansi nilai devidend yield dan retained earning dengan moderasi investment opportunity set (ios) dalam penilaian harga saham pengaruh ketidakpuasan konsumen, karakteristik kategori produk dan kebutuhan mencari variasi terhadap keputusan perpindahan merek kartu prabayar pengaruh kepemimpinan kharismatik terhadap usaha ekstra bawahan analisis pengaruh posisi kas, profitability, potensi pertumbuhan, ukuran perusahaan, debt to equity ratio terhadap dividend payout ratio pada perusahaan manufaktur di bej analisis faktor - faktor yang mempengaruhi keputusan pendanaan perusahaan : pengujian pecking order hypotesis analisis pengaruh tingkat kepuasan terhadap prestasi akademik mahasiswa (stusi empiris di umy) analisis faktor - faktor yang berpengaruh terhadap keputusan konsumen membeli jasa warnet di yogyakarta (kasus pada warnet - warnet di jl. kap. p. tendean) aplikasi theory of planned behaviour (tpb) dalam pengujian sikap-niat siswa-siswi smu muhammadiyah i yogyakarta untuk masuk kuliah di umy analisis kualitas kehadiran kuliah mahasiswa fakultas ekonomi universitas muhammadiyah yogyakarta analisis faktor-faktor yang mempengaruhi loyalitas konsumen pada air mineral aqua (studi kasus pada mahasiswa umy) pengaruh kualitas pelayanan terhadap kepuasan pelanggan pada bengkel mobil rally blpt jl. kyai mojo yogyakarta analisis pengaruh kualitas jasa terhadap kepuasan pelanggan pada travel gajah cabang yogyakarta analisis pengaruh rasio profitabilitas, likuiditas dan leverage terhadap kebijakan dividen pada perusahaan go public di bursa efek jakarta analisis pengaruh citra terhadap loyalitas konsumen pada rumah sakit pku muhammadiyah gombong di kabupaten kebumen analisis pengaruh kepuasan kompensasi terhadap komitmen organisasi pada kopma uny yogyakarta hubungan antara risiko dan tingkat keuntungan pada perusahaan - perusahaan di bursa efek jakarta (bej) analisis investasi dan pembentukan portofolio saham optimal di bursa efek jakarta (dengan menggunakan model indeks tunggal pada saham-saham lq 45 pada tahun 2004 dan 2005) analisis faktor-faktor yang mempengaruhi pertumbuhan modal sendiri pada industri makanan dan minuman yang terdaftar di bursa efek jakarta pengaruh pengumuman dividen terhadap reaksi pasar pengaruh gaya hidup, harga, kelompok referensi keputusan pembelian samsung smartphone mahasiswa/i fakultas ekonomi universitas sumatera utara analisis perbedaan return saham , trading volume activity variance sebelum sesudah stock split ( perusahaan terdaftar bursa efek indonesia periode 2011-2013) analisis partikel pemarkah emotif bahasa jepang ; satu kajian pragmatik pengetahuan orang tua tentang bullying anak kelurahan bangun mulia kecamatan medan amplas hubungan merokok kejadian dermatitis kontak alergi tindakan perawat pencegahan infeksi nosokomial rumah sakit umum deli serdang hubungan persepsi keselamatan kesehatan kerja perilaku k3 pekerja bagian produksi pt. supratama juru enginering medan tahun 2015 analisis pengaruh investasi pertanian tenaga kerja pertanian pdrb kabupaten asahan propinsi sumatera utara. discovering lost treasure perlindungan hukum kreditur pemegang jaminan berupa hak tanggungan mengalami force majeure perjanjian kredit representasi pesan tradisi budaya karo film 3 nafas likas pengaruh customer retention, switching cost, trust in brand customer retention produk kartu seluler prabayar simpati mahasiswa s1 fakultas ekonomi & bisnis universitas sumatera utara perancangan sistem pakar mendiagnosa kerusakan handphone metode certainty factor (cf) berbasis web evaluasi tingkat kesalahan pengobatan sendiri (swamedikasi) kalangan mahasiswa universitas sumatera utara tanggap pertumbuhan produksi tanaman bawang merah (allium ascalonicum l.) pemberian pupuk fosfat asam humat. higiene sanitasi pengelolaan pemeriksaan kandungan escherichia coli mie gomak uang dijual pasar sidikalang tahun 2012 simulasi proses deep drawing pelat jenis stainless steel 304 menggunakan software abaqus 6.9-3 perhitungan debit luas genangan banjir sungai babura analisis pengaruh rasio capital adequacy ratio (car), non peforming loan (npl), operating expenses/operating income (bopo), return on asset (roa), net interest margin (nim) loan to deposit ratio (ldr) dana pihak ketiga (dpk) sebagai variabel moderating. (studi perusahaan perbankan terdaftar bursa efek indonesia tahun 2009 – 2013). pertanggungjawaban pidana tindak pidana korupsi dilakukan oleh korporasi ( putusan pengadilan tinggi banjarmasin no. 04/pid. sus/2011/pt. bjm) politik anggaran pembangunan desa desa martoba kecamatan simanindo kabupaten samosir evaluasi program jaminan pemeliharaan kesehatan (jpk) secara mandiri oleh pt indofood cbp (consumer branded products) sukses makmur tbk (terbuka) cabang medan pengujian kemampuan adsorpsi dari adsorben karbon aktif mesin pendingin tenaga surya kajian kandungan mineral kalium, natrium kalsium sayuran kubis (brassica oleracea l.) diperoleh dari lahan hasil pertanian pasca letusan gunung sinabung karakterisasi simplisia skrining fitokimia serta isolasi senyawa steroid/triterpenoid dari fraksi n-heksana daun gaharu (aquilaria malaccensis lam.) analisis determinan pulang atas permintan sendiri (paps) ruang rawat inap rumah sakit umum daerah kota padangsidimpuan tahun 2014 analisis total zat padat terlarut (total dissolved solid) total zat padat trsuspensi (total suspended solid) air badan air khususnya air sungai kampung ladang outbound camp sebagai wadah alternatif wisata outdoor kota medan peranan agrowisata mendukung pendapatan asli kabupaten karo penggunaan internet pencarian berita dinas komunikasi informatika provinsi sumatera utara pengaruh efisiensi modal kerja profitabilitas perusahaan rokok indonesia ( industri rokok go-public listing dibursa efek indonesia (bei) tahun 2004-2011 pengaruh komunikasi interpersonal petugas kesehatan karakteristik ibu kelengkapan imunisasi dasar wilayah kerja puskesmas bandar dolok kabupaten deli serdang hubungan komunikasi interpersonal petugas kesehatan kepatuhan berobat penderita tb paru kecamatan sibolangit kabupaten deli serdang tahun 2013 efektivitas metode simulasidan media leaflet pengetahuan keterampilan ibu-ibu rumah tanggadalam penanggulangandanpencegahan diaredi daerah rawan banjir kecamatan matangkuli kabupaten aceh utaratahun 2013 pengaruh pemberian cookies substitusi tepung tempe pertumbuhan anak batita gizi kurang kelurahan pakuan baru kota jambi tahun 2013 implementasi metode system development life cycle (sdlc) algoritma profile matching penentuan karyawan berprestasi an analysis of translating figurative language in paulo coelho‟s novel the alchemist hubungan perilaku pencegahan kejadian hiv kalangan lsl klinik ims vct veteran medan tahun 2015 pengaruh pelayanan program kb pembinaan keluarga oleh plkb pencapaian peserta kb aktif badan kb kabupaten simalungun tahun 2013 pemberitaan konflik basuki tjahaja purnama dprd dki jakarta harian sinar indonesia baru peranan kelompok masyarakat pengawas (pokmaswas) pemberdayaan masyarakat pesisir pantai kekuatan impak resin akrilik polimerisasi panas setelah penambahan serat kaca potongan kecil 1% metode berbeda implementasi layanan rakyat sertifikasi tanah (larasita) kantor pertanahan kota binjai peran mediator penyelesaian sengketa pembagian harta bersama setelah perceraian (studi pengadilan agama medan) implementasi kebijakan peraturan daerah kota medan no 5 tahun 2012 penerbitan izin mendirikan bangunan kota medan implementasi kriptografi des file gambar ke file audio algoritma steganografi lsb+1 implementasi perbandingan metode alpha-trimmed mean filter adaptive media filter reduksi noise citra digital fungsi pesta luhutan bolon tugu raja silahisabungan mempertahankan integrasi sosial pomparan raja silahisabungan ( masyarakat silalahi nabolak, kecamatan silahisabungan, kabupaten dairi) analisis pengaruh frekuensi redaman kabel koaksial pengaruh ukuran perusahaan, kemampulabaan, leverage, dewan komisaris pertanggungjawaban sosial perusahaan perbandingan efektivitas poly aluminium chloride (pac) tawas menurunkan kadar khromium (cr) turbidity 590 ntu metode spektrofotometri dr/2400 evaluasi pengelolaan obat program diare instalasi farmasi dinas kesehatan provinsi sumatera utara pengaruh pree chlorination angka lempeng total bakteri air sungai belawan keseragaman kandungan digoksin metode kromatografi cair kinerja tinggi (kckt) penetapan kadar air sediaan jamu pil secara destilasi azeotrop penetapan angka lempeng total air sungai belawan analisis peran bpr syariah bagi pengembangan ukm kecamatan kotanopan kabupaten mandailing natal analisis faktor-faktor mempengaruhi konsumsi mahasiswa asing universitas sumatera utara respon salinitas pertumbuhan komposisi rantai panjang polyisoprenoid semai mangrove avicennia officinalis. analisis finansial pemanfaatan pengolahan daun jeruju (acanthus ilicifolius l) menjadi berbagai produk olahan pengaruh kualitas produk citra merek keputusan pembelian smartphone samsung medan analisis budaya organisasi pegawai samsat medan pengaruh penambahan nanokristal selulosa dari tandan kosong kelapa sawit (elaeis guineensis jack) produk karet nanokomposit teknik pencelupan pengaruh faktor harga, rasa kemasansusu bear brand loyalitas konsumen mahasiswa fakultas hukum universitas sumatera utara pengaruh kreativitas keterampilan keberhasilan usaha kerajinan rotan medan pengaruh strategi diferensiasi kepuasaan pasien serta dampak loyalitas rumah sakit siti hajar padang bulan medan pengaruh kepercayaan, kemudahan, kualitas informasi keputusan pembelian secara online situs mahasiswa/i fakultas ekonomi bisnis usu analisis dampak keberadaan kawasan industri medan (kim) belawan tingkat kesejahteraan masyarakat sekitar kim belawan analisis faktor-faktor mempengaruhi minat masyarakat memilih asuransi berbasis syariah ( pt asuransi takaful umum cab.medan) peran pemerintah daerah kabupaten langkat pelaksanaan penataan ruang menurut undang-undang nomor 26 tahun 2007 persepsi pengguna layanan digital perpustakaan usu portal garuda eksistensi presidential threshold paska putusan mahkamah konstitusi nomor 14/puu-xi/2013 respon pertumbuhan produksi jamur tiram putih (pleurotus ostreatus) berbagai media serbuk kayu pemberian pupuk npk resiliensi guru sekolah dasar mengajar pesisir ( staf pengajar sd negeri 107396 paluh merbau) implementasi pelayanan promotif preventif puskesmas tapian dolok kabupaten simalungun tahun 2015 pengaruh store atmosphere keputusan pembelian konsumen kongbox cafe medan implementasi fuzzy inferensi decision tree optimasi pengukuran kinerja guru menentukan kompensasi merit pay tingkat pengetahuan mahasiswa kepaniteraan klinik fkg usu tentang standard precautions pasien hiv, hepatitis b, hepatitis c tbc tahun 2015 gambaran motivasi belajar bahasa mandarin siswa sma methodist 2 medan pemeriksaan boraks bakso dijual pedagang kaki lima warung bakso kelurahan padang bulan kecamatan medan baru tahun 2014 perilaku kader pemantauan pertumbuhan balita puskesmas mandala kecamatan medan tembung pengaruh pengetahuan, sikap tindakan vulva hygiene ph organ genitalia internal siswi sman 1 tiga panah kabupaten karo tahun 2013 analisis risiko pajanan gas so2 no2 sumber transportasi gangguan saluran pernafasan pedagang kaki lima (pkl) terminal terpadu amplas kecamatan medan amplas kota medan gambaran karakteristik sosial budaya masyarakat kejadian hipertensi wilayah kerja puskesmas sawit seberang kecamatan sawit seberang kabupaten langkat 2014 gambaran sosial budaya diabetes mellitus masyarakat wilayah kerja puskesmas gunungtua kecamatan padang bolak kabupaten padang lawas utara tahun 2014 pengaruh pengetahuan awal ketetapan ukuran keanekaragaman plankton sungai buaya kabupaten sergai kabupaten deli serdang sumatera utara implementasi peraturan walikota medan nomor 20 tahun 2011 penerbitan ijin usaha minimarket pengatalogan bahan pustaka prosiding seminar nasional teknik kimia 2009 inovasi teknologi proses pemanfaatan sumber daya alam menuju bumi hijau konsorsium perpustakaan indonesia analisis subjek bahan pustaka pengaruh faktor internal ekternal beban kerja perawat instalasi hemodialisa rumah sakit umum dr. pirngadi medan tahun 2015 penerapan analisis regresi ridge data pasien hipertensi rumah sakit umum daerah sidikalang tahun 2014 hubungan beban kerja stres kerja pegawai bpjs kesehatan kantor cabang utama medan tahun 2015 hubungan skor klinis a2ds2 (age, atrial fibrillation, dysphagia, sex and stroke severity) kejadian pneumonia penderita stroke akut analisis bahaya pekerja bagian workshop pt. x medan tahun 2015 hydrolysis of degummed and undegummed palm fatty acid distillate (pfad) pengaruh bullying tempat kerja kualitas kehidupan kerja hubungan lama kerja masa kerja neuropati perifer supir angkutan kota trayek 95 kota medan tahun 2015 hubungan kepadatan lalat, personal hygiene sanitasi dasar kejadian diare balita lingkungan i kelurahan paya pasir kecamatan medan marelan kota medan tahun 2015 perbedaan tingkat kelelahan kerja berdasarkan kebiasaan sarapan pekerja kurir pengiriman barang jne kota medan tahun 2015 perubahan warna resin akrilik polimerisasi panas setelah perendaman larutan kunyit kajian penerapan proses sosial arsitektur ( starbucks focal point medan) pengaruh karakteristik arsitektur cina bangunan vihara gunung timur medan analisis arsitektur masjid raya al mashun sebagai identitas kota studi perbandingan arsitektur bangunan masjid al – osmani masjid azizi tanjung pura konsep daur ulang material bekas sebagai elemen interior kafe medan ( resep nenek moyangku, lekker urban food house, hungry tummy) hubungan karateristik persepsi masyarakat tentang jaminan kesehatan nasional (jkn) keikusertaan menjadi peserta jkn kota medan tahun 2014 ‘cerita kampus’ pemuasan kebutuhan followers akun twitter usukomfm medan faktor-faktor mempengaruhi kejadian demam berdarah dengue (dbd) kecamatan bajenis kota tebing tinggi tahun 2014 gambaran perilaku konsumsi air minum siswa/siswi sma negeri 3 medantahun 2014 faktor- faktor mempengaruhi jenis alat kontrasepsi digunakan akseptor wilayah kerja puskesmas sering kecamatan medan tembung kota medan tahun 2015 perancangan sistem pembayaran (billing system) pasien rumah sakit umum inanta padangsidempuan studi deskriptif fungsi komunikasi non verbal emoticon instant messaging kalangan mahasiswa penerapan program behavior based safety (bbs) kecelakaan kerja pt inalum kuala tanjung tahun 2014 pemanfaatan account twitter @anak_usu sebagai sarana informasi pengaruh profitabilitas, capital adequacy ratio, leverage opini audit going-concern perusahaan perbankan terdaftar bei penerapan metode fuzzy anp copras pemilihan merek mesin injection molding pt. mewah indah jaya rancang bangun mesin pendingin ruangan menggunakan energi surya campuran air, garam,dan es sebagai media pendingin analisis faktor-faktor yangmempengaruhi pendapatan serta persepsi nelayan program peningkatan pendapatan nelayan oleh pemerintah ( kelurahan bagan deli, kec.medan belawan, kota madya medan) respons pertumbuhan vegetatif tiga varietas kelapa sawit (elaeis guineensis jacq.) pre nursery beberapa komposisi media tanam limbah pengaruh media tanam panjang slip bahan tanaman pembibitan tanaman vetiver (vetiveria zizanoides (l.) nash) analisis fasilitas kredit perumahan rakyat kepemilikan rumah masyarakat kota medan bank tabungan negara (persero) tbk cabang medan respons pertumbuhan produksi terung (solanum melongena l.) pemberian pupuk kandang ayam pupuk fosfor pelaksanaan sistem jaminan sosial bagi pekerja/buruh setelah berlakunya undang-undang no. 24 tahun 2011 tentang badan penyelenggara jaminan sosial (bpjs) pengaruh promosi kesehatan menggunakan metode ceramah permainan ular tangga peningkatan perilaku murid kelas v tentang konsumsi makanan jajanan sd negeri kecamatan medan petisah tahun 2015 kajian teoritik persamaan dirac pengaruh medan magnetik homogen deskripsi struktur fungsi musik taganing repertoar si pitu gondang ensambel gondang sabangunan disajikan oleh maningar sitorus dentin tersier terbentuk gigi molar rahang bawah atrisi akibat menyirih evaluasi kinerja penyaluran air daerah irigasi batang gadis kecamatan panyabungan kabupaten mandailing natal analisishubunganketimpangan daerah tingkat kemiskinan sumatera utara pelayanan reservasi sistem e-tiket domestik maskapai penerbangan city link medan observasi klinis pengaruh pemberian serbuk daun sidaguri (sida rhombifolia l) pasien hiperurisemia pergeseran solidaritas sosial masyarakat terkena banjir (studi deskriptif masyarakat sekitar sungai deli, kelurahan sukaraja, kecamatan medan maimun) kehidupan petani salak desa parsalakan kecamatan angkola barat kabupaten tapanuli selatan (1970 – 200) pengaruh profitabilitas, likuiditas, pertumbuhan penjualan, ukuran perusahaan struktur aset struktur modal perusahaan otomotif terdaftar bursa efek indonesia periode 2010-2013 analisis pengaruh good corporate governance konvergensi ifrs manajemen laba perusahaan bumn terdaftar bursa efek indonesia periode 2011-2013 uji variasi suhu hasil pengering alat pengering ikan (tipe kabinet) hubungan status gizi insiden keilitis angularis anak-anak umur 6-10 tahun panti asuhan terima kasih abadi hubungan persepsi dukungan sosial keluarga self regulated learning mahasiswi program magister usu telah menikah pengaruh gaya kepemimpinan kinerja guru sdn 106800 hamparan perak kabupaten deli serdang penetapan kadar logam aluminium (al) air reservoir instalasi pengolahan air pdam tirtanadi sunggal secara kolorimetri penetapan kadar betametason valerat krim betametason secara kromatografi cair kinerja tinggi pengaruh penggorengan kadar asam lemak bebas minyak nabati metode titrasi asam basa analisis kadar klorida (cl) air reservoir hamparan perak metode argentometri analisis kadar stanum (sn) minyak goreng secara spektrofotometri serapan atom uji mutu sediaan gentamisin salep kulit diproduksi oleh pt. kimia farma (persero) tbk. plant medan pengaruh penggorengan komposisi asam lemak minyak kelapa sawit minyak beras pengaruh penggorengan komposisi asam lemak minyak kelapa minyak jagung perbandingan efektivitas poly aluminium chloride pac tawas menurunkan kadar tembaga (cu) turbidity 590 ntu metode spektrofotometri dr/2400 gambaran pengetahuan, sikap, tindakan remaja puteri pemeriksaan payudara sendiri (sadari) sma katolik budi murni 1 medan tahun 2014 analisis pengaruh profitabilitas, likuiditas, leverage, free cash flow ukuran perusahaan kebijakan dividen perusahaan industri barang konsumsi terdaftar bursa efek indonesia (bei) periode 2011-2013 analisis pengaruh cash ratio, return on assets, growth firm size, debt to equity ratio net profit margin dividen payout ratio perusahaan lq-45 terdaftar bursa efek indonesia tahun 2010 -2012 analisis kinerja jaringan multiprotocol label switching (mpls) layanan video streaming pengaruh persepsi kualitas interaksi atasan-bawahan organizational citizenship behavior pengurus dpd partai golkar sumatera utara pengaruh intensitas cahaya pertumbuhan konten rantai panjang polyisoprenoid mangrove sejati mayor berjenis sekresi sonneratia caseolaris (l.) pemanfaatan fungi aspergillus flavus, aspergillus. terreus, trichoderma harzianum meningkatkan pertumbuhan bibit avicennia marina. penggunaan berbagai dosis pupuk kandang pertumbuhan bibit sukun (artocarpuscommunis.forst) dta danau toba, kecamatan haranggaol horison analisis pengaruh struktur modal kebijakan dividen nilai perusahaan(studi saham-saham lq 45 bursa efek indonesia periode 2008-2014) komunikasi nonverbal citra presiden joko widodo (analisis semiotika komunikasi nonverbal serta citra terbentuk dari presiden republik indonesia joko widodo) strategi komunikasi awak kabin garuda indonesia airlines(studi deskriptif kualitatif strategi komunikasi awak kabin garuda indonesia airlines sehingga mendapat predikat sebagai the world’s best cabin crew 2014 oleh skytrax) evaluasi kinerja forum kerukunan umat beragama (fkub) provinsi sumatera utara menjaga kerukunan umat beragama provinsi sumatera utara peranan pemerintah daerah memberikan surat izin usaha perdagangan (suatu studi badan pelayanan perizinan terpadu (bppt) kota gunungsitoli) pelaksanaan program kota layak anak meningkatkan kesejahteraan anak oleh badan pemberdayaan perempuan keluarga berencana kota medan asuhankeperawatanpada an.a gangguan kebutuhan dasar oksigenasi rsud.dr.pirngadi medan tahun 2014 implementasi penyelesaian permainan rubrik cube algoritma kociemba platform android sistem infromasi akuntansi pemberian kredit multi guna sumut kcp setia budi tinjauan sosial ekonomi keluarga penambang emas tambang emas rakyat desa hutabargot kecamatan hutabargot kabupaten mandailing natal pengaruh viskositas laju aliran saliva pembentukan kalkulus pasien instalasi periodonsia rsgm usu pengaruh pertumbuhan rasio keuangan ( current ratio, debt to eqiuty ratio , total asset turn over ) ukuran perusahaan kinerja perusahaan perusahaan manufaktur terdaftar bursa efek indonesia periode 2011-2013 fungsi tugas ashigaru situasi perang zaman kamakura hingga zaman edo dalihan na tolu” sebagai katup pengaman bagi potensi konflik masyarakat batak toba berbeda agama (studi sidabaribaparapat, kecamatan girsang sipanganbolon, kabupaten simalungun) perawatan bahan pustaka perpustakaan universitas hkbp nommensen medan konfirmasi diagnostik sitologi imprint, potong beku histopatologi lesi tiroid rsup. haji adam malik medan tahun 2011-2012 pengetahuan lokal petani mengelola padi sawah pangaribuan dampak penggunaan game online perilaku remaja (studi deskriptif kuantitatif remaja kelurahan asam kumbang medan) pengendalian internal prosedur penerimaan pengeluaran kas pt taspen kcu medan pendugaan produktivitas pohon pakan orangutan sumatera (pongo abelii) kawasan pusat pengamatan orangutan sumatera (ppos), bukit lawang. teknik pemecahan kunci privat elgamal algoritma baby step giant step perkembangan akar bibit rhizophora mucronata lamk berbagai intensitas naungan pengaruh efektivitas koagulan pac (poly auminium chloride) tawas logam mangan (mn) air baku pdam tirtanadi hamparan perak studi penggunaan obat pasien anak rawat inap rumah sakit umum daerah dr. pirngadi kota medan periode januari 2013 - desember 2013 analisis swot sebagai dasar penentuan strategi bersaing pt. perkebunan nusantara iv asuhan keperawatan ny. s gangguan aman nyaman nyeri post sectio caesaria rsud dr. pirngadi medan analisa ruang jalan konsep livable street ( jalan jamin ginting) analisis operasional angkutan umum kota medan jenis mobil penumpang umum ( kpum 04 amplas – uma) faktor-faktor memengaruhi potensi kecelakaan kerja pengemudi truk pt berkat nugraha sinar lestari belawan tahun 2015 pengujian pemanas air tenaga surya sistem pipa panas menggunakan fluida kerja refrigeran r-718 tekanan vakum 45 cmhg, 40 cmhg 35 cmhg variasi kemiringan kolektor 400 500. perbandingan metode weighted product simple multi-attribute rating tecnique menentukan lahan terbaik tanaman karet implementasi elliptic curve elgamal public key cryptosystem sebagai pengaman distribusi kunci block cipher aes simulasi pencarian kunci privat algoritma silver-pohlig-hellaman algoritma kriptografi elgamal implementasi perbandingan low-pass filtering high- pass filtering mereduksi noise citra digital watermarking menggunakan algoritma discrete cosine transform (dct) penyisipan ke citra perancangan m-learning menggunakan metode gamification pengaruh variasi arus las sifat mekanik ketangguhan las smaw elektroda nsn308 pengaruh bullying tempat kerja burnout karyawan gambaran coping stress penyintas menghadapi bencana erupsi gunung sinabung kabupaten karo inventarisasi jenis tanaman mpts (multy purpose tree species) daerah tangkapan air danau toba provinsi sumatera utara efektivitas pemberdayaan masyarakat miskin melalui program rehabilitasi sosial rumah tidak layak huni oleh dinas sosial tenaga kerja kabupaten nias barat efek antibakteri ekstrak etanol umbi lobak (raphanus sativus l.) fusobacterium nucleatum atcc 25586 sebagai bahan alternatif medikamen saluran akar (secara in vitro) pengaruh kualitas aktiva produktif, tingkat suku bunga loan to deposit ratio (ldr) profitabilitas perusahaan perbankan terdaftar bursa efek indonesia (bei) tahun 2010-2013 pengaruh pengadopsian isa, ukuran klien audit, kompleksitas audit, risiko litigasi, profitabilitas klien, jenis kap professional fee analisis pengaruh pemadaman secara berkala oleh pln kegiatan usaha mikro kecamatan medan baru tinjauan hukum pelaksanaan perjanjian jual beli tanaman bibit karet antara cv.saputro jaya agrindo masyarakat petani kabupaten simalungun modifikasi ulos batak (studi etnografi tentang perubahan fungsi ekonomi kreatif) evaluasi penggunaan koleksi literatur anak badan perpustakaan arsip dokumentasi provinsi sumatera utara analisis daya dukung mini pile proyek pembangunan ruko northcote condominium block-d penerapan metode q menentukan model pengdalian persediaan minyak kelapa sawit pengaruh promosi jabatan lingkungan kerja semangat kerja pt. perkebunan nusantara iv (persero) medan (divisi sumber daya manusia) gambaran sikap mahasiswa batak toba dalihan na tolu metode pengurutan objek pengelompokan data berdasarkan kuantil studi temperatur optimal kekuatan tarik makrostruktur komposisi campuran polypropiline (pp) high-densitiy polyethylene (hdpe) mesin ekstruder faktor – faktor berhubungan kelengkapan pemeriksaan kehamilan ibu mempunyai bayi kelurahan binjai kecamatan medan denai tahun 2014 ploating place perbandingan kinerja antena mikrostrip susun dua elemen patch segi empat menggunakan teknik dgs (defected ground structure) tanpa dgs berbentuk segitiga sama sisi hubungan tipe komitmen organisasi cyberloafing karyawan kantor perwakilan bank indonesia provinsi sumatera utara kecerdasan emosional remaja memiliki minat musik berbeda peran sikap, norma subjektif, perceived behavioral control (pbc) intensi menggunakan homeschooling sebagai jalur pendidikan pengujian pemanas air tenaga surya sistem pipa panas menggunakan fluida kerja refrigeran r-718 tekanan vakum 45 cmhg, 40 cmhg, 35 cmhg variasi sudut kolektor 200 300 optimalisasi jumlah tipe rumah akan dibangun metode simpleks pembangunan perumahan citraland bagya city medan pengaruh tingkat konvergensi ifrs perlindungan bagi investor kualitas laba perusahaan-perusahaan terdaftar bursa efek negara indonesia, malaysia, singapura, india fermentasi gliserol hasil samping pabrik biodiesel menjadi 1,3-propanadiol menggunakan bakteri klebsiella pneumonia analisis finansial usahatani padi organik ( desa lubuk bayas kecamatan perbaungan kabupaten serdang bedagai) analisis nilai tambah strategi pengembangan produk olahan kopi bubuk arabika (coffea arabika) kelompok tani simalungun jaya desa sait buttu saribu kabupaten simalungun analisis pasal 1338 kitab undang- undang hukum perdata (pacta sunt servanda) perjanjian antara dokter pasien tinjauan tentang praktik asuransi kecelakaan tertanggung sebagai pelaku kecelakaan efektifitas vitamin d derajat keparahan dermatitis atopik perancangan sistem informasi akademik sd negeri 060851 medan menggunakan php penerapan algoritma greedy permainan mill berbasis android perancangan alat pengukur kecepatan & debit suatu aliran cairan berbasis mikrokontroler ragam diksi upacara adatsaur matua masyarakat batak toba tinjauan sosiolinguistik hubungan karies karies tidak dirawat kualitas hidup masyarakat dewasa usia 20-40 tahun desa deli tua kecamatan namorambe faktor-faktor mempengaruhi kuminitas merek loyalitas pelanggan analisispengaruh efesiensi modal kerja tingkat likuiditas perusahaan manufaktur terdaftar bursa efek indonesia (bei) analisis pengaruh fluktuasi kenaikan bbm penjualan pedagang pasar tradisional perumnas simalingkar kajian pemilihan moda transportasi antara angkutan kota monorel menggunakan metode stated preference ( rencana pembangunan monorel kota medan) analisa aspergillus fumigatus menggunakan polymerase chain reaction (pcr) kultur sputum penderita batuk kronis gambaran perilaku ibu pemeliharaan kesehatan gigi anak sd negeri 064023 kemenangan tani medan tahun 2015 analisis perbandingan tingkat efisiensi antara bpr syariah bpr konvensional indonesia menggunankan metode data envelopment analysis (dea) bangkitan perjalanan perumahan nasional (perumnas) helvetia karakteristik penderita gagal ginjal menjalani hemodialisis rsup. h. adam malik tahun 2013 penetapan kadar air sediaan sabun mandi sere padat secara gravimetri uji efektivitas anti-aging dari krim ekstrak bunga brokoli (brassica oleracea l var. italica plenck) marmut implementasi kombinasi tiny encryption algorithm (tea) algoritma least significant bit(lsb)untuk keamanan file text analisis pelaksanaan program kesehatan lingkungan periode januari – desember 2013 puskesmas kabupaten tapanuli tengah tahun 2014 analisis peran serta petugas puskesmas tentang penerapan kawasan tanpa rokok (ktr) puskesmas teladan kota medan tahun 2014 iklan televisi keputusan membeli optimalisasi peran badan permusyawaratan desa (bpd) penyelenggaraan pemerintahan desa (studi bpd desa aek goti kecamatan silangkitang kabupaten labuhanbatu selatan) evaluasi pelaksanaan program pensiun iuran pasti dana pensiun lembaga keuangan bank negara indonesia (ppip dplk bni) bagi karyawan pt.perkebunan nusantara iii medan pembangunan modal sosial keberadaan kegiatan pelatihan ikan pora-pora bagi masyarakat miskin pengangguran oleh dinas tenaga kerja sosial desa silalahi i, kecamatan silahisabungan, kabupaten dairi kajian teori permainan strategi pemasaran suatu produk metode simpleks efek waktu milling menggunakan hem (high energy milling) pembuatan magnet bonded pr-fe-b penerapan automasi perpustakaan universitas darma agung medan tradisi persembahan makanan kepada orang meninggal upacara kematian masyarakat tionghoa kota medan kompetensi teknologi informasi komunikasi pegawai perpustakaan umum kabupaten deli serdang analisis pesan moral on, gimu, giri novel “tokyo tower” karya lily franky peranan burhanuddin usman sebagai pemusik saksofon kebudayaan musik melayu implementasi strategi pengembangan sektor pariwisata kabupaten toba samosir (studi kantor dinas kebudayaan pariwisata kabupaten toba samosir) implementasi sistem manajemen keselamatan kesehatan kerja badan usaha milik negara studi pt. pertamina refinery unit ii dumai implementasi program badan penyelenggara jaminan sosial (bpjs) (studi rumah sakit tingkat ii putri hijau kesdam i/bukit barisan medan) literasi informasi mahasiswa baru pengguna perpustakaan universitas negeri medan tahun akademik 2014/2015 analisis kausalitas antara pengeluaran penerimaan pemerintah sumatera utara peranan audit internal meningkatkan sistem pengawasan intern pt. astra international tbk. – toyota sales operation auto2000 cabang medan amplas pengaruh pajak daerah retribusi daerah belanja modal pemerintah kabupaten provinsi aceh pengaruh pendapatan asli daerah (pad), dana alokasi umum (dau), dana alokasi khusus (dak) belanja modal kota pulau sumatera hubungan antara risiko diukur metode value at risk (var) imbal hasil reksa dana saham indonesia structure, conduct performance industri makanan indonesia analisis potensi pengembangan ekonomi kreatif kota medan faktor-faktor mempengaruhi penggelapan pajak indonesia recyclable of lipozyme rm im in biodiesel synthesis from cpo through interesterification process analisis pengaruh kebijakan investasi perkembangan investasi sumatera utara kelayakan analisis usahatani jeruk siam (citrus nobilis lour var. microcarpa hassk)( desa kubu simbelang, kecamatan tigapanah, kabupaten karo) pengelolaan hutan oleh masyarakat kabupaten samosir pengakuan diri seorang gay lingkungan gay (studi deskriftif cafe’ shop kota medan) nutrisi sebagai pencegah primer sekunder penyakit jantung koroner wisata salib kasih (studi etnografi mengenai wisata religi kecamatan siatasbarita, kabupaten tapanuli utara) peran televisi pembentukan opini publik (studi analisis deskriptif peran televisi pembentukan opini masyarakat desa muliorejo kecamatan sunggal kabupaten deli serdang pemberitaan kebijakan presiden joko widodo menghukum mati pengedar narkoba) nutrisi usia lanjut komunikasi seni jalanan (studi analisis unsur-unsur komunikasi seni jalanan oleh komunitas seniman jalanan jalan adam malik, medan) efektifitas saluran komunikasi pemilu (studi deskriptif kualitatif efektifitas saluran komunikasi menentukan pilihan pemilihan umum presiden tahun 2014 desa pasar iv namutrasi kabupaten langkat) konstruksi pemahaman wartawan uu kip (studi pendekatan konstruktivisme wartawan aliansi jurnalis independen cabang medan memahami undang-undang republik indonesia nomor 14 tahun 2008 tentang keterbukaan informasi publik) respon siswa pelaksanaan program bina keluarga remaja oleh badan kependudukan keluarga berencana nasional kota medan (studi yayasan fajar dinul islam smk namira technology nusantara medan) perubahan gaya hidup remaja pasca berdirinya wisata hiburan hill park desa suka makmur kecamatan sibolangit kabupaten deli serdang konflik elit lokal pemekaran kecamatan blang jerango kabupaten gayo lues potensi konflik antara peternak babi masyarakat sekitar daerah simalingkar b medan ( daerah gang maju iii lingkungan x simalingkar b,kwala bekala, medan) tanggung jawab negara indonesia selaku negara khatulistiwa negara kolong (gso) hubungan kadar ubiqutin c-terminal hydrolase – l1 tingkat keparahan cedera kepala pengalaman remaja putri korban kekerasan seksual pusat kajian perlindungan anak (pkpa) medan the structure of selected print advertisement a multimodal analysis faktor – faktor berhubungan kejadian pre hipertensi usia 18-40 tahun desa jati kesuma kecamatan namo rambe kabupaten deli serdang tahun 2015 peningkatan kinerja link menengah melalui pemasangan pengaku diagonal bagian ujung redesain prestress (post-tension) beton pracetak i girder antara pier 4 pier 5, ramp 3 junction kualanamu “ jembatan fly-over jalan toll medan-kualanamu” analisis kelarutan kalsium oksalat kalsium karbonat infus daun tempuyung segar (sonchus arvensis l.) sediaan kapsul ekstrak daun tempuyung secara spektrofotometri serapan atom analisis marketing mix meningkatkan penjualan produk mirai ocha analisis strategi pemasaran berdaya saing produk ayam kampung organik (studi lembaga pusat pelatihan pengembangan masyarakat huria kristen indonesia) peran fungsi legislasi dprd kota medan periode 2009 – 2014 pembuatan peraturan daerah berbagai aturan transaksi pajak buah berastagi picture health warning kotak rokok minat merokok siswa (studi korelasional komunikasi visual peringatan bahaya merokok kotak rokok minat merokok aiswa sma swasta ypi amir hamzah) pengaruh program pertanian organik sosial ekonomi kelompok dampingan yayasan bina keterampilan pedesaan (bitra) indonesia desa lubuk bayas kecamatan perbaungan kabupaten serdang bedagai kehamilan diluar nikah putus sekolah kalangan remaja putri desa patumbak 1 ( remaja putri desa patumbak 1 kecamatan patumbak kabupaten deli serdang) pengaruh waktu pemolesan bahan poles bubuk pumice kekasaran permukaan resin akrilik polimerisasi panas pengaruh komisaris independen, komite audit, kepemilikan manajerial, kepemilikan institusional manajemen laba perusahaan otomotif terdaftar bursa efek indonesia tata cara pengembalian kelebihan pembayaran pajak pertambahan nilai kantor pelayanan pajak paratama medan petisah faktor-faktor mempengaruhi kelengkapan pengungkapan laporan keuangan ptpn-iv analisis faktor-faktor mempengaruhi peringkat obligasi perusahaan perbankan terdaftar bursa efek indonesia analisis perbedaan profitabilitas pengelolaan perusahaan sebelum sesudah privatisasi mewujudkan good corporate governance (studi empiris bumn sektor telekomunikasi indonesia) laporan praktik kerja profesi farmasi rumah sakit gambaran pola makan status gizi ibu hamil wilayah kerja puskesmas buhit kecamatan pangururan kabupaten samosir tahun 2014 perancangan pembuatan argometer digital menggunakan gps pengaruh window level window width lung window mediastinum window kualitas citra ct-scan thorax analisis kebutuhan informasi pengguna perpustakaan keliling desa kota pari kecamatan pantai cermin analisis pengaruh profitabilitas, leverage earning per share harga saham perusahaan basic industry and chemicals terdaftar bursa efek indonesia periode 2010-2012 analisis pengaruh audit tenure, ukuran kap, ukuran perusahaan klien rotasi audit kualitas audit perusahaan manufaktur tercatat bursa efek indonesia penanganan taking order marriott cafe jw marriott hotel medan strategi pustakawan meningkatkan minat baca masyarakat badan perpustakaan, arsip dokumentasi sumatera utara sistem informasi akuntansi persediaan pt pertamina (persero) mor i medan sistem pengawasan internal kas kebun percobaan usu tambunan a kecamatan salapian kabupaten langkat pengelolaan aktiva tetap pt.pln (persero) area medan pengaruh manajemen modal kerja, likuiditas, leverage, corporate governance profitabilitas perusahaan manufaktur terdaftar bursa efek indonesia rancang bangun kotak pendingin menggunakan elemen pendingin termoelektrik sumber energi surya uji variasi suhu pengeringan biji kakao alat pengering tipe kabinet mutu bubuk kakao uji berbagai jenis komoditi alat pencetak keripik biji-bijian uji variasi diameter lubang nampan pengering ubi kayu (manihot esculenta) tipe kabinet kualitas hasil pengeringan pengaruh pemberian naungan konsentrasi rootone-f pertumbuhan vetiver (vetiveria zizanioides (l.) nash) an analysis on major characters’ conflicts in wendelin van draanen’s flipped studi indeks sefalik vertikal, transversal, horizontal usia 7-18 tahun deutro-melayu hubungan indeks massa tubuh lingkar kepala anak usia dini (6-8 tahun) deutro melayu asal-usul makna perayaan perahu naga bagi masyarakat tionghoa kemampuan menggunakan harf jarr kalimat bahasa arab oleh mahasiswa departemen sastra arab usu tahun pembelajaran 2013/2014 pengaruh kesesuaian penempatan kerja prestasi kerja pegawai kantor badan perencanaan pembangunan (bappeda) kabupaten tapanuli selatan aplikasi pendeteksian wajah manusia menghitung jumlah manusia menggunakan metode viola-jones tradisi lisan nyanyian rakyat anak-anak masyarakat batak toba kecamatan lintongnihuta kabupaten humbang hasundutan keterancaman leksikon ekoagraris bahasa angkola/mandailing kajian ekolinguistik gambaran paparan asap rokok selama kehamilan berat badan bayi dilahirkan ibu melahirkan beberapa rumah sakit klinik bersalin medan analisis strategi pemasaran coruca coffee shop perubahan fungsi sosioekologis leksikon flora bahasa pakpak dairi pengaruh waktu pemberian konsentrasi paclobutrazol pertumbuhan bunga matahari (hellianthus annuus l.) implementasi algoritma ant colony pencarian lokasi rumah sakit berbasis mobile gis platform android kesantunan daya semiotika bahasa berkampanye calon legislatif partai golongan karya kabupaten labuhan batu utara pengaruh beberapa ukuran pupa penggerek batang tebu jumlah populasi tetrastichus sp. (hymenoptera eulophidae) laboratorium the influence of teacher’s teaching character to the student’ slearning behaviour and language at sman 3 langsa 2014 pengaruh budaya kerja komitmen pegawai kinerja pegawai dinas pasar kabupaten deli serdang pra rancangan pabrik pembuatan tanin dari kulit buah kako kapasitas 1.500 ton/tahun pemanfaatan fermentasi hasil samping industri kelapa sawit probiotik lokal performans domba pemanfaatan tepung ikan pora-pora (mystacoleucus padangensis) sebagai substitusi tepung ikan komersial ransum performans itik porsea umur 0-12 minggu pengaruh perbandingan sari serai sari jahe konsentrasi natrium benzoat mutu sirup serai pengaruh perbandingan sari buah jambu biji merah sari buah sirsak konsentrasi gum arab mutu permen jelly pengaruh letak daun lama fermentasi mutu teh daun gaharu kajian selektivitas erosi budidaya tanaman karet usia 15 tahun desa lau damak kecamatan bahorok kabupaten langkat karakteristik kimia fungsional tepung komposit dari jenis tepung kasava termodifikasi berbagai metode pengeringan tepung terigu pengaruh kombinasi pasir vulkan,zeolit air laut sifat kimia tanah produksi padi varietas lokal lahan gambut dataran tinggi toba tradisi martahi karejo masyarakat angkola kajian semiotik sosial analisis pengelolaan arsip nasabah dinamis aktif pt. bank xxx medan evaluasi pengelolaan obat program filariasis instalasi farmasi dinas kesehatan provinsi sumatera utara perbandingan efektivitas poly alumunium chloride (pac) tawas menurunkan turbidity (kekeruhan) derajat keasaman (ph) turbidity 590 ntu uji disolusi tablet parasetamol produksi pt. kimia farma (persero) tbk. plant medan uji mutu krim ketokonazol diproduksi oleh pt. kimia farma (persero) tbk. plant medan the juvenile delinquency portrayed in nicholas sparks’ novel the last song perbandingan kinerja jaringanmetropolitan area network internet protocol versi 4 versi 6 analisis faktor-faktor mempengaruhi hasil produksi jagung kabupaten mandailing natal tahun 2013 kinerja pramusaji meningkatkan kualitas pelayanan prime steak house j.w marriott hotel medan sistem pengandaan bahan pustaka perpustakaan universitas muhammadiyah sumatera utara kampus ii pengaruh salinitas pertumbuhan komposisi rantai panjang polyisoprenoid semai mangrove sejati minor berjenis sekresi xylocarpus granatum koenig pengomposan limbah pertanian sebagai upaya mengatasi pencurian humus taman hutan raya bukit barisan kabupaten karo pengaruh service quality(kualitas pelayanan) word of mouth (komunikasi mulut ke mulut) sektor pelayanan kesehatan pengaruh stres kerja, konflik, gaji turnover karyawan choco bakery hubungan politik antara pangulu maujana nagori nagori tiga ras, kecamatan dolok pardamean, kabupaten simalungun periode 2008-2015 strategi komunikasi pemasaran rangka meraih konsumen (studi deskriptif kualitatif strategi komunikasi pemasaran marketing pt railink “kereta api bandara internasional kualanamu” upaya meraih konsumen) pengrauh sosial ekonomi keluarga kenakalan remaja desa karang rejo kecamatan gunung maligas kabupaten simalungun strategi adptasi masyarakat menghadapi bencana banjir ( kelurahan pekan tanjung pura kecamatan tanjung pura kabupaten langkat) pengaruh penambahan abu cangkang keong mas (pomacea canaliculata.l) telah diaktifkan sebagai adsorben kadar ion besi (fe3+) tembaga (cu2+) air sungai deli pembuatan poliuretan sebagai media penyaring air payau dari lignin isolat kayu jati bahan aditif pasir pengaruh likuiditas kinerja keuangan, leverage sebagai variabel intervening perusahaan manufaktur terdaftar bursa efek indonesia pengaruh financing to deposit ratio non performing financing profitabilitas bank syariah indonesia analisis peran umkm pengurangan jumlah penduduk miskin kota medan tinjauan yuridis perlindungan nasabah bank setelah adanya otoritas jasa keuangan perbankan studi ojk kantor regional v sumatera, medan gambaran karakteristik sosial budaya keluarga tentang perilakumerokok siswa laki-laki sma negeri 1 bukit kabupaten bener meriah aceh tahun 2015 daya antibakteri ekstrak kulit buah manggis (garcinia mangostana linn.) bakteri streptococcus mutans sebagai bahan alternatif medikamen saluran akar metode dilusi in vitro rancang bangun alat pemotong asam gelugur (garcinia atroviridis griff.) karakteristik fiskikimia fungsional tepunggandum ditanam sumatera utara analisis kesalahan urutan goresan penulisan aksara mandarin mahasiswa sastra cina universitas sumatera utara pengaruh partisipasi penyusunan anggaran, motivasi komitmen organisasi kinerja karyawan pt.perkebunan nusantara iv (persero) tinjowan kec. ujung padang, kab.simalungun kajian metode hidrograf satuan sintetik sungai deli pengaruh penambahan berbagai bahan pengawet alami konsentrasinya mutu nira aren pengaruh profesionalisme kerja pegawai kepuasan mahasiswa (studi sub bagian administrasi pendidikan fakultas ilmu sosial ilmu politik universitas sumatera utara) evaluasi hasil pelatihan arsip dinamis lingkungan pemerintah kabupaten tapanuli utara penetapan kadar air sediaan jamu serbuk secara destilasi azeotrop pemanfaatan arang sebagai media penahan air mendukung pertumbuhan bibit sukun daerah tangkapan air danau toba, kabupaten simalungun pengaruh brand image keputusan konsumen menggunakan jasa tiki jalan dr.mansyur, medan analisis pengaruh good corporate governance profitabilitas perusahaan pt. bank mandiri (persero) tbk ekowisata mangrove (studi etnografi tentang pengelolaan ekowisata mangrove berbasis masyarakat kampoeng nipah, desa sei nagalawan, kecamatan perbaungan, serdang bedagai) pengaruh pemanfaatan taman bacaan peningkatan minat baca rumah baca lontung samosir perbandingan prediksi leeway space menggunakan analisis moyers tanaka-johnston murid sekolah dasar suku batak kota medan analisis komponen kimia uji aktivitas antibakteri minyak atsiri bunga tembelekan (lantana camara l) asuhan keperawatan ny. l prioritas masalah gangguankebutuhan dasar mobilisasi rsud dr. pirngadi medan asuhan keperawatan tn. e prioritas masalah kebutuhan dasar kenyamanan; nyeri asuhan keperawatan ny. s prioritas masalah kebutuhan dasar gangguan rasa nyaman nyeri kronik rsud dr.pirngadi medan asuhan keperawatan tn. m kebutuhan dasar rasa aman nyaman ; nyeri post op appendicsitis rsud.dr pirngadi medan a brief description of murder and vampire pictured in vampire academy novel by richelle mead pengaruh modal intelektual kinerja keuangan perusahaan perbankan terbuka bursa efek indonesia pra rancangan pabrik pembuatan glukosa dari sabut kelapa sawit kapasitas 15.000 ton/tahun pengaruh total asset turn over ratio debt equity ratio audit delay return on asset sebagai variabel pemoderasi perusahaan property real estate terdaftar bursa efek indonesia tahun 2011-2013 hubungan lebar mesiodistal gigi kecembungan profil jaringan lunak wajah mahasiswa fkg usu ras campuran proto deutromelayu pengaruh sistem pengendalian manajemen budaya organisasi kinerja perusahaan (studi perusahaan perkebunan kelapa sawit sumatera utara) pengaruh spirit of entrepreneur kinerja usaha para pelaku ukm tenant pusat inkubator bisnis cikal usu pengukuran indeks kepuasan masyarakat pelayanan publik badan pelayanan perizinan terpadu, dinas pendapatan daerah dinas kependudukan catatan sipil kota medan formulasi sediaan pewarna pipi menggunakan ekstrak bunga kecombrang (etlingera elatior jack) sebagai pewarna rancang bangun band pass filter metode hairpin menggunakan saluran mikrostrip frekuensi 2,4-2,5 ghz pengaruh asam borat pengawetan kayu jabon metode pengawetan rendaman panas dingin perencanaan sistem drainase kota pangkalan kerinci kabupaten pelalawan riau faktor-faktor pelaksanaan posyandu wilayah kerja puskesmas nisam kabupaten aceh utara tahun 2013 hubungan antara perawatan luka perineum penyembuhan luka perineum ibu nifas klinik martua sudarlis mandala medan prosedur pengembalian kelebihan pembayaran pajak penghasilan (pph) atas orang pribadi kantor pelayanan pajak (kpp) pratama medan timur asuhan keperawatan an. k prioritas masalah defisit perawatan diri rsud. dr.pirngadi medan efektifitas metode simulasi pengetahuan sikap ibu persalinan pemberian asi eksklusif kecamatan bilah barat puskesmas suka makmur kabupaten labuhan batu tahun 2013 pengaruh senam osteoporosis peningkatan aktivitas fisik usia lanjut puskesmas glugur kota medan tahun 2013 asuhan keperawatan an. a prioritas masalah kebutuhan dasar rasa nyaman nyeri rsud dr. pirngadi medan gambaran konsep diri narapidana remaja lembaga pemasyarakatan (lapas) anak tanjung gusta medan pengaruh perilaku ibu balita dukungan keluarga pemanfaatan pelayanan imunisasi dasar wilayah kerja puskesmas pandan kabupaten tapanuli tengah tahun 2013 pengalaman pengobatan pasangan infertilitas klinik infertilitas rsud dr. pirngadi medan pengalaman perawat memberikan perawatan paliatif pasien kanker rumah sakit murni teguh medan gambaran konsep diri mahasiswa fakultas keperawatan usu mekanisme koping, kesiapan melaksanakan kolaborasi mahasiswa profesi ners mahasiswa profesi dokter usu kualitas hidup pasien kanker payudara dirawat rumah sakit umum pusat haj adam malik medan pengaruh corporate social responsibility hubungan corporate governance nilai perusahaan perusahaan manufaktur listing bursa efek indonesia faktor- faktor perilaku kunjungan ibu bayi balita posyandu wilayah kerja puskesmas medan johor kelurahan pangkalan masyhur hubungan status gizi prestasi belajar siswa sd negeri 200203 padangsidimpuan hubungan kebiasaan berolahraga tingkat stres mahasiswa fakultas keperawatan universitas sumatera utara analisis kandungan timbal lipstik impor negeri serta tingkat pengetahuan konsumen pedagang lipstik pasar petisah kota medan tahun 2015 asuhan keperawatan ny. s gangguan aman nyaman nyeri post operasi sectio caesaria rsud. dr. pirngadi medan analisis perencanaan obat puskesmas padangmatinggi kota padangsidimpuan tahun 2015 asuhan keperawatan an. a gangguan rasa nyaman nyeri rsud dr. pirngadi medan rusunawa kawasan hamdan terpadu asuhan keperawatan tn.b prioritas masalah kebutuhan dasar personal hygiene rsud dr. pirngadi medan implementasi perbandingan metode geometric mean filter alpha-trimmed mean filter mereduksi exponential noise citra digital keseimbangan rumah perubahan perancangan rumah susun kawasan transit oriented development (tod) belawan pengaruh budaya organisasi fungsi kepemimpinan kinerja perawat pelaksana rumah sakit umum swadana daerah tarutung gambaran ketersediaan pangan status gizi anak balita keluarga perokok desa trans pirnak marenu kecamatan aek nabara barumun kabupaten padang lawas analisis yuridis perlindungan hukum bagi konsumen telepon seluler akibat itikad buruk layanan jasa telekomunikasi (studi putusan mahkamah agung nomor 2995 k/pdt/2012) perlindungan hukum internasional atas pelanggaran ham sukuanakdalamsebagai kaum indigenous indonesia peramalan jumlah beras butuhkan penduduk jumlah produksi padi provinsi sumatera utara tahun 2014-2018 hubungan celebrity worship intensi berpacaran studi fangirl k-pop analisis implementasi kebijakan kawasan tanpa rokok (ktr) rumah sakit umum daerah dr. pirngadi kota medan tahun 2015 pijat bayi oleh pemijat bayi tradisional kecamatan medan area tahun 2014 organisasi perempuan ( aisyiyah kota medan) fenomena berolahraga (studi etnografi ukm beladiri taekwondo usu) penggunaan kata penghubung hǎi shì(还是)dan huò zhě (或者) kalimat bahasa mandarin koran hao bao hubungan pemanfaatan koleksi perpustakaan prestasi belajar mahasiswa politeknik mbp medan studi deskriptif manghirap tondi desa lintong nihuta kecamatan tampahan masyarakat batak toba oleh ibu rotua pardede kajian tekstual musikal analisis kraniofasial antropometri penderita down syndrome usia 5-25 tahun upt. slb-e negeri pembina sumatera utara translation procedures in translating information technology terms in sony ericsson w150i’s user guidebook pengaruh suhu pemanasan lama penyimpanan perubahan kualitas nira aren (arenga pinnata) perbedaan sikap menopause wanita bekerja tidak bekerja analisis kinerja pustakawan layanan sirkulasi perpustakaan universitas muhammadiyah sumatera utara (ditinjau dari persepsi pengguna) perbandingan metode analytic hierarchy process (ahp) simple multi attribute rating technique (smart) menentukan perusahaan asuransi terbaik sistem pendukung keputusan pemilihan rumah sakit berdasarkan kebutuhan pasien menggunakan metode ahp promethee sistem pendukung keputusan penentuan warga miskin metode simple additive weighting (saw) profile matching dashboard information system pengukuran indeks keamanan informasi institusi perguruan tinggi perangkat lunak capture plat nomor polisi mobil algoritma jaringan syaraf tiruan learning vector quantization back propagation berbasis ip camera identity and ideology of toba batak in ―o tano batak‖ song lyrics subtitle film berbahasa prancis “comme un chef” bahasa indonesia variasi transitivitas teks translasional mangupa bahasa mandailing-inggris representasi masyarakat pincalang menghadapi era modernisasi novel pincalang karya idris pasaribu deskripsi fonologi leksikon bahasa ciacia efektifitas metode simulasi pengetahuan sikap remaja putri tentang upaya deteksi dini kanker payudara sadari sma negeri 1 sma citra harapan percut sei tuan kabupaten deli serdang pengalaman nyeri kronis pasien kanker rsup h. adam malik medan faktor-faktor berhubungan pemberian asi eksklusif desa pangirkiran kecamatan halongonan kabupaten padang lawas utara tahun 2015 analisis rujukan puskesmas botombawo kabupaten nias era jaminan kesehatan nasional tahun 2015 analisis pemberian imunisasi hepatitis b (uniject) bayi usia 0-7 hari desa pangirkiran kecamatan halongonan kabupaten padanga lawas utara tahun 2015 implementasi algoritma learning vector quantization weighted product memilih perusahaan tempat berinvestasi religiusitas gay (studi fenomenologis gay beragama islam) kepatuhan perawat pelaksanaan pemasangan kateter urine pemasangan infus rumah sakit umum daerah haji sahuddin persepsi kecemasan mahasiswa menghadapi tugas akhir skripsi fakultas keperawatan usu tahun 2015 hubungan efikasi diri kesiapan interprofessional education (ipe) mahasiswa ilmu keperawatan pendidikan dokter usu hubungan pengetahuan pasangan usia subur (pus) tentang keluarga berencana (kb) pelaksanaan kb kecamatan sei kanan kabupaten labuhanbatu selatan pola hidup pasien kanker payudara selama kemoterapi rsup h adam malik medan proses transesterifikasi minyak kelapa sawit menggunakan novozym® 435 sistem pelarut chcl menghasilkan biodiesel implementasi algoritma k-nearest neighbor mengklasifikasikan motif batik besurek bengkulu pengomposan tandan kosong kelapa sawit menggunakan pupuk organik aktif dari limbah cair pabrik kelapa sawit pengaruh lubang asupan udara dampak pelaksanaan peraturan pemerintah nomor 46 tahun 2013 wajib pajak usaha mikro kecil menengah (umkm) penerimaan pajak penghasilan (pph) pasal 4 ayat 2pada kantor pelayanan pajak pratama lubuk pakam pengaruh kepemimpinan produktivitas kerja pegawai kantor pertanahan kabupaten deli serdang perbandingan prediksi leeway space menggunakan analisis moyers tanaka-johnston murid sekolah dasar suku batak kota medan pengaruh diversifikasi fee based income profitabilitas (roa) bank terdaftar bursa efek indonesia (bei) periode 2009-2013 pengaruh working capital turnover, economic value added, market value added market capitalization bumn terdaftar bei periode 2009-2013 pengaruh implementasi e-spt, implementasi e-filing, sanksi administrasi kepatuhan wajib pajak melaporkan spt masa ppn kpp pratama medan kota pengaruh customer experience minat beli ulang pelanggan xo suki sun plaza medan pengaruh harga kompetitif, kelengkapan barang, lokasi keputusan pembelian toko sepatu davin pajak usu medan pengaruh motivasi persepsi sikap konsumen serta dampaknya keputusan pembelian air minum isi ulang anugrah water mahasiswa universitas sumatera utara pengaruh emosi perilaku komplain konsumen pt. bank xxx medan pengaruh kepercayaan kemudahan belanja online mahasiswa fakultas ekonomi bisnis universitas sumatera utara pengaruh nilai pelanggan (customer value) loyalitas pelanggan (customer loyalty) padarumah makan zam-zam dr. mansyur medan analisis pengaruh kredit usaha rakyat (kur) tingkat produktivitas hasil panen padi kecamatan air putih kabupaten batu bara determinan efisiensi bumd regionalsumatera berdasarkan data envelopment analysis (dea) bank aceh, bank nagari, bank sumut pengaruh penggunaan bahan additive silicafume superplasticizer perilaku fisis mekanis beton mutu tinggi pasca bakar perjanjian sewa menyewa tanah milik pt.kereta api indonesia masyarakat ( desa batang kuis kabupaten deli serdang) formulasi sediaan krim dari ekstrak etanol daun pandan wangi (pandanus amaryllifolius roxb.) sebagai pelembab kulit alami analisis kinerja pustakawan perpustakaan institut agama islam negeri (iain) sumatera utara unsur-unsur detektif novel the tokyo zodiac murders panggung indie medan kajian pengelolaan gaya musik pengaruh penambahan serat polietilen kekasaran permukaan penyerapan air bahan basis gigitiruan resin akrilik polimerisasi panas pengaruh ekstrak stroberi (fragaria ananassa) 5% sebagai obat kumur akumulasi plak mahasiswa fakultas kedokteran gigi usu angkatan 2010 redesign pakaian pelindung dingin pekerja cold storage pt charoen pokphand indonesia food division medan berdasarkan insulation required (ireq) metode value engineering pengujian perhitungan beban panas kotak pendingin menggunakan elemen pendingin termoelektrik sumber energi surya kebiasaan makanan ikan baung (mystusnemurus c.v) sungai bingai binjai provinsi sumatera utara. pengaruh konsentrasi tepung astaxanthin pakan peningkatan warna ikan maskoki (carrasius auratus) induksi tunas mikro tanaman karet (hevea brasiliensis muell. arg) komposisi media genotipe berbeda tanggap tiga varietas kedelai pemberian rhizobium gawangan karet tbm 1 respon pertumbuhan produksi tanaman jagung frekuensi pemupukan pupuk organik cair aplikasi pupuk dasar npk tinjauan yuridis hukum administrasi negara pemungutan pajak hotel kota rantau prapat berdasarkan perda kabupaten labuhanbatu nomor 6 tahun 2011 penetapan kadar mineral besi, magnesium seng daun bangun-bangun (plectranthus amboinicus l.) segar direbus secara spektrofotometri serapan atom perbandingan prediksi leeway space menggunakan analisis moyers tanaka-johnston murid sekolah dasar suku batak kota medan perbedaan kekasaran permukaan enamel gigi penggunaan karbamid peroksida 16% jus buah stroberi (fragaria x ananassa) sebagai bahan pemutih gigi pengaruh antara komunikasi orangtua-remaja teman sebaya perilaku seks pranikah remaja putri smpn mtsn kecamatan tambang riau tahun 2013 keanekaragaman distribusi plankton perairan muara desa belawan i kecamatan medan belawan hubungan antara diabetes melitus tipe ii burning mouth syndrome rumah sakit umum pusat haji adam malik medan penegakan hukum kasus penggelapan premi asuransi (analisis putusan no. 1952/pid.b/2013/pn-mdn) relasi gramatikal bahasa batak toba ancangan tipologi the function of phrasal verbs in short stories found in “hello” magazines rekognisi frasa adposisional bahasa indonesia pertanggungjawaban klien kepada perusahaan factoring pengalihan piutang pedagang ketidakmampuan nasabah mengembalikan kredit btn cabang medan implementasi algoritma floyd warshall menentukan jarak terpendek (medan-bandara kuala namu) analisis pengolahan skripsi elektronik (e-skripsi) sebagai salah satu bentuk dokumen elektronik menggunakan perangkat lunak aplikasi senayan perpustakaan stmik time penetapan kadar betametason valerat krim betason n secara kromatografi cair kinerja tinggi efektivitas koagulan pac(poly aluminium chloride) tawas (alum)terhadap logam besi (fe) air baku pdam tirtanadi hamparan perak perbandingan bilangan peroksida minyak jagung minyak curah metode iodometri analisis kadar besi (fe) air sumur padang bulan medan secara spektrofotometri serapan atom perbandingan efektivitas poly aluminium chloride (pac) tawas menurunkan kadar ammonia nitrogen turbidity 590 ntu metode spektrofotometri dr/2400 penetapan kadar bromazepam tablet secara spektrofotometri ultraviolet analisis perbandingan pendanaan leasing kredit bank pengadaan mesin photo copy pengaruh komisaris independen, komite audit, struktur kepemilikan kinerja keuangan perusahaan sektor keuangan terdaftar bursa efek indonesia (bei) proyeksi nilai penjualan energi listrik pt.pln (persero) cabang medan helvetia tahun 2015 pengaruh budaya organisasi happiness at work pemanfaatan fungi aspergillus flavus, aspergillus terreus trichoderma harzianum meningkatkan pertumbuhan bibit rhizophora mucronata lamk respons pertumbuhan tanaman konsentrasi rantai panjang polyisoprenoid variasi naungan salinitas mangrove sonneratia alba smith pengaruh pendidikan gizi tentang pola makan seimbang melalui game puzzle gambar animasi peningkatan pengetahuan anak sdn 067690 kota medan pengaruh pendidikan pelatihan produktivitas kerja agen jasa asuransi pt. prudential life assurance medan analisis bauran pemasaran meningkatkan penjualan kain tenun tradisional karo trias tambun kabanjahe analisis manajemen risiko ( telkom, kandatel binjai) implementasi peraturan menteri pendidikan kebudayaan republik indonesia no. 59 tahun 2014 tentang kurikulum 2013 sekolah menengah atas/ madrasah aliyah (studi sekolah menengah atas negeri 3 medan) penggunaan natrium tripolifosfat pembuatan nanopartikel kitosan dari cangkang belangkas pengaruh elit politik proses pemekaran daerah (studi analisis pemekaran provinsi sumatera tenggara) analisis ―hasan rohani – figur multitalenta menjadi presiden iran‖ pendekatan wacana kritis persepsi mahasiswa fisip usu video parodi vicky prasetyo zaskia ghotic karya eka gustiwana youtube morphemic shifts in bilingual translation of colleen mc cullough’s the thorn birds and lanny murtihardjana’s burung-burung semak berduri analisis gaya bahasa iklan elektronik produk kosmetik nilai budaya leksikon erpangir ku lau tradisi suku karo (kajian antropolinguistik) partisipasi masyarakat menjaga pelestarian daerah aliran sungai bahorok (studi mayarakat sekitar sungai bahorok desa perkebunan bukit lawang kecamatan bahorok kabupaten langkat) studi deskriptif fungsi komunikasi non verbal emoticon instant messaging kalangan mahasiswa tipe reduplikasi bahasa batak toba cerita ―si tapi mombang haomasan dohot raja bungkal sodugaron‖ konfigurasi modal sosial etnis jawa mendukung keberhasilan pembangunan desa (studi deskriptif desa sena, kacamatan batang kuis, kabupaten deli serdang sumatra utara) pemanfaatan account twitter @anak_usu sebagai sarana informasi hubungan hasil pemeriksaan indocyanin green retensi 15 menit (icg-r15) skor child pugh pasien tumor hati rsup h. adam malik medan korelasi penguasaan paragraf kemampuan pemahaman isi bacaan siswa kelas ix smp negeri 10 medan tahun pembelajaran 2013/2014 analisis link budget pembangunan bts rooftop cemara iv sistem telekomunikasi seluler berbasis gsm pt. telkomsel kedudukan nasabah koperasi simpan pinjam pailitnya koperasi simpan pinjam konflik batin tokoh utama novel saman karya ayu utami pendekatan psikoanalisis sigmund freud potensi masyarakat mengelola koperasi pertambangan emas desa keude krueng sabee, kecamatan krueng sabee, kabupaten aceh jaya pengaruh pemberian berbagai tingkat mikoriza arbuskula tanah ultisol produktivitas tanaman leguminosa pengaruh perilaku wirausaha dukungan keluarga keberhasilan pengusaha kain ( pedagang kain jl. perniagaan pasar ikan lama medan) pengaruh berbagai tingkatan fungi mikoriza arbuskula produktivitas rumput gajah mini (pennisetum purpureum schamach ) tanah ultisol tindak tutur direktif ekspresif dialog film ―alangkah lucunya negeri ini‖ karya deddy mizwar analisis penyebab kerusakan rehabilitasi bendung sunggam kabupaten padang lawas utara-sumatera utara trio musik populer batak toba analisis sejarah, fungsi, struktur musik pendugaan produktivitas pohon pakan orangutan sumatera (pongo abelii) kawasan pusat pengamatan orangutan sumatera (ppos), bukit lawang indonesian – english code switching and code mixing found in the novel ―kamar cewek‖ inkorporasi pelesapan verba bahasa mandailing analisis pemilihan moda antara bus kereta api ( medan – tanjungbalai) analisis fosfor cacing tanah (megascolex sp. fridericia sp.) secara spektrofotometri sinar tampak penggunaan tepung limbah udang pengolahan filtrat air abu sekam fermentasi em-4 kapang trichoderma viride ransum karkas lemak abdominal ayam broiler penggunaan pelepah daun kelapa sawit perlakuan fisik, kimia, biologi kombinasinya performans domba lokal jantan strategi peningkatan produksi jagung desa kineppen kecamatan munthe kabupaten karo pengaruh pupuk kandang kelinci pupuk urea ketersediaan n-total pertumbuhan tanaman jagung ( zea mays l. ) tanah inceptisol kwala bekala shelley segal’s rebellion against religious institutions in an atheist album jean baptiste grenouille’s psychological disorder as an impact of social problems in patrick süskind’s perfume the story of a murderer perbedaan inklinasi insisivus pasien maloklusi klas i klas ii skeletal pola pernafasan normal pernafasan melalui mulut efek antibakteri ekstrak etanol daun afrika (vernonia amygdalina) sebagai bahan alternatif medikamen saluran akar porphyromonas gingivalis (in vitro) prediksi leeway space menggunakan metode tanaka-johnston murid sekolah dasar suku batak kota medan prevalensi maloklusi berdasarkan relasi skeletal kasus pencabutan non-pencabutan klinik ppdgs ortodonti fkg usu persepsi pengusaha kota medan tentang kebijakan bank indonesia tentang lindung nilai (hedge) pengaruh pelaksanaan audit manajemen produktivitas sumber daya manusia ( pt. bank sumut pusat) pengaruh brand image word of mouth brand preference meningkatkan loyalitas konsumen brownies amanda mahasiswa program studi manajemen fakultas ekonomi bisnis universitas sumatera utara pengaruh karaktetistik individu, karakteristik pekerjaan karakteristik situasi kerja kinerja karyawan pt. perkebunan sumatera utara unit kebun patiluban mandailing natal pengaruh kepercayaan gaya hidup keputusan membeli produk secara online berbasis gender masyarakat kecamatanmedan baru kota medan analisis pengaruh experiential marketing,perceived quality advertising keputusan pembelian produk luwak white koffie mahasiswa fakultas ekonomi bisnis universitas sumatera utara analisis daya saing usaha ekonomi kreatif kota medan kajian koefisien rembesan saluran irigasi penampang trapesium tanah latosol skala laboratorium sistem pendukung keputusan pendugaan kebutuhan rice milling unit (rmu) kotamadya pematangsiantar pelaksanaan eksekusi jaminan perseorangan debitor wanprestasi perjanjian kredit pt. bank xxxx medan pengembangan mata air aek manik sebagai kawasan objek wisata kabupaten simalungun pengaruh locus of control (loc) organizational citizenship behaviour (ocb) karyawan ptpn iv unit ajamu sikap jinamee tinggi masyarakat aceh peran al washliyah pendidikan politik sumatera utara efektifitas proses elektrokoagulasi penurunan kadar besi air sumur tradisi masyarakat desa janji mauli kecamatan sipirok kabupaten tapanuli selatan (1900-1980) pengaruh camel & indeks corporate governace nilai perusahaan perbankan terdaftar bursa efek indonesia analisis simulasi keefektifan alat penukar kalor tabung sepusat variasi kapasitas aliran fluida panas, kapasitas aliran fluida dingin, suhu masukan fluida panas aliran sejajar analisis simulasi keefektifan alat penukar kalor tabung sepusat aliran berlawanan variasi temperatur air panas masuk kapasitas aliran konstan tinjauan yuridis kasus pengusiran pencari suaka australia menurut hukum internasional daya terima beras analog dari tepung ubi kayu sebagai pangan pokok desa tanjung beringin kecamatan sumbul kabupate dairi tahun 2014 analisis volatilitas nilai tukar rupiah suku bunga indonesia pengaruh social support resiliensi ibu tunggal analisis penawaran permintaan kredit investasi indonesia studi eksperimental kuat lentur balok beton bertulang perkuatan baja ringan profil u daerah tarik perananan lembaga adat pakpak sulang silima marga ujung masyarakat kecamatan sidikalang (1994 – 2004) perencanaan kebutuhan kapasitas produksi pt. pusaka prima mandiri pengaruh kosentrasi perekat permeabilitas kuat geser (shear strength) pasir cetak industri pengecoran logam strategi buruh mempertahankan hidup ( pt.putra mandiri kelurahan bukit sofa kecamatan siantar sitalasari kota pematang siantar) pengaruh sistem informasi pelayanan santunan kecelakaan kepuasan klaimen (studi kantor pt. jasa raharja (persero) cabang sumatera utara) peningkatan kualitas perempuan parlemen ( fraksi golkar dprd kabupaten labuhanbatu periode 2014-2019) analisis kebijakan politik pangan sby-boediono tahun 2009-2014 pemilihan anti nyamuk ditinjau dari tingkat pendidikan, pendapatan perilaku serta keluhan kesehatan keluarga kelurahan asam kumbang kecamatan medan selayang tahun 2015 analisis kejadian cuaca ekstrim wilayah sumatera utara berdasarkan indeks peringatan dini hubungan motivasi kerja kinerja petugas kia puskesmas kota binjai tahun 2015 proses transesterifikasi minyak sawit menggunakan novozyme® 435 menghasilkan biodiesel sawit analisis pengaruh lingkungan kerja, disiplin tunjangan profesi guru kinerja guru dinas pendidikan kabupaten toba samosir pembuatan etil ester sebagai biodiesel dari crude palm oil menggunakan katalis choline hydroxide redesain permukiman relokasi masyarakat gunung sinabung wahana rekreasi tembakau deli implementasi metode naive bayes menentukan posisi ideal pemain sepakbola berbasis android ( talenta soccer rantauprapat) implementasi augmented reality pembelajaran sel hewan platform android intensitas nyeri luka sectio caesarea kualitas tidur pasien pasca salin hari ke-2 rsup h.adam malik medan trauma tembus mata traumatic optic neuropathy management of traumatic ptosis with multiple cicatrics on the right upper eyelid and frontal region analisis netralitas uang inflasi output riil jangka panjang indonesia katarak traumatika analisis awal kelayakan ekonomi finansial perencanaan monorel kota medan intraocular foreign bodies analisis daya dukung pondasi bored pile diameter 0,8 meter menggunakan metode analitis metode elemen hingga proyek pembangunan hotel sapadia medan rancang bangun kolektor surya sebagai pengsasil fluida panas alat pengering hibrida pompa kalor surya pengaruh perbandingan tepung terigu berbagai jenis mocaf karakteristik fisik, kimia, sensori flat wafer analisis faktor-faktor mempengaruhi kepatuhan wajib pajak orang pribadi kantor pelayanan pajak pratama medan polonia analisis finansial usahatani jeruk nipis (citrus aurantifolia) desa marjanji, kecamatan sipispis, kabupaten serdang bedagai analisis pengelolaan usahatani tebu sistem tebu rakyat intensifikasi (tri) desa bulu cina kecamatan hamparan perak kabupaten deli serdang tinjauan yuridis pembatalan pernikahan akibat menggunakan dokumen/keterangan palsu ( putusan pengadilan agama medan no. 776/pdt.g/2009/pa/mdn) pengaruh konsentrasi tepung wortel (daucus carota) pakan peningkatan warna ikan maskoki (carassius auratus) asuhan keperawatan ny. s gangguan aman nyaman nyeri post sectio caesaria rsud dr. pirngadi medan survei pengaruh budidaya tanaman kelapa persentase serangan oryctes rhinoceros l. (coleoptera;scarabaeidae) kecamatan hamparan perak respons pertumbuhan bibit mucuna (mucuna bracteata d.c) secara stek media tanam limbah kelapa sawit mikoriza asuhankeperawatanpada an.a gangguan kebutuhan dasar oksigenasi rsud.dr.pirngadi medan tahun 2014 perbuatan melawan hukum akibat merusak segel meteran milik pt. pln ( putusan mahkamah agung no.694 k/pdt/2008) perkembangan akar bibit rhizophora mucronata lamk berbagai intensitas naungan pertanggungjawaban hukum perusahaan angkutan penumpang bus kecelakaan (studi cv. paradep taxi) perlindungan hukum perjanjian kredit jaminan surat keputusan pengangkatan anggota dewan perwakilan rakyat daerah kota medan (studi bank sumut pusat) penyisipan pesan gambar menggunakan pixel indicator technique (pit) pseudo random number generator (prng) hubungan karateristik persepsi masyarakat tentang jaminan kesehatan nasional (jkn) keikusertaan menjadi peserta jkn kota medan tahun 2014 pengaruh komitmen organisasional, penjualan adaptif , orientasi smart-working kepuasan hubungan kerja kreativitas strategi pemasaran meningkatkan kinerja bisnis ibo multi level marketing pt oriflame indonesia medan aplikasi teknik relaksasi otot progresif mengatasi masalah nutrisi asuhan keperawatan pasien kanker payudara menjalani kemoterapi rindu b2a rsup haji adam malik medan analisis faktor-faktor memengaruhi keputusan konsumen membeli koran sindo pt. media nusantara informasi biro medan aplikasi terapi murottal asuhan keperawatan pasien pre operasi fraktur kecemasan ruang rindu b3 rsup.ham medan gambaran dukungan keluarga memenuhi kebutuhan spiritual pasien stroke rumah sakit umum pusat haji adam malik medan terjemahan istilah budaya novel negeri 5 menara ke bahasa inggris the land of five towers sistem pakar mendiagnosis penyakit sinusitis menggunakan algoritma certainty factor forward chaining gambaran rentang gerak sendi ekstremitas bawah pasien immobilisasi mengalami gangguan sistem saraf rsup h. adam malik medan the portrayal of dictatorship as reflected in george orwell’s novel “nineteen eighty-four” gambaran kemiskinan novel sepatu dahlan karya khrisna pabhicara pendekatan sosiosastra pengaruh brand association terhdap customer responses produk pond’s carrefour citra garden medan analisis faktor-faktor mempengaruhi penahanan aset likuid sebagai dasar penerapan basel iii sektor perbankan analisis perhitungan daya dukung aksial pondasi tiang bor tunggal diameter 0,6 meter menggunakan data sondir, spt, uji beban statik, pda proyek pembangunan hotel sapadia medan analisis pengurangan waste time pendekatan lean manufacturing proses produksi pt. pancakarsa bangun reksa perencanaan aktivitas distribusi menggunakan metode drp (distribution resource planning) efisiensi biaya distribusi perancangan fasilitas kerja bagian produksi pt. mewah indah jaya menggunakan macroergonomic analysis and design (mead) pengaruh persepsi iklim kelas penggunaan strategi self- regulated learning siswa kelas x xi unggulan sma negeri 3 medan pengaruh motivasi berprestasi serious cyberloafing pt. pos indonesia (persero) kantor regional i medan respon pertumbuhan konsentrasi rantai panjang polyisoprenoid cekaman garam mangrove sonneratia alba smith pengaruh rasio komposisi semen partikel kualitas papan semen partikel dari limbah industri pensil kualitas papan semen dari limbah industri pensil berbagai komposisi bahan baku konsentrasi katalis faktor-faktor berhubungan komunikasi interpersonal tenaga kesehatan kepuasaan pasien rawat jalan puskesmas pandan kabupaten tapanuli tengah tahun 2014 reses kebijakan pemerintah ( studi analisis (hasil reses sebagai rujukan pembuatan kebijakan kota gunungsitoli) peran kerapatan adat nagari ( kan ) pembangunan nagari ( studi nagari baringin kecamatan lima kaum, kabupaten tanah datar ) strategi dinas pendapatan pengelola keuangan kekayaan daerah (dppkkd) kabupaten toba samosir meningkatkan pendapatan asli daerah melalui penerimaan pajak hotel studi perbandingan kandungan besi (fe) aluminium didalam air minum diproduksi oleh pdam tirtanadi unit cabang produksi cabang sei agul, medan labuhan sunggal medan pengaruh pemberian tugas oleh guru kepada siswa pemanfaatan koleksi perpustakaan madrasah aliyah negeri (man) 1 medan analisis keberadaan candida albicans aspergillus spp. serta keluhan kesehatan perilaku penjual tentang bahaya kesehatan pakaian bekas pasar melati kelurahan tanjung selamat kecamatan medan tuntungan kota medan tahun 2015 restore the forgotten history in royale heritage sistem pendukung keputusan penentuan mata pelajaran lintas minat kurikulum 2013 menggunakan algoritma weighted product analytical hierarchy process pelaksanaan pengelolaan sampah partisipasi pedagang menjaga kebersihan lingkungan pasar terapung kec. tembilahan kota kab. indragiri hilir riau tahun 2015 karakteristik penderita mioma uteri rawat inap rumah sakit tentara tk-iv 01.07.01 pematangsiantar tahun 2014 sistem pakar diagnosis penyakit systemic lupus erythematosus (sle) menggunakan metode certainty faktor backward chaining gambaran perilaku masyarakat pola pencarian pengobatan desa doloksaribu lumban nabolon, kecamatan uluan kabupaten toba samosir tahun 2015 sistem pakar menentukan alat kontrasepsi pasangan suami istri menggunakan metode bayes forward chaining sistem pakar mendiagnosa hama penyakit tanaman karet menggunakan metode dempster shafer forward chaining analisis perilaku stakeholders tingkat desa tentang pengembangan desa siaga aktif kabupaten deli serdangtahun 2013 pengaruh faktor sosiodemografi, sosioekonomi kebutuhan perilaku masyarakat pencarian pengobatan kecamatan medan kota tahun 2013 determinan pemanfaatan buku kesehatan ibu anak (kia) ibu bayi wilayah kerja puskesmas balige kabupaten toba samosir tahun 2013 an analysis of the main characters’ conflicts in browns’s novel “the da vinci code” penanaman kesantunan masyarakat angkola-mandailing tinjauan antropolinguistik the correlation between self-esteem to the students’ speaking achievement faktor-faktor memengaruhi laju kesembuhan penderita typhus abdominalis dirawat inap rsud dr.pirngadi medan tahun 2014 kalimat koordinasi bahasa batak toba sebuah ancangan tipologi sintaksis proses tipologi bahasa mandailing hubungan kualitas kehidupan kerja komitmen afektif perawat rsud dr. pirngadi medan an analysis of the second year students at smp swasta muhamamdiyah 5 medan in using passive voice aspektualitas bahasa jawa desa bandar tengah kecamatan bandar khalipah peran perawat memberikan asuhan keperawatan anak ruang inap anak rsup haji adam malik medan linguistik problema translasi hubungan percaya diri pengendalian diri (selfcontrol) remaja siswa/i sma negeri 17 medan an analysis on contrastive negation in english and indonesian tingkat pengetahuan sikap perawat tentang pengurangan bahaya fisiologis imobilisasi pasien stroke ruang ra4 rsup h. adam malik medan aktivitas self care pasien diabetes melitus rsup h. adam malik medan pengaruh good corporate governance ukuran perusahaan kinerja perusahaan manufaktur terdaftar bei analisis konflik watak tokoh utama novel “bekisar merah” karya ahmad tohari karakteristik penderita thalassemia rsu sari mutiara medan tahun 2012-2014 pergeseran bahasa permainan tradisional mandailing kajian ekolinguistik pengaruh gaya hidup, harga, kelompok referensi keputusan pembelian samsung smartphone mahasiswa/i fakultas ekonomi universitas sumatera utara hotel kawasan wisata sejarah tembakau deli an error analysis in using tenses made by the third year students of smk 7 medan analisis perbedaan return saham , trading volume activity variance sebelum sesudah stock split ( perusahaan terdaftar bursa efek indonesia periode 2011-2013) tradisi thedak siten jawa pengembangan karakter studi kualitatif pemenuhan gizi ibu hamil wilayah kerja puskesmas mencirim kecamatan sunggal kabupaten deliserdang tahun 2013 museum pusat komunitas seni tembakau deli the reading comprehension ability of sma student (the case of the second year students sma negeri 1 gebang langkat academic year 2013/2014) keanekaragaman makrozoobentos perairan sungai asahan sumatera utara prilaku sifat mausuf hubungan sintaksis bahasa arab pengaruh penambahan kutub bantu motor arus searah penguatan seri shunt memperkecil rugi-rugi engagement with the water motivasi intrinsik, kecerdasan ganda, sikap kemampuan berbahasa indonesia siswa keturunan tionghoa hubungan kinerja kader posyandu, karakteristik partisipasi ibu status gizi balita kecamatan bandar kabupaten bener meriah lexical semantic in angkola language analisis pengaruh iklim organisasi motivasi kerja kinerja dosen kepuasan kerja sebagai variabel intervening politeknik negeri medan analisis kepribadian tokoh utama novel empress orchid karya anchee min berdasarkan psikologi sastra determinan pemanfaatan pelayanan rawat jalan puskesmas batang toru kecamatan batang toru kabupaten tapanuli selatan tahun 2015 kearifan lokal novel pincalang karya idris pasaribu (sebuah kajian sosiologis) kriteria kepuasan penghuni hunian sewa 9rumah kost) mahasiswa sekitar kawasan universitas sumatera utara karakteristik psikometri subtes rechenaufgaben (ra) versi revisi intelligenz struktur test (ist gambaran self-efficacy mahasiswa universitas sumatera utara berasal dari papua analisis link budget pembangunan bts rooftop cemara iv sistem telekomunikasi seluler berbasis gsm pt. telkomsel kedudukan nasabah koperasi simpan pinjam pailitnya koperasi simpan pinjam konflik batin tokoh utama novel saman karya ayu utami pendekatan psikoanalisis sigmund freud pengaruh pemberian berbagai tingkat mikoriza arbuskula tanah ultisol produktivitas tanaman leguminosa pengaruh berbagai tingkatan fungi mikoriza arbuskula produktivitas rumput gajah mini (pennisetum purpureum schamach ) tanah ultisol penggunaan pelepah daun kelapa sawit perlakuan fisik, kimia, biologi kombinasinya performans domba lokal jantan tata cara pengembalian kelebihan pembayaran pajak pertambahan nilai kantor pelayanan pajak paratama medan petisah sistem infromasi akuntansi pemberian kredit multi guna sumut kcp setia budi pengendalian internal prosedur penerimaan pengeluaran kas pt taspen kcu medan 'cerita kampus’ pemuasan kebutuhan followers akun twitter usukom fm medan implementasi peraturan walikota medan nomor 20 tahun 2011 penerbitan ijin usaha minimarket implementasi layanan rakyat sertifikasi tanah (larasita) kantor pertanahan kota binjai analisis faktor risiko pasien mioma uteri rsup. h. adam malik medan rs jejaring hubungan pengetahuan remaja putri tentang dismenore motivasi periksa ke pelayanan kesehatan smu ypsa- medan sikap keterampilan perawat penerapan tindakan triage igd rsud dr. pirngadi medan faktor-faktor memengaruhi bidan penanganan perlengketan plasenta ibu bersalin kecamatan padang bolak kabupaten padang lawas utara tahun 2012 implementasi algoritma genetik penjadwalan perkuliahan praktikum ( fasilkom-ti fmipa usu) sistem pendukung keputusan penentuan kelayakan calon tenaga kerja indonesia (tki) ke luar negeri menggunakan metode simple additive weighting (saw) simple multi-attribute rating augmented reality perabotan rumah tangga berbasis android implementasi kebijakan peraturan daerah kota medan no 5 tahun 2012 penerbitan izin mendirikan bangunan kota medan smartphone android mengontrol perangkat keamanan sepeda motor berbasis mikrokontroler promini fungsi pesta luhutan bolon tugu raja silahisabungan mempertahankan integrasi sosial pomparan raja silahisabungan ( masyarakat silalahi nabolak, kecamatan silahisabungan, kabupaten dairi) implementasi algoritma brute force algoritma knuth-morris-pratt (kmp) pencarian word suggestion gambaran perilaku ibu pemanfaatan kms status gizi baduta wilayah kerja puskesmas lawe perbunga kecamatan babul makmur kabupaten aceh tenggara tahun 2015 perbedaan stres kerja ditinjau dari sistem kerja shift perawat rsuph adam malik medan implementasi program keluarga berencana puskesmas tanjung beringin kecamatan hinai kabupaten langkat tahun 2015 implementasi penanganan pneumonia balita manajemen terpadu balita sakit (mtbs) puskesmas bandar khalipah kecamatan percut sei tuan kabupaten deli serdang tahun 2015 geopark kaldera toba peran asuransi kredit mengatasi kredit macet perbandingan keakuratan antara c – reaktif protein hitung leukosit mendiagnosis radang apendiks akut anak rumah sakit pendidikan fk usu rancangan implementasi model prabayar berbasis web menggunakan bahasa pemrograman php memanfaatkan chillispot, freeradius mysql pengaruh motivasi kompetensi bidan kualitas pelayanan kesehatan ibu hamil unit pelaksana teknis dinas (uptd) puskesmas kabupaten aceh barat pengelolaan pelayanandan asuhan keperawatan klien gangguan sistem persarafan stroke haemoragik ruang rindu a4 neurologi rsup h adam malik medan daya terima brownies tepung biji kecipir kandungan gizinya analisis faktor-faktor mempengaruhi penerimaan pajak pertambahan nilai indonesia induksi tunas tanaman nilam (pogostemon cablin benth.) pemberian α-benzil amino purina α-asam asetat naftalena secara in –vitro analisis kandungan kadmium (cd), timbal (pb) formaldehid beberapa ikan segar kub(kelompok usaha bersama) belawan, kecamatan medan belawan tahun 2015 seleksi in vitro menggunakan peg beberapa varietas tomat kondisi cekaman kekeringan hubungan iklim (curah hujan, suhu udara, kelembaban udara kecepatan angin) kejadian diare kota jakarta pusat periode tahun 2004-2013 pengaruh pengetahuan pimpinan tentang anggaran, pengalaman kerja latar belakang pendidikan pengawasan keuangan gaya kepemimpinan sebagai variabel moderating upaya polri menanggulangi tindak pidana perjudian toto gelap (togel) kalangan masyarakat tindakan irigasi perawatan saluran akar dilakukan oleh dokter gigi umum kota medan tahun 2015. profil kadar vitamin e plasma berbagai derajat keparahan akne vulgaris rumah sakit umum pusat haji adam malik medan kekerasan permukaan resin komposit nanohybrid setelah perendaman obat kumur mengandung alkohol 21% prevalensi trauma gigi sulung anterior anak usia 1- 4 tahun tk, paud posyandu kecamatan medan maimun medan perjuangan. eksekusi hak tanggungan sebagai konsekuensi jaminan kredit perlindungan hukum bagi kepentingan kreditur medan legenda nilam baya bagi masyarakat melayu batubara kajian fungsi pengaruh kualitas pelayanan loyalitas pelanggan melalui kepuasan pelanggan bt/bs bima medan profil kadar leptin serum berbagai derajat keparahan pasien psoriasis vulgaris rumah sakit umum pusat haji adam malik medan analisis kandungan timbal (pb) ketengikan minyak goreng digunakan berulang serta perilaku para pedagang gorengan persimpangan kelurahan kenangan perumnas mandala kecamatan percut sei tuan tahun 2015 pengaruh atribut produk sikap konsumen keputusan pembelian produk luwak white koffie mahasiswa fakultas teknik universitas sumatera utara karakteristik penderita penyakit appendicitis rawat inap rumah sakit haji medan tahun 2007-2011 to live deli’s wonder-land perancangan menara ya’ahowu pusat perbelanjaan sebagai landmark kawasan ekonomi khusus idealand, teluk dalam-nias selatan mekanisme penyelesaian sengketa oleh association of southeast asian nations (asean) penyelesaian sengketa antar negara anggota asean. karakterisasi simplisia skrining fitokimia serta uji aktivitas antioksidann ekstrak etanol daun cincau perdu penentuan ekivalensi mobil penumpang simpang tiga tak bersinyal atas dasar kinerja arus lalu lintas ( simpang jalan jamin ginting menuju jalan bunga lau) karakteristik ibu pasangan usia subur mengalami abortus rumah sakit santa elisabeth medan tahun 2010-2013 sekolah national plus kawasan terpadu hamdan implementasi algoritma affine cipher algoritma advanced encryption standard (aes) aplikasi short message service (sms) berbasis android pengaruh pertumbuhan ekonomi, pendapatan asli daerah (pad), dana alokasi umum (dau) pengalokasian anggaran belanja modal pemerintahan kabupaten/kota provinsi sumatera utara pengaruh pergantian manajemen, biaya audit, reputasi audit, opini audit kesulitan keuangan pergantian auditor secara sukarela (studi empiris perusahaan manufaktur terdaftar bei tahun 2012-2013) peran pelayanan perpustakaan keliling kantor perpustakaan arsip dokumentasi serdang bedagai pengaruh iklim sekolah school connectedness siswa sma harapan i medan sistem pendukung keputusan pemilihan jurusan kelas metode weighted sum model (wsm) & weighted product model (wpm) berbasis android ( ; sma negeri 1 tebing tinggi) hubungan tipe kepribadian extroversion agreeableness kecenderungan perilaku prososial suku batak toba pengaruh sikap perubahan organisasi komitmen organisasi pengurus partai keadilan sejahtera kota medan gambaran optimisme suami mengalami cacat struktur komunitas makrozoobenthos danau pondok lapan kecamatan salapian kabupaten langkat struktur komunitas plankton danau pondok lapan desa naman jahe kecamatan salapian kabupaten langkat tindakan eksploitasi sumber daya perikanan wilayah laut zee oleh kapal asing menurut hukum internasional analisis yuridis mengenai kewajiban pajak pelaku usaha perdagangan elektronik jejaring sosial status perjanjian internasional antara indonesia asean pendirian sekretariat asean jakarta terkait host country agreement (hca) tinjauan yuridis tentang peranan direktorat jenderal bea cukai kelancaran lalu lintas barang ekspor impor (studi kantor pengawasan pelayanan direktorat jenderal bea cukai tipe madya pabean belawan) pengaruh pemutaran film kb perilaku partisipasi masyarakat ber-kb kabupaten aceh singkil tahun 2014 stereotip antara masyarakat lokal masyarakat pendatang gampong keude matangglumpang dua, kecamatan peusangan, kabupaten bireuen disharmonis penghuni rumah susun sederhana sewa (rusunawa) kota tebing tinggi “ninja sawit” desa mariah jambi kecamatan jawa maraja bah jambi kabupaten simalungun sumatera utara karakteristik perkembangan anakan kuntul besar (egretta alba) kuntul kecil (egretta garzetta) kawasan tambak tanjung rejo sumatera utara studi kantung semar (nepenthes spp.) kawasan hutan batang toru blok barat kabupaten tapanuli utara sumatera utara studi tumbuhan anggrek kawasan hutan batang toru blok barat kabupaten tapanuli utara sumatera utara analisis evaluasi kinerja pembangunan ekonomi kabupaten / kota pemekaran sumatera utara analisa daya dukung pondasi bore pile menggunakan metode analitis ( proyek pembangunan manhattan mall condominium) perbandingan analisa besar daya dukung pondasi bore pile menggunakan metode elemen hingga metode analitik metode loading test ( proyek pembangunan manhattan mall condominium) analisa nilai waktu perjalanan penumpang angkutan umum kota medan menggunakan random regret minimization ( rute rencana pembangunan monorel kota medan) respon pertumbuhan stump karet (hevea brassiliensis muell arg.) pemberian growtone berbagai komposisi media tanam pengkajian peluang konsentrat limbah cair abu boiler pabrik kelapa sawit sebagai sumber unsur hara tanah ultisol valuasi ekonomi hutan tele masyarakat kabupaten samosir analisis pengaruh atribut produk (merek, kualitas, kemasan) keputusan pembelian rokok marlboro mahasiswa fakultas ekonomi bisnis universitas sumatera utara transformasi digital sebagai proses pelestarian naskah kuno minangkabau badan perpustakaan kearsipan provinsi sumatera barat efektivitas diseminasi informasi repository perpustakaan universitas negeri padang analisis kualitas pelayanan menggunakan metode libqual+tm perpustakaan umum gunung bungsu sumatera barat evaluasi aplikasi sistem informasi arsip (sia) kantor pusat komputer universitas negeri padang analis cemaran fluorida sianida air sungai deli secara spektrofotometri visibel pengaruh pemberian post chlorination pertumbuhan mikroba air telah diolah peranan camat menningkatkan penerimaan pajak bumi bangunan kecamatan stabat, kabupaten langkat faktor-faktor mempengaruhi jumlah kriminalitas berdasarkan jenis tindak kriminalitas kabupaten deli serdang tahun 2009 – 2013 implementasi algoritma levenshtein distance algoritma knuts morris pratt fitur word complete search engine implementasi algoritma levenshtein distance boyer moore fitur autocomplete autocorrect aplikasi katalog perpustakaan daerah aceh timur penerapan metode ahp fdm pemilihan rancangan rumah tekstur minimalis berbasis web sistem pakar mendeteksi psikopat seseorang menggunakan metode dempster shafer certainty factor perbandingan metode simple additive weighting (saw) weighted product model (wpm) pemberian jaminan kesehatan masyarakat sistem pendukung keputusan perangkingan penerima bsm metode simple additive weighting (saw) weighted product model (wpm) implementasi metode straight ahead and pose to pose pembuatan kartun 2d “global warning” kajian perilaku struktur rangka berpengaku eksentrik tipe-d inovasi pengaku badan elemen link analisis hukum ketentuan fakta materil perspektif hukum pasar modal indonesia analisis atas keterlambatan distribusi bbm ( pt sekawan jaya wisesa) desain routing information protocol jaringan kamputer pengalokasian jumlah host per jaringan berdasarkan vlsm gambaran identitas etnis remaja memiliki orang tua berbeda etnis batak-minang kota medan hubungan kondisi fisik rumah pekerjaan kejadian tuberkuloso paru desa bandar khalipah kecamatan percut sei tuan tahun 2015 karakteristik penderita gangguan jiwa penyalahgunaan napza (narkotika, psikotropika, zat adiktif) panti sosial pamardi putra “insyaf” sumatera utara tahun 2014 hubungan status gizi asupan energi kelelahan kerja pekerja pt. perkebunan nusantara i pabrik kelapa sawit pulau tiga tahun 2015 analisis kadar residu pestisida sayuran serta tingkat perilaku konsumen sayuran beredar pasar tradisional pringgan kecamatan medan baru tahun 2015 karakteristik penderita penyakit diabetes mellitus kompliksi dirawat inap rumah sakit martha friska tahun 2014 hubungan karakteristik motivasi kerja kinerja bidan desa pelayanan kb wilayah kerja puskesmas kampung mesjid kecamatan kualuh hilir kabupaten labuhanbatu utara tahun 2015 transformasi bentuk arsitektural rumah tinggal suku karo dynamic connections perbandingan daya dukung tiang pancang tunggal diameter 0,6 meter berdasarkan perhitungan analitis metode elemen hingga (proyek pembangunan jalan bebas hambatan medan – kualanamu) analisis kapasitas daya dukung tiang pancang tunggal panjang tiang 21 meter diameter 0,6 meter secara analitis metode elemen hingga (proyek pembangunan jalan bebas hambatan medan – kualanamu lokasi jembatan sei batu gingging sta. 41 + 630) prediksi produksi panen kelapa sawit menggunakan jaringan saraf radial basis function (rbf) game adaptasi bekel berbasis android efektifitas ekstrakkulit duku ( lansiumdomesticum) sebagai insektisida nabati membunuh nyamuk aedesspp tahun 2014 analisa tiga dimensi rekayasa penempatan posisi damper struktur multistory frame tipe pengaku bracing analisis kompresi citra digital metode fraktal fungsi anggaran sebagai alat perencanaan pengawasan biaya operasional yayasan kesehatan telkom area i sumatera evaluasi kualitas fungsi auditor internal meningkatkan efektivitas pengendalian internal bank ( bank permata cabang medan) hubungan locus of control penyesuaian diri mahasiswa tingkat pertama universitas sumatera utara perbedaan adversity quotient antara siswa pribumi sekolah pembauran siswa pribumi sekolah negeri kota medan hubungan paparan kebisingan karakteristik operator spbu tekanan darah kecamatan medan sunggal tahun 2015 pengaruhbauran promosi kartu kredit anz meningkatkan volume penjualan bistronomix cafe medan deli pengaruh kualitas produk merek keputusan pembelian smartphone merek iphone mahasiswa ilmu administrasi niaga/bisnis fisip usu perkembangan kepribadian anak masa pubertas homeschooling primagama perempuan lembaga pemasyarakatan ( studi deskriptif perempuan lembaga pemasyarakatan) program tayangan sepakbola liga inggris tindakan menonton kalangan babes (studi korelasional antara program tayangan sepakbola liga inggris tindakan menonton kalangan babes (perempuan penggemar sepakbola) anggota fans club chelsea indonesia suporters club (cisc) regional medan united indonesia (ui) regional medan) pengaruh insentif kinerja pegawai (pada kantor kementerian agama kota medan) pengaruh gaya kepemimpinantransformasional kinerja karyawan perusahaan daerah air minum (pdam) tirtanadi kota medan kantor cabang padangbulan implementasi strategi pengendalian pertumbuhan penduduk badan pemberdayaan perempuan keluarga berencana (bppkb) kecamatan kabanjahe kabupaten karo implementasi program pembinaan anak jalanan kota medan dinas sosial ketenagakerjaan kota medan pengaruh transfer pemerintah pusat belanja modal pemerintah kabupaten/kota sumatera utara tahun 2011-2013 pemberian larutan jahe merah (zingiber officinalle var rubra) metode pengolahan berbeda bobot karkas ayam broiler terinfeksi eimeria tenella pemberian larutan jahe merah (zingiber officinale var rubra) metode pengolahan berbeda performans ayam broiler terinfeksi eimeria tenella struktur komunitas nekton danau pondok lapan kecamatan salapian kabupaten langkat kajian morfometri danau pondok lapan desa nama jahe kecamatan salapian kabupaten langkat analisis kualitas air beban pencemaran danau pondok lapan kecamatan salapian kabupaten langkat pengaruh motivasi kerja, kepuasan kerja, kejelasan sasaran anggaran, partisipasi anggaran, akuntabilitas publik kinerja manajerial bappeda provinsi sumatera utara pengaruh stock split financial ratio harga saham perusahaan terdaftar bursa efek indonesia periode 2011-2013 pengaruh konsep diri, pembelajaran kewirausahaan lingkungan keluarga minat berwirausaha mahasiswa prodi manajemen fakultas ekonomi bisnis usu tahun 2011 pengaruh self esteem kecerdasan emosi keberhasilan usaha toko grosir eceran kawasan padang bulan medan pengaruh publikasi program corporate social responsibility periklanan peningkatan minat beli konsumen produk air mineral aqua pengaruh konflik kejenuhan kepuasan kerja karyawan melalui motivasi karyawan pt. tolan tiga indonesia medan analisis pengaruh pendapatan usahatani kopi tingkat kesejahteraan masyarakat ( kabupaten aceh tengah kabupaten bener meriah) analisis dampak fluktuasi harga bbm usaha penangkapan ikan kapal motor (kasus kecamatan sarudik, kabupaten tapanuli tengah) fungsi fisik mangrove sebagai penahan abrasi pesisir kota medan provinsi sumatera utara pengaruh konsentrasi lama perendaman asam sulfat (h2so4) viabilitas benih delima (punica granatum l.) tinjauan yuridis tentang pembagian kekayaan dari yayasan kepada organ yayasan ditinjau dari undang-undang nomor 16 tahun 2001 jo undang-undang nomor 28 tahun 2004 pertanggungjawaban pidana pengguna ijazah palsu pemilihan kepala desa kabupaten langkat (studi putusan pn no.197/pid.b/2011/pn.stb, pt no.431/pid/2011/pt.mdn, ma-ri no.579k/pid/2012) tinjauan yuridis perjanjian kerjasama electronic data capture antara bank pedagang (merchant) menurut kuh perdata pbi nomor 16/8/pbi/2014 (studi pt. bank negara indonesia, tbk medan) perkembangan gratifikasi sebagai tindak pidana korupsi menurut undang-undang tentang pemberantasan tindak pidana korupsi indonesia hubungan induk perusahaan anak perusahaan kaitannya larangan praktik monopoli persaingan usaha tidak sehat indonesia menurut uu no. 5 tahun 1999 formulasi uji efek anti-aging krim ekstrak serat mesokarp kelapa sawit analisis perubahan garis pantai tutupan lahan pasca tsunami pantai lhoknga, kecamatan lhoknga, kabupaten aceh besar studi komparasi keanekaragaman makrozoobentos diperairan haranggaol, danau toba, sumatera utara kepadatan ikan bilih (mystacoleucus padangensis blkr.) pola pertumbuhannya perairan haranggaol danau toba pengaruh komposisi dewan komisaris komite audit manajemen laba perusahaan perbankan terdaftar bursa efek indonesia penggunaan abu gunung sinabung sebagai filler campuran asphalt concrete-wearing course (ac-wc) menggunakan spesifikasi bina marga 2010 respon pertumbuhan stump karet (hevea brassiliensis muel arg.) pemotongan akar tunggang berbagai komposisi media tanam pertumbuhan stump karet berbagai kedalaman komposisi media tanam pengaruh lama inokulasi ukuran larva chilo sacchariphagus boj. (lepidoptera crambidae) perbanyakan sturmiopsis inferens towns. (diptera tachinidae) laboratorium pengaruh regangan tarik benang karet penentuan waktu kemantapan mekanis lateks pt.industri karet nusantara pengaruh produk, faktor sosial, harga, iklan, word of mouth keputusan pembelian sony xperia mahasiswa universitas sumatera utara pelaksanaan corporate social responsibilty (csr) kepada masyarakat kota medan oleh bank central asia pengaruh book tax gap persistensi laba perbankan indonesia model fixed effect random effect pengaruh motivasi peningkatan produktivitas kerja pegawai kantor camat medan barat kota medan mekanisme pengenaan pemungutan pajak hiburan dinas pendapatan daerah medan analisis penerapan pajak progresif kendaraan bermotor rangka meningkatkan pendapatan asli daerah kantor sistem administrasi manunggal satu atap (samsat) medan selatan tata cara penghapusan denda piutang pajak kendaraan bermotor kadaluarsa kantor sistem administrasi manunggal satu atap (samsat) medan selatan pelaksanaan peraturan pemerintah nomor 46 tahun 2013 tentang pajak penghasilan atas penghasilan dari usaha diterima atau diperoleh wajib pajak memiliki peredaran bruto tertentu kantor pelayanan pajak pratama medan polonia tingkat kepatuhan wajib pajak orang pribadi melaporkan surat pemberitahuan (spt) melalui e-filing kantor pelayanan pajak pratama binjai mekanisme pengenaan pemungutan pajak restoran kantor dinas pendapatan kota medan penetapan kadar air kadar abu kopi arabika, robusta luwak berasal dari dataran tinggi gayo peranan penempatan pegawai kinerja pegawai pt.pertamina (persero) marketing operation region i sumbagut hubungan program kompensasi kinerja karyawan pt. asam jawa medan pentingnya peranan pendidikan pelatihan peningkatan kompetensi pegawai negeri sipil kantor pendidikan pelatihan provinsi sumatera utara hubungan kedisiplinan kinerja pegawai bagian sekretariat staf ahli gubernur kantor gubernur provinsi sumatera utara sistem pengendalian aktiva tetap pt perkebunan nusantara iii (persero) medan analisis laporan keuangan pt hanjaya mandala sampoerna tbk sistem pembayaran dana pensiun asuransi kematian pegawai negeri sipil (pns) pt. taspen (persero) kcu medan sistem pengendalian internal kas smp negeri 1 sei rampah mekanisme penyitaan oleh jurusita pajak pph badan kantor pelayanan pajak (kpp) pratama lubuk pakam analisis komposisi asam lemak air susu ibu secara kromatografi gas optimasi analisis kadar campuran amoksisilin kalium klavulanat metode spektrofotometri derivatif penetapan kadar kalium, kalsium natrium daun kucai (allium schoenoprasum, l.) segar direbus secara spektrofotometri serapan atom pemetaan potensi hasil hutan non kayu kelompok palmae bambu berbasis sistem informasi geografis (sig) kecamatan lumban julu kphl model unit xiv tobasa sifat fisis mekanis papan semen dari limbah industri pensil berbagai rasio bahan baku target kerapatan analisis perubahan tutupan lahan kota lubuk pakam antara tahun 2012 2015 analisis pengaruh ekuitas merek keputusan pembelian mobil toyota new avanza ( auto 2000 sm. raja medan) pengaruh promosi jabatan pemberian insentif kinerja karyawan (studi bank sumut kantor cabang utama medan) pengaruh kepemimpinan budaya organisasi kinerja karyawan pt. soci mas deli serdang analisis faktor-faktor mempengaruhi ekuitas merek produk sepatu lari nike (studi pengguna sepatu lari nike lapangan merdeka medan) strategi pengembangan ukm melalui analisis swot bengkel firdana service desa tawar sedenge, kecamatan bandar, kabupaten bener meriah koeksistensi sistem hukum pengelolaan pendidikan panti asuhan al-hakiim desa paya kulbi karang baru kabupaten aceh tamiang penyingkapan diri (self disclosure) orangtua tunggal anak (studi fenomenologi penyingkapan diri (self disclosure) ibu tunggal remaja perempuan kelurahan mangga kecamatan medan tuntungan kota medan) pengaruh gaya kepemimpinan kinerja pegawai kantor camat teluk nibung kota tanjungbalai pengaruh pemekaran kecamatan kondisi sosial ekonomi masyarakat (studi kecamatan pamatang sidamanik kabupaten simalungun) modal sosial sistem bagi hasil beternak sapi masyarakat desa purwosari atas, kecamatan dolok batu naggar, kabupaten simalungun pengembangan bahan magnetik berbasis banixal6-xfe6o19 bahan absorber gelombang elektromagnetik teanteanan masyarakat batak toba kajian sosial budaya kajian psikologi sastra legenda raja sisingamangaraja xii analisis stilistika nangen si tagan dera masyarakat pakpak kekasaran permukaan resin komposit hybrid setelah perendaman larutan kopi sidikalang kekasaran permukaan resin akrilik polimerisasi panas setelah perendaman larutan ekstrak daun kemangi (ocimum basilicum linn) 12,5% analisis faktor-faktor mempengaruhi keberadaan komite manajemen risiko perusahaan perbankan terdaftar bei tahun 2011-2014 pengaruh profitability growth opportunity firm’s value capital structure sebagai variabel intervening perusahaan properti real estate terdaftar bursa efek indonesia periode tahun 2010-2012 pengaruh penerapan konsep nilai wajar memprediksi arus kas perusahaan perbankan terdaftar bei kemungkinan applikasi reverse osmosis pengolahan limbah industri oleokimia kristalisasi likopen dari buah tomat (lycopersicon esculentum) menggunakan antisolvent pembuatan gliserol tribenzoat proses esterifikasi menggunakan katalis h-zeolit teraktivasi oleh asam klorida perbedaan perilaku konsumtif mahasiswi universitas sumatera utara kost tinggal orangtua ditinjau dari kontrol diri gambaran penyesuaian diri muallaf pelaksanaan manajemen perkantoran dinas pertanian provinsi sumatera utara etiket kerja sekretaris dinas pendapatan provinsi sumatera utara memberikan pelayanan kepada tamu dinas pendapatan provinsi sumatera utara tugas akhir judul peranan sekretaris perjalanan dinas staf ahli gubernur sekretariat staf ahli gubernur kantor gubernur provinsi sumatera utara peranan gaya kepemimpinan meningkatkan kinerja karyawan pt. asam jawa medan peranan fasilitas kerja meningkatkan kinerja karyawan pt. pertamina (persero) bagian retail fuel marketing region i rayon kota medan sistem pelaksanaan perhitungan pph pasal 21 ppks ( pusat penelitian kelapa sawit ) unit usaha marihat pematang siantar analisis rasio keuangan pt. bank mandiri (persero) tbk analisis transfer antar bank via sistem kliring nasional pt. bank mandiri (persero) tbk sistem informasi keuangan penerimaan pengeluaran kas pt. kharisma pemasaran bersama nusantara (kpbn) cabang medan proses penyusunan anggaran pt taspen (persero) kantor cabang utama medan prosedur pelaksanaan pembukaan giro pt. bank rakyat indonesia cabang gajah mada analisis kinerja keuangan perusahaan pt taspen (persero) sistem pengawasan internal kas pt perkebunan nusantara iii (persero) medan analisis biaya produksi pt. perkebunan nusantara iii (persero) medan prosedur pemberian kredit umum pt. bank sumut cabang pembantu pandan kabupaten tapanuli tengah analisis rasio keuangan pt. perusahaan gas negara (persero), tbk terdaftar bursa efek indonesia analisis rasio keuangan pt. gudang garam tbk periode 2010-2014 program csr (corporate social responsibility) dilaksanakan harian metro siantar pematangsiantar perhitungan pemotongan pemungutan pajak penghasilan kpp pratama lubuk pakam mekanisme penagihan utang pajak surat paksa kantor pelayanan pajak (kpp) pratama lubuk pakam analisis rasio keuangan pt. mopoli raya medan pengaruh retailing mix keputusan pembelian gerai alfamidi jalan setia budi 1 medan prosedur pemberian nomor seri faktur pajak kepada pengusaha kena pajak (pkp) kantor pelayanan pajak pratama medan kota kepadatan pola pertumbuhan ikan jurung (tor spp.) perairan sungai bahorok kabupaten langkat provinsi sumatera utara perencanaan jadwal distribusi menggunakan metode distribution resources planning (drp) pt. mewah indah jaya pengujian mesin pendingin ruangan menggunakan energi surya campuran air, garam, es sebagai media pendingin uji jarak ulir alat pengempa minyak kemiri (oil press) tipe ulir pengaruh waktu fermentasi komposisi limbah kulit buah aren (arenga pinnata) starter kotoran sapi biogas dihasilkan kajian peranan pengembangan kawasan hutan kota cadika pertumbuhan sektor informal kelurahan pangkalan masyhur, kecamatan medan johor pengaruh komposisi ukuran mikro serbuk kulit kerang darah (anadora granosa) komposit epoksi-ps/serbuk kulit kerang darah (skkd) pengaruh pemberian minyak kelapa murni minyak kedelai profil lipida tikus jantan (rattus norvegicus). pengaruh suhu vulkanisasi komposisi bentonite clay dimodifikasi alkanolamida dari bahan baku rbdpko produk lateks karet alam peran inhibitor hmg-coa reduktase penurunan interleukin-6 hasil akhir klinis penderita kontusio serebri pembuatan gliserol tribenzoat proses esterifikasi menggunakan katalis h-zeolit teraktivasi oleh asam sulfat problematika sertifikasi hak milik atas tanah melalui ajudikasi pasca bencana tsunami kota banda aceh implementasi kebijakan undang-undang nomor 24 tahun 2011 tentang badan penyelenggara jaminan sosial (studi badan penyelenggara jaminan sosial (bpjs) ketenagakerjaan kantor cabang binjai) mekanisme pengukuhan pencabutan pengukuhan pengusaha kena pajak (pkp) kantor pelayanan pajak pratama medan belawan sistem informasi penagihan tunggakan pelunasan rekening listrik pt. pln (persero) rayon johor pembuatan tablet kalsium laktat metode cetak langsung menggunakan maltodekstrin sebagai bahan penghancur penetapan kadar mineral kalsium, kalium natrium daun kari (murraya koenigii (l.) spreng) secara spektrofotometri serapan atom penetapan kadar campuran parasetamol ibuprofen sediaan tablet secara spektrofotometri derivatif zero crossing analisis manajemen laba kinerja keuangan perusahaan pengakuisisi sebelum sesudah akuisisi terdaftar bursa efek indonesia tahun 2009-2010 pengaruh penambahan ekstrak daun pepaya (carica papaya l.) nilai spf krim tabir surya kombinasi oktil metoksisinamat avobenson penetapan kadar mineral ca, fe, k, na daun ranti (solanum americanum mill.) secara spektrofotometri serapan atom formulasi evaluasi secara in vitro kompleks nanopartikel alginat-kitosan mengandung amoksisilin bovine serum albumin analisis cemaran kromium zinkum air sungai deli secara spektrofotometri visibel tata cara pelaksanaan pemungutan pajak hiburan rangka meningkatkan penerimaan pendapatan asli daerah kota binjai analisis cemaran nitratdan nitrit air sungai deli secara spektrofotometri visibel perbandingan efektifitas pemakaian koagulan pac tawas menurunkan kekeruhan air baku (sungai belawan) penetapan kadar hidrokortison asetat sediaan krim secara kromatografi cair kinerja tinggi (kckt) penentuan bobot jenis indeks bias serta kelarutan etanol putaran optik minyak kayu putih (melaleuca leucadendron) penetapan kadar kloramfenikol sediaan kapsul secara kromatografi cair kinerja tinggi identifikasi zat pemutih klorin ikan asin beredar pasar durian medan uji mutu bahan baku thiamin mononitrat sebagai bahan baku vit. b kompleks diproduksi oleh pt. kimia farma (persero) tbk. plant medan penerapan etika komunikasi kantor badan kepegawaian daerah walikota medan peranan seorang sekretaris perusahaan meningkatkan brand image pt. perkebunan nusantara iii (persero) sei batanghari medan pelaksanaan manajemen perkantoran dinas pertanian provinsi sumatera utara implementasi algoritma edge detection operator sobel proses perbaikan kualitas citra teks oeang republik indonesia daerah (orida) sumatera utara 1947-1950 optimasi pembuatan biodiesel dari mesokarp sawit teknologi reactive extraction menggunakan respone surface method (rsm) pembuatan biodiesel dari mesokarp buah sawit teknologi reactive extraction analisa hukum penetapan ahli waris ( putusan pengadilan agama medan no. 1229/pdt.g/2010/pa/mdn) analisa respon mekanik genteng komposit beton busa diperkuat serat tkks akibat beban flexure variasi ukuran butir pasir analisis hukum upaya pt. bank sumut cabang utama medan pencegahan pemberantasan tindak pidana pencucian uang berdasarkan undang-undang nomor 8 tahun 2010 pbi nomor 11/28/pbi/2009 pengaruh konsentrasi tepung wortel (daucus carota l) pakan peningkatan warna ikan koi (cyprinus carpio) analisis yuridis penerapan undang-undang no.2 tahun 2004 tentang penyelesaian perselisihan hubungan industrial mendukung iklim usaha investasi studi eksperimental proses pembuatan paving block komposit concrete foam diperkuat serat tkks akibat beban tekan statik penjelasan hukum wanprestasi dilakukan klien tidak membayar honor/tarif pengacara pengkajian status gizi ibu hamil kelurahan belawan ii kecamatan medan – belawan pengaruh waktu vulkanisasi pembebanan pengisi tepung kulit singkong termodifikasi penyerasi alkanolamida pembuatan produk film lateks karet alam pengaruh komposisi ukuran makro serbuk kulit kerang darah (anadora granosa) komposit epoksi-ps/serbuk kulit kerang darah (skkd) pengaruh populasi kacang tanah (arachis hypogaeal.) jagung (zea maysl.) pertumbuhan produksi sistem pola tumpang sari perencanaan sistem drainase rencana kawasan industri deli serdang kecamatan medan amplas praktik tanggung jawab sosial pemberdayaan usaha kecil menengah studi pt perkebunan nusantara iv unit usaha kebun adolina, kabupaten deli serdang penyelesaian sengketawali adhal kaitannya keabsahan perkawinan (studi penetapan no. 215/pdt.p/2011/p.a.jakarta selatan) tinjauan yuridis prinsip kehati-hatian direksi perjanjian kerja sama proses pengadaan barang jasa (studi penelitian pt. perkebunan nusantara iii (persero) medan) inventarisasi anggrek terestial hutan pendidikan bagian timur kawasan taman hutan raya bukit barisan tongkoh kabupaten karo sumatera utara pelaksanaan corporate social responsibility (csr) pt. perkebunan nusantara iii pemberdayaan umkm kabupaten asahan (studi program kemitraan pt. perkebunan nusantara iiidistrik asahan) studi sintesis metil ester asam lemak dari pitch cair melalui tahap reaksi esterifikasi transesterifikasi penggunaan surfaktan polivinil alkohol (pva) sebagai bahan aditif pembuatan aspal emulsi liberalisasi pendidikan kerangka gats kajian hukum pendirian perguruan tinggi asing indonesia strategi pengembangan sistem agribisnis beras organik ( desa lubuk bayas, kecamatan perbaungan) analisis permintaan daging sapi kota medan analisis pendapatan agroindustri dodol kabupaten serdang bedagai dampak pengerukan pasir kelimpahan plankton parameter fisik kimia hulu sungai belawan, kecamatan pancur batu, kabupaten deli serdang. sistem penjadwalan kuliah menggunakan algoritma genetika fakultas teknik universitas sumatera utara pemijahan ikan maskoki (carrasius auratus) menggunakan berbagai substrat respon pertumbuhan bibit kakao (theobroma cacao l.) pemberian pupuk guano kcl daya predasi semut myopopone castaneae (hymenoptera formicidae) larva penggerek pucuk kelapa sawit oryctes rhinoceros l. (coleoptera scarabaidae) laboratorium penyelesaian wanprestasi perjanjian kredit jaminan hak tanggungan koperasi credit union seia sekata kecamatan galang kabupaten deli serdang analisis hukum perjanjian penyambungan air pdam tirtanadi medan pengawasan lembaga dana pensiun setelah berlakunya undang-undang no.21 tahun 2011 tentang otoritas jasa keuangan sistem outsourcing industri jasa perbankan setelah adanya putusan mahkamah konstitusi nomor 27/ppu-9/2011 hubungan infeksi ascaris lumbricoides hasil uji tusuk kulit (skin prick test) alergen dari cacing ascaris anak sekolah dasar negeri 047/xi koto baru memiliki riwayat atopi kecamatan pesisir bukit kota sungai penuh provinsi jambi pertimbangan hakim menjatuhkan sanksi pidana pelaku tindak pidana pencucian uang money laundering prinsip permberdayaan usaha mikro kecil menengah ketentuan pembatasan kepemilikan waralaba restoran ditinjau dari undang-undang nomor 28 tahun 2008 tentang usaha mikro kecil menengah tinjauan yuridis tentang pelaksanaan bagi hasil koperasi pegawai negeri kencana ii medan tinjauan hukum peranan kawasan berikat proses eskpor gliserin (studi pt. musim mas) analisa yuridis penggunaan laba perseroan menurut undang-undang nomor 40 tahun 2007 aspek yuridis pemberian pembiayaan modal kerja perbankan syariah menggunakan akad mudharabah (studi bank syariah mandiri cabang medan utama) analisis rasio keuangan hotel mona plaza pekanbaru pemeriksaan cemaran timbal (pb) sediaan lipstik beredar pasar ramai medan secara spektrofotometri serapan atom gambaran kepatuhan pola makan penderita hipertensi berobat klinik spesialis ginjal hipertensi rasyida medan tahun 2015 pembuatan game tetris kendali pengenalan perintah suara smartphone android hubungan penerapan program keselamatan kerja tindakan tidak aman oleh karyawan pt perkebunan nusantara iv (persero) unit usaha teh bah butong pengaruh serbuk kaca properties batako kompetisi sepak bola antar kampung kecamatan tigalingga kabupaten dairi analisis kadar formalin buah impor dijual beberapa pasar swalayan kota medan tahun 2015 peranan badan pemberdayaan perempuan keluarga berencana kota medan pengendalian laju pertumbuhan penduduk kota medan perbandingan status koagulasi penderita stroke iskemik non stroke penerapan konsep-konsep pemberdayaan masyarakat meningkatkan sosial ekonomi anggota cu karya murni kelurahan binjai kecamatan medan denai kota medan pengaruh penambahan kitosan karakteristik bioplastik dari pati umbi talas menggunakan plasticizer gliserol fenomena anak putus sekolah masyarakat nelayan kelurahan pasar ii natal, kecamatan natal, kabupaten mandailing natal penurunan kadar logam kromium, tembaga, nikel limbah cair laboratorium elektroplating politeknik negeri medan metode elektrokoagulasi faktor-faktor mempengaruhi nasabah memilih menabung bank sumut cabang syariah medan analisis persepsi respon masyarakat eksistensi lembaga-lembaga zakat kota medan ( masyarakat kelurahan pulo brayan darat ii medan) analisis faktor penyebab terjadinya sisa material proyek pembangunan gedung wilmar business institute medan primate land ( green architecture ) analisis program keselamatan kesehatan kerja bagian produksi 5s konsep kaizen sebagai upaya pencegahan kecelakaan kerja pt.apindowaja ampuh persada hubungan pengetahuan sikap pekerja tindakan pekerja penggunaan alat pelindung pendengaran bagian produksi pabrik kelapa sawit ptpn iv adolina tahun 2015 optimasi pemesinan mesin bubut tipe m-300 horrison metode optimasi algoritma genetika analisis strategi pengembangan nilai tambah produk perikanan ( kecamatan teluk mengkudu, kabupaten serdang bedagai) implementasi sistem pendukung keputusan menentukan predikat kelulusan santri dyah algoritma electre simple additive weighting (saw) hubungan profil peternak pendapatan usaha ternak kerbau lumpur kecamatan lintong nihuta, kabupaten humbang hasundutan dampak program desa mandiri pangan pendapatan masyarakat ( kel.ladang bambu, kec. medan tuntungan, kota medan) analisa penetapan harga jual unit rumah perumahan la grandia setia budi perbedaan psychological well-being antara wanita menopause bekerja tidak bekerja pengaruh inokulasi cendawan mikoriza arbuskula (cma) interval penyiraman pertumbuhan bibit suren (toona sureni merr.) iklan provider axis telkomsel televisi implementasi sistem pelayanan terpadu kantor pelayanan perizinan terpadu penanaman modal kabupaten serdang bedagai berdirinya yayasan srikandi sejati jakarta 1998 aspek moral kumpulan cerpen tamu dari paris karya yanusa nugroho tinjauan semiotik pra rancangan pabrik pembuatan keramik barium titanat kapasitas produksi 700 ton/tahun pemanfaatan pelepah daun kelapa sawit fermentasi aspergilus niger limbah pabrik kelapa sawit performans sapi bali jantan pembuatan pupuk cair biogas dari limbah sayuran perencanaan portal bangunan bertingkat 10 menggunakan prestressed concrete sesuai building code aci 318-05 pengaruh kualitas pelayanan hubungan emosional loyalitas nasabah pt. bank muamalat indonesia, tbk cabang pematang siantar pengaruh analisis pekerjaan penempatan kerja prestasi kerja karyawan divisi primary care pt. kalbe farma tbk cabang medan pelaksanaan sistem pemilukada implikasi pertanggungjawaban pemerintah ditinjau dari undang-undang pemerintah daerah berlaku indonesia peranan legislator perempuan pelaksanaan fungsi legislasi anggaran (studi legislator perempuan terpilih kota binjai 2009-2014) analisis yuridis batas waktu perjanjian sewa-menyewa rumah ( putusan perkara perdata no.577/pdt.g/2013/ pn-mdn) persepsi mahasiswa pemberitaan tv swasta uji kemampuan bakteri kitinolitik dari nepenthes tobaica nepenthes gracilis menghambat pertumbuhan beberapa jamur patogen tanaman re-desain egrek sebagai alat pemanen kelapa sawit menggunakan kansei engineering quality function deployment pt. perkebunan nusantara iii (kebun ramnbutan) karakteristik fisikokimia fungsional tepung komposit berbahan dasar tepung ubi jalar, pati jagung, tepung kedelai xanthan gum analisis biomekanika pekerja pemanen kelapa sawit egrek pt. perkebunan nusantara iii (kebun ramnbutan) tinjauan yuridis atas upaya reformasi dewan keamanan perserikatan bangsa-bangsa menciptakan tatanan negara-negara dunia berdaulat, damai adil optimisasi penjadwalan job shop menggunakan algoritma tabu search metode earliest due date minimisasi makespan analisis penerapan iso 90012000 kaitannya harga cpo keuntungan (kasus pt perkebunan nusantara iii (persero) kebun sei meranti kabupaten. labuhan batu selatan) optimalisasi penerimaan pajak penghasilan pasal 21 kantor pelayanan pajak (kpp) pratama binjai mekanisme pengenaan pemungutan pajak restoran dinas pendapatan kota medan respons pertumbuhan produksi tanaman kedelai (glycine max .l merill) pemberian abu vulkanik sinabung pupuk kandang ayam pengaruh pelaksanaan penyuluhandalam upaya meningkatkan kepatuhan wajib pajakuntuk memenuhi kewajiban perpajakan kantor pelayanan pajak pratama medan barat asuhan keperawatan tn. s prioritas masalah kebutuhan dasar oksigenasi rsud.dr. pirngadi medan tahun 2014 respons pertumbuhan produksi tanaman kedelai (glycine max(l.) merrill) pemberian debu vulkanik hasil erupsi gunung sinabung pupuk kandang sapi asuhan keperawatan ny.l gangguan kebutuhan dasar eliminasi rsud. dr.pirngadi medan asuhan keperawatan pasien kebutuhan dasar gangguan aktivitas kedudukan dewan keamanan perserikatan bangsa-bangsa menjatuhkan sanksi resolusi israel analisis kualitatif bakteri coliform colifekal air badan air perancangan website kelurahan perdagangan kabupaten simalungun hubungan pengetahuan sikap ibu hamil pemberian imunisasi tetanus toksoid wilayah kerja puskesmas maga kecamatan lembah sorik marapi kabupaten mandaialing natal tahun 2015 perbedaan kontrol diri remaja berasal dari keluarga utuh keluarga bercerai pola makan, kecukupan gizi status gizi balita keluarga miskin perumnas mandala, kelurahan kenangan baru citra perempuan ideologi feminisme empat novel karya a. hasjmy analisis kadar timbal (pb) sayuran selada kol dijual pasar kampung lalang medan berdasarkan jarak lokasi berdagang jalan raya tahun 2015 pengaruh karakteristik perusahaan corporate social responsibility disclosure perusahaan manufaktur terdaftar bei perilaku menyimpang tokoh utama novel gerhana kembar karya clara ng tinjauan psikosastra faktor-faktor mempengaruhi audit delay suatu perusahaan jasa terdaftar bei pengaruh kualitas audit auditor tenure earnings management perusahaan manufaktur terdaftar bursa efek indonesia analisis rasio keuangan memprediksi financial distress perusahaan garmen tekstil terdaftar bei menggunakan metode altman’s z-score pengaruh peranan audit internal budaya organisasi penerapan prinsip good corporate governance pt. bank rakyat indonesia (persero) tbk, medan pengaruh pengetahuan produk kebutuhan mencari variasi perilaku brand switching pembelian kartu sim pengguna smartphone android pengaruh faktor makro ekonomi faktor fundamental harga saham perusahaan asuransi terdaftar bursa efek indonesia analisis implementasi peraturan pemerintah no 33 tahun 2012 tentang pemberian asi eksklusif klinik/bidan bersalin kota medan tahun 2015 analisis dampak pembayaran non tunai jumlah uang beredar indonesia hubungan tekanan panas denyut nadi pekerja pt. perkebunan nusantara iv kebun bah butong tahun 2015 analisis kausalitas antara fdi pertumbuhan ekonomi asean analisis dampakstock split harga saham volume perdagangan perusahaan terdaftar bei (sektor manufaktur, pertambangan, finansial agrikulturdari tahun 2010-2013) ekoleksikal padi, kelambir, mergat, buluh kajian ekolinguistik bahasa melayu serdang tradisi lokal mamahea niowalu (mendandu pengantin) adat pernikahan nias utara analisis faktor-faktor berhubungan motivasi kerja penyuluh pertanian kabupaten karo pengaruh penggunaan metode story telling kemampuan berbicara peserta didik kelas vii smpn 2 padangsidimpuan analisa kekerasan struktur mikro daerah interface hasil proses cladding material stainless steel baja karbon menengah perancangan simulasi mesin mixer kapasitas 6,9 liter putaran 280 rpm menggunakan ansys fluent 14.0 pengujian pengaruh mutu pelayanan kesehatan kepuasan pasien rawat inap peserta jkn puskesmas rawat inap batang kuis kabupaten deli serdangtahun 2015 flying oase studi perkembangan tipologi rumah toko kota penataan pengembangan kawasan geopark kaldera toba (engagement with stone) persepsi masyarakat kota ruang terbuka publik kota tebing tinggi makna ideasional karangan bahasa indonesia mahasiswa prodi d4 mice politeknik negeri medan pengaruh hydraulic retention time (hrt) ph proses asidogenesis limbah cair pabrik kelapa sawit (lcpks) keadaan ambient kajian karakteristik visual koridor jalan k. h. zainul arifin medan pengaruh hydraulic retention time (hrt) ph proses asidogenesis limbah cair pabrik kelapa sawit (lcpks) temperatur 45oc metafora emosi bahasa batak toba hubungan faktor sosiodemografi sosiopsikologi pemanfaatan pelayanan kesehatan rawat jalan peserta jaminan pemeliharaan kesehatan jamsostek pusat pelayanan kesehatan tingkat pertama pt. jamsostek (persero) kantor cabang belawan tahun 2013 gambaran pola makan dukungan keluarga penderita diabetes melitus menjalani rawat jalan rsu dr. pirngadi medan tahun 2015 perjuangan kesetaraan gender lima novel nh. dini simbol politik keculasan politik novel glonggong karya junaedi setiyono gambaran ketahanan pangan rumah tangga petani padi desa maligas tongah kecamatan tanah jawa kabupaten simalungun pemodelan profil pantai estimasi jarak sempadan pantai kawasan pantai cermin pengaruh tuntutan kerja hubungan atasan -bawahan stres kerja kajian kekuatan stabilitas struktur bangunan menara tungku pembakaran batu bara memperhitungkan pengaruh gempa, angin temperatur tinggi analisa tekuk lateral balok crane baja i perhitungan manual abaqus error and error analysis in language study kritik sosial puisi drama w.s. rendra 1970-an—1990-an the uses of facebook by english diploma students of faculty of cultural study peranan total quality management kinerja manajemen pt pp london sumatera indonesia tbk medan analisis kinerja keuangan kinerja sosial bank syariah devisa bank syariah non devisa indonesia studi kelayakan ekonomi budidaya durian desa lau bagot, kecamatan tigalingga, kabupaten dairi inventarisasi anggrek terestial hutan pendidikan bagian timur kawasan taman hutan raya bukit barisan tongkoh kabupaten karo sumatera utara gambaran kesejahteraan psikologis wanita dewasa madya ditinjau dari grandparenting style analisis kerugian pemetaan sebaran serangan rayap bangunan smp negeri kota pekanbaru pendugaan cadangan karbon tanaman karet (hevea brasiliensis muell. arg.) perkebunan rakyat desa tarean, kecamatan silindak, kabupaten serdang bedagai pengaruh variasi naungan pertumbuhan konsentrasi rantai panjang polyisoprenoid semai mangrove sejati minor berjenis sekresi xylocarpus granatum koenig pemanfaatan fungi aspergillus flavus, aspergillus tereus, trichodermaharzianumuntuk meningkatkan pertumbuhan bibit bruguiera cylindrica desa nelayan indah kecamatan medan labuhan sebaran sukun persepsi masyarakat (artocarpus communis forst) daerah tangkapan air danau toba nagori purba saribu, kecamatan haranggaol horison, kabupaten simalungun pengaruh gaya kepemimpinan budaya organisasi kinerja kerja karyawan (studi hotel rudang berastagi) proses pelaksanaan peraturan walikota medan nomor 54 tahun 2010 tentang rincian tugas pokok fungsi badanpenanaman modal kota medan (studi pengawasan badan penanaman modal kota medan) pengaruh sistem waktu polishing kebocoran mikro restorasi klas v resin komposit nanohybrid analisis pengaruh likuiditas (current ratio), profitabilitas (return on equity, return on investment, earning per share), inventory turnover harga saham perusahaan tekstil garmen terdaftar bursa efek indonesia pengaruh net profit margin nilai perusahaan good corporate governance sebagai variabel pemoderasi perusahaan manufaktur terdaftar bursa efek indonesia tahun 2011-2013 analisis komparasi faktor-faktor mempengaruhi audit fees selama masa pengadopsian ifrs indonesia malaysia pengaruh proses penyusunan anggaran partisipasi anggaran kualitas pelaksanaan anggaran satuan kerja perangkat daerah ( kabupaten serdang bedagai) pengaruh return saham, volume perdagangan varian return bid-ask spread perusahaan perbankan bursa efek indonesia aspek pembuktian oleh para pihak permohonan itsbat nikah pengadilan agama (studi pengadilan agama kelas i-a kota medan) analisis yuridis peraturan bersama antar lembaga negara penanganan pecandu korban penyalahgunaan narkotika ke lembaga rehabilitasi perbandingan tindak pidana aborsi menurut hukum positif indonesia hukum islam akumulasi logam berat cu pb rhizophora apiculata tingkat pancang pohon budaya kerja pengusaha butik studi deskriptif pengusaha butik sun plaza medan pemanfaatan serat lidah mertua (agave angustifolia haw) kulit pisang sebagai bahan baku pembuatan kertas analisis pengaruh cost to income ratio (cir), debt to equity ratio (der), size bank, return on asset (roa), earnings per share (eps), non performing loan (npl) harga saham perusahaan perbankan terdaftar bursa efek indonesia analisis investasi ekonomi sektor unggulan kota medan analisis perbandingan usaha tani padi sawah sistem sri (system of rice intensification) sistem konvensional kecamatan teluk mengkudu kabupaten serdang bedagai pengawasan intern gaji dinas pertambangan energi provinsi sumatera utara pengaruh kepemimpinan efektivitas kerja pegawai kantor pelayanan pajak pratama medan kota dampak pelaksanaan sosialisasi perpajakan tingkat kepatuhan wajib pajak (studi penyampaian surat pemberitahuan tahunan kantor pelayanan pajak pratama medan kota) analisis sistem pencatatan metode sistem penilaian pt. pp london sumatra indonesia,tbk analisis komparasi usahatani padi sawah berdasarkan budidaya nonorganik, semiorganik, organik ( desa lubuk bayas, kec. perbaungan, kab. serdang bedagai) pelaksanaan fungsi pengawasan badan permusyawaratan desa (studi tentang pelaksanaan fungsi pengawasan badan permusyawaratan desa (bpd) desa telaga sari kecamatan tanjung morawa kabupaten deli serdang praktik kerja lapangan mandiri tata cara penyampaian surat pemberitahuan (spt) tahunan pajak penghasilan (pph) orang pribadi kantor pelayanan pajak pratama medan timur pengaruh lingkungan kerja kinerja karyawan rumah sakit islam malahayati medan persyaratan analisis mutu keseragaman bobot kadar air sediaan obat vtradisional jamu balai pengawasan obat makanan (bpom) medan pelaksanaan korespondensi bagi seorang sekretaris bagian sekretariat dekan fakultas ekonomi universitas sumatera utara analisa kadar gula darah menggunakan spektrofotometer microlab 300 analisa kandungan fluorida (f), tingkat pengetahuan tindakan orang tua anak usia 4-6 tahun tentang pasta gigi dipakai taman kanak-kanak kecamatan medan area tahun 2015 pengembangan karakterisasi sifat listrik film kitosan sebagai sensor aseton penambahan carboxymethyl cellulosa (cmc) analisis alkalinitas air reservoir pdam tirtanadi medan penetapan kadar oktil metoksi sinamat lusio metode kromatografi cair kinerja tinggi (kckt) kata jihad terjemahan al-qur’an departemen agama republik indonesia analisis strategi penerjemahan analisis alokasi anggaran biaya operasional pt taspen (persero) kcu medan pengaruh media poster media leaflet pengetahuan sikap siswa sma negeri 2 rantau selatan kabupaten labuhan batu tahun 2015 studi penggunaan sistem pendingin udara tekan meningkatkan efisiensi transformator (aplikasi pltu labuhan angin, sibolga) analisis faktor-faktor mempengaruhi minat masyarakat memilih bank syariah sebagai sumber kredit pemilikan rumah (kpr) survei kecamatan medan tuntungan analisis kelayakan penerima kredit pemilikan rumah metode profile matching promethee analisa rugi-rugi pelengkungan serat optik singel mode pelemahan intensitas cahaya pengaruh hydraulic retention time (hrt) rasio recycle sludge proses asidogenesis limbah cair pabrik kelapa sawit (lcpks) keadaan ambient perancangan mixed-use shopping mall office kawasan transit oriented development (tod) binjai perancangan hotel mixed-use kawasan transit oriented development (tod) binjai pola komunikasi keluarga pengambilan keputusan perkawinan usia remaja ( pola komunikasi keluarga pengambilan keputusan perkawinan usia remaja desa sei semayang, kecamatan sunggal, kabupaten deli serdang) analisis permintaan kredit multiguna pegawai negeri sipil perbankan kota panyabungan pengaruh corporate social performance corporate financial performancestudi empiris perusahaanyang terdaftar national center forsustainability reporting 2010-2013 tinjauan atas peranan pelaksanaan pemeriksaan pajak kantor pelayanan pajak (kpp) pratama medan timur pemanfaatan berbagai jenis fungi meningkatkan pertumbuhan rhizophora apiculata desa nelayan indah kecamatan medan labuhan analisis manajemen risiko ( gudang obat rumah sakit tentara pematangsiantar ) strategi pemasaran kopi bubuk tanpak sidikalang analisis swot program informasi televisi pemenuhan kebutuhan informasi masyarakat (studi korelasional mengenai program “metro kini” metro tv pemenuhan kebutuhan informasi masyarakat kelurahan parhorasan nauli kota pematangsiantar) pengaruh mutasi semangat kerja pegawai negeri sipil kantor pelayanan pajak pratama kota pematang siantar pengaruh implementasi international pasient safety goals (ipsg) kinerja perawat ruang rawat inap rsup h. adam malik medan penggunaan bakteri dari lumpur aktif menurunkan nilai cod (chemical oxygen demand) limbah cair industri oleokimia pt. socimas pembulatan hasil program linier fuzzy menggunakan metode branch and bound pengaruh struktur modal, kinerja keuangan, keputusan investasi nilai perusahaan (studi perusahaan manufaktur sektor consumer goods terdaftar bursa efek indonesia tahun 2011-2013) pembelajaran praktik instrumen gitar kurikulum abrsm dasar i chandra kusuma school kajian masalah solusinya pengaruh kadar air, dosis lama pengendapan koagulan serbuk biji kelor sebagai alternatif pengolahan limbah cair industri tahu hubungan ketergantungan proses antara proses splitting distilasi industri oleokimia pemanfaatan abu kulit buah kelapa sebagai katalis reaksi transesterifikasi minyak sawit menjadi metil ester faktor-faktor memengaruhi minat beli produk susu oleh ibu mempunyai balita pasar swalayan kota pematangsiantar tahun 2013 perancangan perangkat lunak pengaman file text menggunakan algoritma el gamal kompresi file tex menggunakan algoritma huffman applicability of specific trend’s consistency of full hydrogenation gambaran pengambilan keputusan remarriage wanita odha (orang hiv/aids) optimising refined bleached deodorized palm stearin for its crude stearic acid iodine value to provide the stable specification of blended stearic acid distillate iodine value analisis pengaruh investment opportunity set kebijakan deviden struktur modal sebagai variabel moderating perusahaan manufaktur bursa efek indonesia providing vegetable stearic acid super v 1895 s from hidrogenated of crude vegetable stearic acid hcv 1895 s with a single fractional distillation column optimization of palmitic acid composition in crude oleic acid to provide specifications of titer and cloud point of distillate oleic acid using a flash distiller deasidifikasi minyak/lemak deodorisasi asam lemak serta gliserin gas n2 peran manajemen perpustakaan perguruan tinggi pengembangan teknologi informasi perpustakaan perguruan tinggi fungsi teknologi informasi mewujudkan provinsi sumatera utara memiliki keunggulan berdaya-saing peranan bullying tempat kerja intensi turnover karyawan faktor-faktor berhubungan pola konsumsi ikan siswa sekolah dasar negeri 060919 kecamatan medan sunggal tahun 2015 institusi perpustakaan sebagai pilar utama peningkatan mutu pelayanan pendidikan penyuntingan naskah pencantuman sitasi bibliografis pengembangan repositori institusi pengalaman usu pelayanan perpustakaan berbasis teknologi informasi seascape hotel resort sibolga mencantumkan sitasi mencegah plagiarisme revitalisasi peran strategis perpustakaan menunjang pembelajaran berbasis mahasiswa social support psychological well-being penyintas bencana alam gunung sinabung peningkatan mutu pelayanan pendidikan melalui penguatan perpustakaan sekolah pengaruh role ambiguity role conflict perilaku cyberloafing karyawan implementasi metode exhaustive search menentukan shortest path antar pusat perbelanjaan kota medan implementasi perbandingan algoritma analytic hierarchy process (ahp) algoritma simple additive weighting (saw) pemilihan website hosting analisis laporan keuangan model springate memprediksi potensi kebangkrutan perusahaan pertambangan sub sektor batu bara terdaftar bursa efek indonesia analisis pengaruh suasana toko (store atmosphere) lokasi minat beli konsumen ramayana department store cabang buana plaza medan analisis kadar timbal(pb) tepung tapioka metode spektrofotometri serapan atom perbandingan poly aluminium chloride (pac) alum (tawas) mempertahankan ph air sungai belawan pdam hamparan perak penetapan kadar protein tahu putih tahu kuning metode kjeldahl pola kromatografi uji aktivitas antibakteri dari ekstrak fraksi kulit buah petai (parkia speciosa hassk.) sebagai antidiare pengaruh brand image brand trust loyalitas pelanggan kfc kfc cabang ring road medan formulasi uji efek anti-aging dari sediaan hand cream ekstrak daun teh hijau (camellia sinensis l.) analisis cemaran timbal, kadmium tembaga kubis hijau (brassica oleracea l.) secara spektrofotometri serapan atom penggunaan berbagai dosis kompos tanaman sukun (artocarpuscommunis)di daerah tangkapan air danau toba kecamatan haranggaol horison kabupaten simalungun analisis kerugian pemetaan sebaran serangan rayap bangunan sd negeri bagian barat kota pekanbaru pemanfaatan fungi aspergillus flavus, aspergillus tereus, trichoderma harzianum meningkatkan pertumbuhan bruguiera gymnorrhiza pengaruh fungi aspergillus flavus, aspergillus terreus trichoderma harzianum pertumbuhan bibit avicennia officinalis persepsi masyarakat pupuk organik keberadaan hutan desa tongkoh, kecamatan dolat rayat, kabupaten karo pengaruh rasio semen partikel kualitas papan semen dari limbah partikel industri pensil faktor-faktor berhubungan gejala dermatitis kontak pekerja bengkel kelurahan merdeka kota medan tahun 2015 pengaruh kompensasi motivasi kinerja karyawan pt ivo mas tunggal sei rokan. pengaruh gaya kepemimpinan disiplin kerja kinerja karyawan pengaruh store atmosphere keputusan pembelian outlet tivona international fragrance cabang pasar merah medan pengaruh brand image i-phone keputusan pembelian mahasiswa fisip usu pengaruh country of origin perceived value consumer ethnocentrism sebagai variabel moderator (studi konsumen televisi merek samsung kota medan) pengaruh motivasi produktivitas kerja karyawan pt. perusahaan gas negara (persero), tbk sbu distribusi wilayah iii sumatera utara analisis strategi pengembangan usaha kopi bubuk cap nona nantampuk mas sidikalang pengaruh pemberian kompensasi lingkungan kerja kinerja karyawan (studi pt indonesia asahan aluminium kuala tanjung kecamatan sei suka) pengaruh gaya kepemimpinan kepuasan kerja karyawan pt. tirta indah abadi mela (pt. tiam) sibolga “efektivitas pelaksanaan pembangunan program nasional pemberdayaan masyarakat mandiri perkotaan (pnpm –mp) desa hutapadang kota padangsidimpuan hutaimbaru analisis faktor-faktor memengaruhi anak putus sekolah kabupaten seruyan provinsi kalimantan tengah rancangan sistem pengontrolan pengamanan kebocoran lpg berbasis mikrokontroler atmega32 menggunakan media informasi sms pengaruh penambahan serat kaca kekasaran permukaan penyerapan air bahan basis gigitiruan nilon termoplastik prevalensi manifestasi oral pengguna narkoba panti sosial parmadi putra (pspp) insyaf sumatera utara persepsi orangtua tentang kualitas hidup anak dihubungkan pengalaman karies anak usia 6-7 tahun sd namira sdn 060922 gambaran xerostomia pasien hipertensi puskesmas sentosa baru puskesmas sering medan pengaruh pengumuman bond rating return saham bursa efek indonesia (studi empiris perusahaan terdaftar index kompas 100 tahun 2010-2014) analisis pengaruh kinerja keuangan risiko sistematis harga saham perbankan bursa efek indonesia analisis faktor-faktor mempengaruhi income smoothing ukuran perusahaan sebagai variabel moderating (studi empiris perusahaan perkebunan terdaftar bursa efek indonesia (bei) bursa malaysia) analisis faktor-faktor mempengaruhi pengungkapan corporate social responsibility (csr) perusahaan manufaktur pertambangan bursa efek indonesia (bei) tahun 2011-2013 analisis akuntansi forensik audit investigatif pelaksanaan prosedur audit penerapan good corporate governance pengaruh keterampilan berwirausaha keberhasilan usaha doorsmeer sabena analisis kinerja reksa dana metode sharpe, metode treynor metode sortiono (studi reksa dana saham bursa efek indonesia periode tahun 2012-2014) analisis pendapatan pengrajin olahan ubi kayu kecamatan pegajahan ( kecamatan pegajahan, kabupaten serdang bedagai) kajian perbandingan hukum atas pembuktian menurut sistem peradilan pidana indonesia sistem peradilan pidana amerika serikat pergantian debitur perjanjian jual-beli mobil secara kredit pt. daya adicipta wihaya medan gambaran pola konsumsi pangan keluarga peserta program percepatan penganekaragaman konsumsi pangan kelurahan mabar hilir kecamatan medan deli tahun 2014 analisis faktor-faktor minat beli konsumen pakaian bekas (monza) (studi pasar tradisional sambu medan) situs pemenuhan kebutuhan informasi (studi korelasional penggunaan situs portal berita online pemenuhan kebutuhan informasi dikalangan mahasiswa ikatan pemuda tanah rencong komisariat universitas sumatera utara) komunikasi antarpribadi penarik becak wanita (studi deskriptif kualitatif komunikasi antarpribadi penarik becak wanita kampus universitas sumatera utara) analisis keanekaragaman genetik markisa (passiflora spp.) sumatera utara berdasarkan penanda rapd (random amplified polymorphic dna) pengendalian biofilm edwardsiella tarda permukaan sisik ikan plastik pvc senyawa antimikroba dihasilkan oleh bakteri asam laktat (bal) analisis faktor-faktor mempengaruhi frekuensi pelaksanaan lelang atas hak tanggungan dari kreditur perbankan kantor pelayanan kekayaan negara lelang medan pengaruh debt to equity ratio, ukuran perusahaan, leverage operasi profitabilitas perusahaan manufaktur terdaftar bursa efek indonesia analisa kerugian head sistem distribusi air umpan boiler pt.pertamina (persero) refinery unit iv cilacap denganmenggunakan software pipe flow expert v6.39 analisa efisiensi siklus rankine sistem pembangkit tenaga uap pt. pertamina (persero) refinery unit iv cilacap analisa pemakaian economizer peningkatan efisiensi penghematan bahan bakar boiler 052 b101 unit pembangkit tenaga uap pt. pertamina (persero) refinery unit iv cilacap pemanfaatan kulit buah kakao kulit buah pisang difermentasi berbagai bioaktivator performans kambing kacang jantan lepas sapih analisis kelayakan usaha ternak itik desa percut, kec. percut sei tuan, kab. deli serdang analisis viabilitas finansial petani ubi kayu kabupaten serdang bedagai ( kecamatan pegajahan, kabupaten sergei) kajian selektivitas erosi budidaya karet 25 tahun desa lau damak kecamatan bahorok kabupaten langkat pengaruh budaya organisasi kinerja pegawai mahkamah syar’iyah daerah kutacane kabupaten aceh tenggara proses akulturasi perubahan identitas (pengaruh proses akulturasi perubahan identitas etnis pasangan keturunan jepang indonesia fukushi tomo no kai) pengaruh penyuluhan tentang makanan kariogenik metode ceramah diskusi pengetahuan anak-anak penderita karies gigi sd negeri 068004 perumnas simalingkar medan 2015 bentuk program csr bank nagari manfaatnya bagi kehidupan sosial ekonomi masyarakat lokal (studi program csr bank nagari cabang pangkalan) modal sosial komunitas buruh pengepul tandan buah segar (tbs) kelapa sawit daerah transmigrasi (studi deskriptif buruh pengepul kelapa sawit desa ramin blok c kecamatan kumpeh ulu kabupaten muaro jambi) siosar islamic research and education centre pengaruh konsentrasi lama perendaman auksin pertumbuhan produksi tanaman tomat cherry (lycopersicum cerasiformaemill.) sibolga visitor center uj i nilai daya dukung tanah lempung distabilisasi semen portland tipe i abu gunung vulkanik gunung sinabung the proudly place adsorpsi β-karoten terkandung dalarn minyak kelapa sawit (crude palm oil) menggunakan adsorben karbon aktif pengaruh kreativitas inovasi kepuasan pelanggan klinik herbal amarullah tinjauan yuridis keberadaan kendaraan bermotor (mobil) pribadi berplat hitam sebagai angkutan umum menurut undang-undang nomor 22 tahun 2009 tentang lalu lintas angkutan jalan (studi ditlantas poldasu dishub provinsi sumatera utara) spirit as the beginning of a regeneration pengaruh pengetahuan, sikap kepatuhan perawat penggunaan alat pelindung diri pencegahan infeksi nosokomial ruang rawat inap rumah sakit sari mutiara medan tahun 2014 analisis tentang pernikahan dini kecamatan kota pinang kabupaten labuhan batu selatan tahun 2015 beauty of history hubungan lama paparan getaran tangan keluhan kesehatan pekerja cukur rambut kelurahan padang bulan i medan 2015 finding the glassbox of wonder hubungan teknik menyusui produksi asi ibu primipara bersalin klinik bidan sumiariani jl. karya kasih kecamatan medan johor tahun 2014 asuhan keperawatan ny. y prioritas masalah kebutuhan dasar gangguan rasa nyaman (nyeri) rsud. dr. pirngadi medan faktor-faktor mempengaruhi peran serta suami mendukung pemberian asi eksklusif kecamatan lima puluh kabupaten batu bara 2014 strategi adaptasi mitigasi bencana banjir masyarakat kelurahan aur kecamatan medan maimun daya terima biskuit modifikasi tepung biji nangka, tepung kacang merah tepung pisang serta kontribusinya kecukupan energi, protein zat besi remaja budaya organisasi bsa owner motorcycle’ siantar kota pematang siantar long way towards recognition karakteristik penderita diabetes mellitus dirawat jalan klinik alifa diabetic centre medan tahun 2013-2014 pengaruh hydraulic retention time (hrt) laju pengadukan proses asidogenesis limbah cair pabrik kelapa sawit (lcpks) keadaan ambient frekwensi penyemprotan pupuk daun (gandasil d) pertumbuhan bibit aquilaria malaccensis lamk pemberian terabuster fungi mikoriza arbuskula pembibitan jabon (anthocephalus cadamba) pengaruh salinitas aktivitas enzim lipase dari bacillus cereus da 5.2.3 degradasi pakan udang solidaritas sosial komunitas punk studi deskriptif komunitas punk simpang aksara medan analisis perbandingan tingkat kepuasan nasabah pelayanan bank mandiri bca analisis optimalisasi pola tanam daerah irigasi waduk keuliling kabupaten aceh besar nad penetapan kadar kalium, kalsium natrium biji, daging buah daun labu kuning (cucurbita moschata d.) secara spektrofotometri serapan atom skrining fitokimia uji aktivitas serta kapasitas antioksidan total sari buah markisa ungu (passiflora edulis sims) sari buah markisa konyal (passiflora ligularis juss) gambaran pengetahuan sikap remaja putri tentang aborsi madrasah aliyah swasta (mas) persatuan amal bakti (pab) 2 helvetia kecamatan labuhan batu kabupaten deli serdang tahun 2013 pengaruh kemampuan motivasi kinerja guru smp yayasan pendidikan x pengurangan ffa warna dari minyak jelantah adsorben serabut kelapa jerami komunikasi interpersonal orang tua anak tentang pendidikan kesehatan reproduksi penerapan akuntansi forensik audit investigatif mendeteksi fraud lingkungan pemerintahan pdam tirtanadi sumatera utara tinjauan yuridis perdagangan barang tiruan menggunakan merek terkenal berdasarkanuu no. 15 tahun 2001 tentang merek (studi kota medan) pengaruh stres kerja motivasi kerja kinerja karyawan pt. perusahaan gas negara (persero) tbk kedaulatan negara penerima modal asing pengaturan penanaman modal analisis keterkaitan produktivitas pertanian impor beras indonesia pembuatan gel ekstrak teripang (holothuroidea sp.) penambahan kitosan pengobatan luka sayat penegakan hak konstitusional melalui constitutional complaint sebagai perwujudan negara hukum studi tentang variabel dominan mempengaruhi minat belanja pasar modern analytic hierarchy process (ahp) aktivitas antioksidan edible film galaktomanan diinkorporasi ekstrak rimpang jahe daging ikan nila manufacturing of medium quality of fatty acid through distillation of hidrogenated splitted palm fatty acid distillate perlindungan pihak tertanggung asuransi tuntutan ganti kerugian dari pihak ketiga (studi pt asuransi intra asia) desain pengecoran runner propeller berbahan kuningan (60% cu / 40% zn) turbin air berdaya 118 w debit 12 l/s cetakan pasir pertimbangan hakim menjatuhkan hukuman kepada anak pelaku tindak pidana pencabulan (studi putusan pengadilan negeri pontianak nomor i/pid.sus.anak/2014/pn.ptk putusan pengadilan negeri medan nomor 2/pid.sus-anak/2014/pn.mdn) pelaksanaan perkawinan sebagai sanksi bagi pelaku khalwat persepektif undang-undang nomor 1 tahun 1974 tentang perkawinan kompilasi hukum islam (atudi kota langsa) pengaruh campuran bahan bakar premium, hidrogen, etanol 96% performansi emisi gas buang esin genset otto analisis dimensi kestabilan pemecah gelombang pelabuhan perikanan lampulo banda aceh employee relations kepuasan kerja sistem pencarian kata media massa online menggunakan algoritma rabin-karp penerapan budaya perusahaan pt. pegadaian (persero) ( pt. pegadaian (persero) wilayah i kota medan ) penentuan jumlah lokasi halte monorel model set covering problem( rencana pembangunanan monorel medan- koridor i) studi pembuatan rempeyek bercita rasa daun kayu manis (cinnamomum burmannii) analisis komponen kimia uji aktifitas antibakteri minyak atsiri daun sirih merah (piper ornatum n) asal pematang siantar analisis bakteri coliform air minum menggunakan metode most probable number (mpn) analisis cemaran mikroba kualitas treated water metode pour plate pt coca-cola bottling indonesia unit medan penetapan kadar asam salisilat sediaan bedak salicyl secara kromatografi cair kinerja tinggi (kckt) uji disolusi tablet kalsium laktat produksi pt. kimia farma (persero) tbk. plant medan penetapan kadar bahan baku parasetamol digunakan pt. kimia farma (persero) tbk. plant medan secara hplc (high performance liquid chromatography) efektivitas koagulan pac (poly aluminium chloride) tawas (alum) logam nitrit (no2) air baku pdam tirtanadi hamparan perak uji disolusi kalium diklofenak sediaan tablet menggunakan metode spektrofotometri ultraviolet pemeriksaan kadar besi (fe) mangan (mn) air minum isi ulang secara spektrofotometri serapan atom (ssa) balai laboratorium kesehatan daerah provinsi sumatera utara peran polisi perairan menangani tindak pidana perikanan perairan serdang bedagai (studi satuan kepolisian perairan resort serdang bedagai) sanksi denda pelaku tanpa izin melakukan kegiatan industri kecil berdasarkan persepktif uu no. 3 tahun 2014 tentang perindustrian (studi putusan pengadilan negeri medan no. 974/pid.b/2014/pn.mdn) tindak pidana bersyarat pelaku kecelakaan lalu lintas dilakukan oleh anak praktik (studi putusan nomor 217/pid.sus/2014/pt.bdg) pasar wisata rumah diorama tembakau deli perlindungan konsumen atas informasi tidak benar mengenai undian berhadian kegiatan perbankan (studi bank pembangunan daerah jawa barat banten cabang medan) tinjauan yuridistanggungjawab pt. kereta api indonesia pengangkutan cpo ptpn iv kebun air batu (studi pt. kereta api medan) perbedaan hubungan ekspresi vegf antara tumor ovarium ganas jinak tradisi pertanian tantangan globalisasi ( kelangsungan tradisi pertanian masyarakat karo) tinjauan hukum administrasi negara penyelenggaraan pemerintahan desa menurut undang-undang nomor 6 tahun 2014 tentang desa (studi desa ujung gading kabupaten labuhan batu selatan) tindak pidana membantu melakukan pencurian kekerasan dilakukan oleh anak (studi putusan nomor 03/pid.sus-anak/2014/pn.mdn) kajian hukum administrasi negara pelaksanaan pelayanan publik berdasarkan undang-undang nomor 25 tahun 2009 (studi kecamatan sibolga kota) penjatuhan sanksi narapidana melakukan tindak pidana selama menjalani pembinaan menurut hukum pidana indonesia (studi lembaga pemasyarakatan kelas i tanjung gusta medan) palm fatty acid distillate (pfad) as an alternative raw material to produce double press and rubber grade fatty acid analisis yuridis pengurangan pungutan oleh otoritas jasa keuangan sebagai akibat dari kepailitan pengaruh keterlambatan pembayaran premi pengajuan klaim asuransi pt. sun life financial indonesia jakarta (studi pt. sun life financial indonesia kantor pusat jakarta) perlindungan hukum penumpang sebagai pengguna jasa angkutan umum pengangkutan darat (studi cv. pas transport) tanggung jawab yuridis para pihak pengiriman tebu dari kebun ke pabrik (studi kebun sei semayang ptpn ii) kewenagan menangkap mengadil bajak laut wilayah jurisdiksi indonesia berdasarkan hukum internasional peranan kepolisian penanggulangan penyalahgunaan narkotika ( wilayah hukum polres tobasa) pertanggungjawaban pidana orang sengaja tidak melaporkan adanya tindak pidana menguasai narkotika (studi putusan pengadilan negeri medan nomor 409/pid.b/2014/pn.mdn.) penerapan concurrent engineering tools design structure matrix perancangan produk ban persaingan sesama merek (intrabrand) dikaitkan pembatasan perdagangan secara vertikal perlindungan hak konsumen atas pengguna jasa penerbangan hal kenaikan harga tiket tinggi ketika musim libur keselamatan penerbangan (studi pt. garuda indonesia kantor cabang medan) analisis hukum mengenai tindak pidana pencurian pemberatan dilakukan oleh anak sebagai pelaku kejahatan perspektif kriminologi ( putusan no.21/pid.sus-anak/2014/pn.mdn) analisis profitabilitas pengembangan usaha ( dian aquatik indonesia) analisis strategi bersaing usaha laundry padang bulan ( cheap laundry) hubungan manajemen konflik produktivitas kerja karyawan pdam tirtanadi kota medan kantor cabang padang bulan an analysis of symbols in john millington synge’s riders to the sea analisis pengaruh penerapan prinsip good corporate governance kinerja perusahaan bursa efek indonesia pengaruh intellectual capital, asetri informasi nilai pasar ekuitas cost of equity capital perusahaan otomotif terdaftar bei (2011-2013) petani nilam (studi deskriptif pengetahuan petani budidaya tanaman nilam kecamatan sitellu tali urang jehe kabupaten pakpak bharat) evaluasi fungsi hidraulika bangunan utama termasuk bangunan bagi box tersier irigasi desa tanjung beringin kecamatan munte kabupaten tanah karo sumatera utara respons pertumbuhan produksi kedelai (glycine max l.) pupuk hayati pupuk organik cair dari limbah cair tahu tindak pidana judi menurut hukum positif (kuhp) qanun nomor 13 tahun 2003 harga diri narapidana lembaga pemasyarakatan wanita kelas iia tanjung gusta medan aktivitas mikroorganisme tanah hutan bekas letusan gunung sinabung kabupaten karo perporma biaya operasional mesin pencacah pelepah sawit rancangan upt mekanisasi pertanian provinsi sumatera utara evaluasi kinerja operasi pemeliharaan sistem irigasi suka damai kecamatan sei bamban kabupaten serdang bedagai uji jumlah batang pengaduk alat pengering kelapa parut (desisccated coconut) analisis pengaruh volume produksi kedelai, jagung, ubi kayu ubi jalar tingkat konsumsi beras sumatera utara peranan sektor pertanian mengurangi ketimpangan pedapatan antar daerah provinsi sumatera utara analis dampak perubahan harga bahan bakar minyak (bbm) biaya input output ayam broiler kabupaten deli serdang ( kecamatan galang kabupaten deli serdang) faktor-faktor memepengaruhi pendapatan wanita usaha lemang dn kontribusinya pendapatan keluarga ( kota tebing tinggi) efektivitas pelaksanaan program pemberdayaan lanjut usia oleh unit pelaksana teknis pelayanan sosial (upt) tuna rungu wicara lanjut usia kelurahan bukit sofa kecamatan siantar sitalasari kotamadya pematang siantar tingkat pengetahuan penderita keluarga penderita tentang kanker payudara rumah sakit umum pusat haji adam malik medan tahun 2013 hubungan struktur tari, musik iringan, fungsi sosial tari galombang dipertunjukan sanggar tigo sapilin upacara adat perkawinan masyarakat minangkabau kota medan pengaruh jus buah stroberi (fragaria x ananassa) diskolorasi gigi disebabkan oleh kopi analisis potensi ekonomi wilayah provinsi sumatera utara pengaruh karakteristik sosial ekonomi sikap petani penerapan padi sawah sri (system of rice intensification) analisis perwilayahan komoditas kubis/kol kabupaten karo provinsi sumatera utara perbandingan kadar serum seruloplasmin preeklamsia berat early onset late onset formulasi ekstrak propolis sediaan gel sebagai anti-aging gambaran pola menstruasi siswi sma as-syafi’iyah medan tahun 2014 strategi komunikasi guru mengembangkan kemandirian anak usia dini ( sekolah alam bukit hijau medan) analisis perhitutungan biaya sumberdaya domestik komoditi padi sawah kecamatan perbaungan kabupaten serdang bedagai perancangan ulang tata letak fasilitas produksi menerapkan travel chart, algoritma blocplan corelap pt. cahaya bintang medan efek aktivitas masyarakat kelimpahan ikan torsp sungai batang gadis kabupaten mandailing natal sumatera utara faktor risiko dapat diubah tidak dapat diubah pasien penderita penyakit jantung koroner rsup ham medan analisis perbandingan pendapatan petani kopi ateng menjual bentuk gelondong merah (cherry red) kopi biji desa bangun das mariah, kecamatan panei, kabupaten simalungun) profil penderita otitis media supuratif kronis (omsk) tipe bahaya rsup. h. adam malik medan tahun 2006-2010 uji daya hambat sampo mengandung minyak kelapa murni terhidrolisis jamur penyebab ketombe pengaruh suhu waktu aktivasi kualitas arang aktif strobilus pinus (pinus merkusii jungh & de vr) pengaruh komponen arus kas, laba akuntansi, ukuran perusahaan return saham perusahaan manufaktur terdaftar bursa efek indonesia (bei) analisis usia arrester jaringan distribusi sambaran kilat menggunakan atpemtp pln ranting medan johor pelaksanaan prinsip kehati-hatian bank mandiri ditinjau dari uu no.10 tahun 1998 tentang perbankan (studi bank mandiri area balai kota medan) hubungan antara karakteristik petani peternak sapi kinerja penyuluh (kasus desa ara condong, kecamatan stabat kabupaten langkat) analisis pengembangan potensi wisata sumber daya alam wilayah pesisir berbasis masyarakat pantai talugawu desa banuagea kabupaten nias utara pengaruh ukuran partikel pati variasi volume plasticizer gliserol karakteristik film bioplastik pati kentang kedudukan hukum badan penyelenggara jaminan sosial (bpjs) kesehatan sistem jaminan sosial nasional (sjsn) tanggung jawab hukum bank menyelesaikan kredit macet (studi bank rakyat indonesia cabang kabanjahe) perlindungan hukum penerima waralaba apabila terjadi sengketa menurut peraturan pemerintah nomor 42 tahun 2007 praktik kerja lapangan mandiri tentang mekanisme penagihan tunggakan pajak kantor pelayanan pajak pratama medan polonia implikasi peraturan otoritas jasa keuangan nomor 29/pojk.05/2014 tentang penyelenggaraan usaha perusahaan pembiayaan selaku pembina pengawas perusahaan pembiayaan (studi pt. adira dinamika multi finance medan) asuhan keperawatan an. t masalah gangguan kebutuhan dasar rasa aman nyaman rsud. dr. pirngadi medan pengaruh brand equity sari roti kepuasan pelanggan kelurahan titi rantai, kecamatan medan baru, kota medan penegakan hukum oleh polisi menangani tindak pidana narkotika kampus khususnya wilayah hukum polda sumut peranan yayasan pusaka indonesia proses pendampingan korban eksploitasi seksual anak optimasi konsentrasi kitosan molekul tinggi sabun transparan antibakteri pengetahuan perilaku dokter gigi tindakan pencabutan gigi penderita diabetes mellitus kecamatan medan selayang periode januari-februari 2014 pengaruh inventory turnoverratio debtors’ turnoverratio gross profitmargin studi empiris perusahaan manufaktur terdaftar bursa efek indonesia rancang bangun kompresor pipa kapiler mesin pengering pakaian sistem pompa kalor daya 1pk tinjauan yuridi tindak pidana kekerasan anak menyebabkan kematian ( putusan pengadilan negeri simalungun no.791/pid.b/2011/pn.sim) penetapan kadar protein susu kedelai bermerek tidak bermerek metode kjeldahl pengaruh penambahan larutan zat kapur kenaikan ph air pengolahan pdam tirtanadi ipa sunggal sistem pengawasan intern gaji upah pegawai pt. telkom sub area medan sistem pengawasan internal pembiayaan kantor camat kecamatan medang deras kabupaten batu bara keragaman genetik tiga populasi kelapa sawit (elaeis guinensis jacq.) tipe pisifera berdasarkan marka rapd pemanfaatan fungi asprgillus flavus, aspergillus tereus, tricodherma harzianum meningkatkan pertumbuhan bibit ceriops tagal kualitas pelayanan publik pt. pegadaian (persero) (studi kantor pt. pegadaian (persero) upc padangmatinggi, kota padangsidimpuan) pengaruh stres pola makan mahasiswa tingkat akhir fakultas keperawatan universitas sumatera utara (usu) konsep diri pengguna napza pusat rehabilitasi al-kamal sibolangit centre pengaruh ukuran perusahaan profitabilitas leverage perputaran persediaan sebagai variabel moderasi perusahaan manufaktur sektor konsumsi terdaftar bei tahun 2011-2013 pengaruh client size, finacial distress, return on asset, public ownership auditor switching perusahaan real estate & property terdaftar bei analisis kesesuaian pencatatan pelaporan keuangan badan perencanaan pembangunan kota medan berdasarkan peraturan pemerintah nomor 71 tahun 2010 pengaruh keputusan investasi, keputusan pendanaan, profitabilitas nilai perusahaan kebijakan dividen sebagai variabel intervening perusahaan manufaktur terdaftar bursa efek indonesia periode 2011-2014 analisis pengaruh laba akuntansi laba tunai dividen kas likuiditas sebagai variabel moderasi perusahaan manufaktur bursa efek indonesia analisis pengaruh pertumbuhan penjualan, ukuran perusahaan, earning per share (eps), debt to equity ratio (der), economic value added (eva) harga saham perusahaan consumer goods terdaftar bursa effek indonesia (periode 2011-2013) analisis pengaruh penagihan pajak aktif penerimaan tunggakan pajak ( kpp pratama medan timur) analisis pengaruh penerapan sistem akuntansi pemerintahan daerah kompetensi sumber daya manusia kualitas laporan keuangan pemerintahan daerah provinsi sumatera utara pengaruh tipe industri, ukuran dewan komisaris profitabilitas pengungkapan corporate social responsibility kepemilikan institusional sebagai variabel moderating perusahaan manufaktur terdaftar bursa efek indonesia pengaruh solvabilitas rentabilitas kinerja keuangan ukuran perusahaan sebagai variabel moderating grup mopoli raya tahun 2005-2013 pengaruh audit internal pengendalian internal penerapan good corporate governance pdam tirtanadi medan pengaruh investasi, earning per share (eps) dividend per share (dps) harga saham perusahaan asuransi terdaftar bei tahun 2010-2013 pengaruh budaya organisasi, kepemimpinan kepuasan kerja komitmen organisasi kinerja karyawan pt. telkom medan pengaruh kecerdasan emosional kecerdasan spiritual kinerja karyawan dinas perhubungan provinsi sumatera utara pengaruh pengetahuan kewirausahaan ketersediaan informasi keinginan menjadi wirausaha mahasiswa s-1 manajemen fakultas ekonomi bisnis universitas sumatera utara pengaruh audit sumber daya manusia efektivitas organisasi pegawai pt. perkebunan nusantara iii (persero) pengaruh pengetahuan kewirausahaan, kepribadian, lingkungan keinginan berwirausaha mahasiswa program studi manajemen fakultas ekonomi bisnis universitas sumatera utara pengaruh kualitas pelayanan loyalitas pasien melalui kepuasan pasien rumah sakit tk ii putri hijau kesdam i/bb medan faktor-faktor mempengaruhi masyarakat membeli produk orijinal ekonomi kreatif kecamatan medan sunggal dampak pemekaran wilayah kinerja ekonomi daerah kota lhokseumawe analisis pengaruh right issue diterbitkan oleh warrant issuers non warrant issuers return saham perusahaan bursa efek indonesia integrasi overall equipment effectiveness failure mode and effect analysis meningkatkan efektivitas mesin hammer mill pt. salix bintama prima perancangan pusat konservasi satwa tanaman mangrove “ono niha zoological park”, kawasan ekonomi khusus, idea land, teluk dalam, nias selatan aktivitas antibakteri ekstrak etanol cacing tanah (megascolex sp.) bakteri salmonella typhosa, escherichia coli, shigella dysenteriae daya hambat ekstrak etanol kulit buah manggis (garcinia mangostana l.) bakteri enterococcus faecalis sebagai alternatif bahan medikamen saluran akar (in vitro) efek antiinflamasi ekstrak jahe merah (zingiber officinalle roscoe) gigi kelinci (oryctolagus cuniculus) (penelitian in vivo) efek analgesik ekstrak jahe merah (zingiber officinalle roscoe) inflamasi pulpa gigi kelinci (oryctolagus cuniculus) (penelitian in vivo) nilai konversi jarak vertikal dimensi oklusi panjang jari tangan kanan suku batak toba pengaruh perendaman basis gigitiruan resin akrilik polimerisasi panas ekstrak kayu manis jumlah candida albicans pengaruh laju aliran saliva kondisi periodontal penderita gangguan jiwa mengkonsumsi obat-obatan antipsikosis rumah sakit tuntungan kekasaran permukaan resin komposit nanofiller setelah pengaplikasian bahan pemutih gigi karbamid peroksida 10% 35% perbedaan kekuatan kompresi gipsum tipe iii pabrikan daur ulang serta gipsum tipe iii daur ulang penambahan larutan zink sulfat 4% sebagai bahan model kerja gigitiruan perbandingan indeks plak pengguna pesawat ortodonti cekat murid sma swasta harapan 1 sma negeri 1 medan perbedaan pengaruh teknik dry-bonding, water wet-bonding ethanol wet-bonding restorasi klas ii resin komposit nanohybrid celah mikro (in vitro) perbedaan dampak maloklusi anterior status psikososial menggunakan indeks pidaq siswa sma global prima nasional plus sma pangeran antasari hubungan antara tingkat pengetahuan guru-guru sd kecamatan medan selayang penatalaksanaan gigi avulsi perbedaan tensile bond strength resin komposit nanohybrid menggunakan sistem adhesif total-etch self-etch restorasi klas i (penelitian in vitro) prevalensi trauma gigi permanen anterior anak sekolah menengah pertama kecamatan medan maimun medan selayang kondisi periodontal pasien gigi tiruan sebagian lepasan (gtsl) akrilik dibuat klinik prostodonti fkg usu perubahan warna lempeng resin akrilik polimerisasi panas setelah perendaman ekstrak daun jambu biji 30% analisa konveksitas jaringan lunak wajah menurut subtelny mahasiswa india tamil malaysia fkg usu prediksi panjang mandibula dewasa menggunakan usia skeletal vertebra servikalis anak perempuan usia 9-14 tahun medan efektivitas pemakaian obat kumur non-alkohol setelah menyikat gigi akumulasi plak siswa sma negeri 11 medan pengaruh hutang, operating ratio, earning power of total invesment, rate of return for owners , working capital, quick ratio dividen tunai perusahaan perkebunan terdaftar bei periode 2009-2013 pengaruh kompetensi sumber daya manusia teknologi informasi kepuasan peserta bpjs ketenagakerjaan kantor cabang tanjung morawa pengaruh good corporate governance corporate social responsibility tindakan pajak agresif perusahaan manufaktur terdaftar bursa efek indonesia periode 2011 -2013 pengaruh komitmen organisasi kinerja auditor konflik peran ketidakjelasan peran sebagai variabel moderating (studi empiris kantor akuntan publik kota medan) analisis pengaruh book tax differences peringkat obligasi perusahaan ukuran perusahaan sebagai variabel kontrol emiten indeks kompas100 bursa efek indonesia tahun 2012-2014 pengaruh nilai perusahaan, profitabilitas, likuiditas ukuran perusahaan dividend payout ratio perusahaan property real estate terdaftar bei 2011-2013 analisa cemaran mikroba treated water soft water metode rapid test (agt test) pt.coca-cola bottling indonesia unit medan penetapan kadar cu makanan cokelat secara spektrofotometri serapan atom penetapan potensi neomisin sulfat krim betason-n secara mikrobiologi uji disolusi tablet dimenhidrinat diproduksi oleh pt. mutiara mukti farma (mutifa) uji disolusi kapsul piroksikam secara spektrofotometri uv penetapan kadar bahan baku hidrokortison asetat pt. kimia farma (persero) tbk. plant medan secara hplc (high performance liquid chromatography) penentuan bilangan asam bobot jenis serta kelarutan etanol dari minyak nilam (pogostemon cablin b.) uji disolusi natrium diklofenak sediaan tablet menggunakan metode spektrofotometri ultraviolet uji mutu bahan baku riboflavin sebagai bahan baku vitamin b kompleks diproduksi oleh pt. kimia farma (persero) tbk. plant medan analisis kadar logam kadmium (cd) air minum kemasan galon isi ulang metode spektrofotometri serapan atom pemeriksaan narkotika melalui urine menggunakan alat multi drugs metode rapid test penetapan kadar iodium garam metode iodometri penetapan kadar air bakso ikan kemasan secara gravimetri uji disolusi tablet gliseril guaiakolat diproduksi oleh pt. mutifa evaluasi pengelolaan obat program malaria instalasi farmasi dinas kesehatan provinsi sumatera utara efektivitas koagulan poly aluminium chloride (pac) tawas logam aluminium air baku pdam tirtanadi hamparan perak uji cemaran mikroba kembang gula lunak bukan jelly identifikasi hidrokuinon sediaan kosmetik secara kromatografi lapis tipis (klt) nilai pendidikan novel kakak batik karya seto mulyadi analisis sosiologi sastra penentuan tinggi badan berdasarkan panjang telapak kaki geografi dialek bahasa minangkabau kabupaten pesisir selatan kualitas visum et repertum perlukaan korban hidup kota medan produksi tindak tutur ilokusi bahasa indonesia anak autistik hiperaktif analisis psikopragmatik perbandingan tingkat keberhasilan kateter fleksibel kaku inseminasi intrauteri pengaruh perendaman cetakan alginat larutan sodium hipoklorit 0,5% glutaraldehid 2% perubahan dimensi pemeriksaan kandungan mineral daun ekor naga (rhaphidophora pinnata (l.f.) schott) secara spektrofotometri serapan atom pengaruh penambahan serat kaca penyerapan air kekuatan transversal serta modulus elastisitas bahan basis gigitiruan nilon termoplastik penurunan jumlah bakteri saliva setelah berkumur larutan ekstrak kayu manis (cinnamomum burmanii) 2,5% mahasiswa fkg usu efek berkumur metode oil pulling menggunakan minyak kelapa jumlah koloni bakteri plak mahasiswa fkg usu analisis faktor-faktor mempengaruhi keputusan konsumen pembelian produk- produk online shop (studi mahasiswa-mahasiswi fakultas ilmu sosial ilmu politik universitas sumatera utara) pengaruh coaching training (pelatihan) kinerja karyawan bank syariah mandiri cabang rantau prapat analisis faktor-faktor mempengaruhi keputusan pembelian toko pinkylips_shop jejaring sosial instagram pengaruh fungsi pengawasan disiplin kerja karyawan pt. bona trans persada cabang medan pengaruh stres kerja kinerja pegawai rumah sakit umum daerah (rsud) tengku mansyur kota tanjungbalai peranan pemerintah meningkatkan partisipasi masyarakat pembangunan infrastruktur (studi desa limau manis kecamatan tanjung morawa kabupaten deli serdang) kualitas pelayanan pengurusan sertifikat hak milik atas tanah (studi badan pertanahan nasional kabupaten humbang hasundutan) pengaruh game-online perilaku remaja kelurahan padang bulan kecamatan medan baru kota medan faktor-faktor penyebab terjadinya pernikahan usia muda kelurahan sawit seberang kecamatan sawit seberang kabupaten langkat respon peserta program keluarga harapan (pkh) pelaksanaan program keluarga harapan desa landuh kecamatan rantau kabupaten aceh tamiang peranan yayasan pusat kajian perlindungan anak (pkpa) meningkatkan kemandirian masyarakat melalui credit union sumber rejeki pinang baris kecamatan medan sunggal kota medan sosial ekonomi keluarga hubungannya prestasi belajar anak smk telkom sandhy putra medan an analysis of moral values in maher zain’s selected song lyrics respon masyarakat kecamatan pahae julu kehadiran pt. sarulla operation limited (sol) kabupaten tapanuli utara faktor dominan penyebab anak menjadi anak jalanan kota binjai respon calon peserta tata cara pngurusan kartu badan penyelenggara jaminan sosial (bpjs) kesehatan kantor cabang utama medan dampak jejaring indomaret kondisi sosial ekonomi pedagang eceran (studi korelasi kelurahan padang bulan, kota medan) preparasi karakterisasi liquid natural rubber (lnr) sebagai kompatibiliser meningkatkan sifat mekanik sifat termal kompon karet alam penggunaan karboksimetil kitosan dari cangkang belangkas (tachypleus gigas) sebagai adsorben menurunkan konsentrasi logam pb studi pemanfaatan zeolit alam aktif sebagai penyerap ammonia akuarium sebagai media budidaya ikan tawar pengaruh pengulangan pemakaian minyak goreng curah kandungan ion besi (fe3+) penurunan jumlah bakteri saliva setelah berkumur larutan ekstrak daun salam (eugenia polyantha) 1,25% mahasiswi usu efektivitas penurunan jumlah bakteri rongga mulut berkumur air rebusan daun sirih 10% dibandingkan obat kumur mengandung cetylpiridinium chloride (cpc) mahasiswa fkg usu faktor-faktor mempengaruhi profit distribution manajement unit usaha syariah indonesia pengaruh good corporate governance, ukuran perusahaan, leverage, profitabilitas integritas laporan keuangan perusahaan manufaktur terdaftar bursa efek indonesia tahun 2010-2012 analisis pengaruh profitability, current ratio, debt to equity ratio, market to book value ratio, corporate tax, sales growth, cash flow dividend payout ratio perusahaan manufaktur terdaftar bursa efek indonesia periode 2009-2013 pengaruh struktur aktiva, return on assets, pertumbuhan penjualan, ukuran perusahaan, price earning ratio, likuiditas struktur pendanaan kepemilikan institusional sebagai variabel moderating perusahaan manufaktur terdaftar bursa efek indonesia pengaruh good corporate governance implementasi international financial reporting standard (ifrs) manajemen laba (studi empiris perusahaan pertambangan terdaftar bursa efek indonesia) pengaruh penerapan standar akuntansi pemerintahan sistem pengendalian intern pemerintah kualitas laporan keuangan pemerintah daerah pengaruh nilai nasabah, kualitas pelayanan, deposito mudharabah atribut produk syariah kepuasan nasabah ( bank syariah mandiri cabang medan) pengaruh corporate social responsibility, kepemilikan institusional, kepemilkan asing nilai perusahaan perusahaan manufaktur terdaftar bursa efek indonesia tahun 2011 2013 pengaruh return on asset (roa) pertumbuhan penjualan debt to equity ratio (der) perusahaan tekstil terdaftar bursa efek indonesia (bei) pengaruh entrepreneurial networking lingkungan bisnis eksternal kinerja usaha umkm pengaruh diferensiasi produk kepercayaan merekterhadap keputusan pembelian mobil avanza pt.astrainternasionaltbk-toyota auto 2000 medan pengaruh price earning ratio, price to book value, dividend yield, tingkat bunga deposito perubahan harga saham perusahaan perbankan bursa efek indonesia pengetahuan konsumen mengenai perbankan syariah pengaruhnya keputusan menjadi nasabah bank syariah muamalat cabang rantau prapat tinjauan yuridis open sky asean 2015 regulasinya penerbangan indonesia pertanggungjawaban pidana anak penyalahgunaan internet sebagai media bullying menurut undang undang no 11 tahun 2008 penerapan undang-undang nomor 28 tahun 2014 tentang hak cipta produksi karya seni berupa rekaman musik daerah ( studi elta record kota bukittinggi ) gaya bahasa beberapa puisi karya du fu peran kantor pertanahan kabupaten simalungun masyarakat dikecamatan sidamanik rangka pendaftaran tanah serta pelaksanaannya berdasarkan uu pa peraturan pemerintah nomor24 tahun 1997 pengaruh situs jejaring sosial pemanfaatan website perpustakaan usu pengaturan batas wilayah laut menurut undang-undang no. 32 tahun 2014 tentang kelautan relevansinya united nations convention on the aw of the sea 1982 proses pengungkapan diri(self disclosure) kaum gay ( tentang pengungkapan diri(self disclosure) kaum gay kota medan) evaluasi literasi informasi menggunakan empowering 8 pengguna perpustakaan universitas hkbp nommensen medan persentase tutupan bentuk pertumbuhan karang hidup perairan pulau ungge kabupaten tapanuli tengah desain arsitektur informasi situs web perpustakaan universitas sumatera utara pengaruh pemberian ekstrak segar buah andaliman (zanthoxylum acanthopodium dc.) gambaran histologis ginjal mencit jantan (mus musculus l.) analisis sinonim kata menyatakan biaya kalimat bahasa jepang deskripsi pertunjukan tari merak upacara perkawinan masyarakat adat sunda kota medan analisis kemampuan pustakawan pengelolaan database perpustakaan politeknik negeri medan (polmed) analisis pragmatik cerita novel “hidamari no kanojo” karya koshigaya osamu analisis citra berformat jpeg hasil olahan dari citra original berdasarkan metode matching block deteksi tepi block jpeg terkompresi analisis nyanyian bhajan sekte sai baba medan analisis tekstual musikal ende tarombo si raja lontung disajikan oleh marsius sitohang trio lasidos studi komparatif musikal studi deskriptif ketoprak dor oleh sanggar langen setio budi lestari upacara adat perkawinan jawa kelurahan jati makmur kecamatan binjai utara kota binjai analisis tekstual melodi sukut-sukutan nangan si tapisuria turang si palameka disajikan oleh rosintan kesigihen masyarakat pakpak dusun lae salak, desa lae sireme, kecamatan tiga lingga, kabupaten dairi, sumatera utara kajian organologis gonrang sidua-dua buatan bapak rossul damanikdi desa sarimatondang 1 kecamatan sidamanik, kabupaten simalungun organologi akustika gitar bass solid elektrik fretless oleh bapak zulkarnaen lubis jalan bridgen katamso no.89 kelurahan kampung baru kota medan morfologi bahasa pakpak dialek simsim pengaruh motivasi, persepsi, pembelajaran, kepercayaan sikap konsumen keputusan pembelian produk laptop merek asus pengunjung plaza medan fair pembuatan karbon aktif dari kulit salak (salacca sumatrana) aktivator seng klorida (zncl2) analisis paparan kebisingan penanggulangannya secara ergonomis pt.permata hijau palm oleo medan pengaruh spiritualitas kepuasan hidup pensiunan tanggap pertumbuhan produksi sawi (brassica juncea l.) pemberian pupuk cair evaluasi pelaksanaan tugas jurusita pajak negara pencairan tunggakan pajak (studi kantor pelayanan pajak pratama lubuk pakam) penggunaan berbagai pupuk kandang pertumbuhan sukun (artocarpus communis forst ) dta danau toba, kecamatan haranggaol horison pengaruh netralisasi penurunan asam lemak bebas peningkatan nilai karoten pusat penelitian kelapa sawit penetapan bilangan asam bilangan penyabunan serta kadar asam lemak bebas minyak kelapa murni (virgin coconut oil) penetapan kadar parasetamol sediaan tablet parasetamol secara kromatografi cair kinerja tinggi (kckt) pemeriksaan bakteri salmonella makanan padat (nugget ayam) efektivitas penggunaan fasilitas biro umum kantor gubernur provinsi sumatera utara fungsi anggaran sebagai alat perencanaan pengawasan biaya operasional yayasan kesehatan telkom area i sumatera hubungan tingkat pengetahuan sikap tindakan mahasiswi akademi kesehatan pemerintah kabupaten langkat tentang perilaku hidup bersih sehat (phbs) tahun 2015 studi perbandingan faktor-faktor (leverage, likuiditas, profitabilitas) perusahaan menerima opini audit wajar tanpa pengecualian perusahaan menerima opini audit wajar tanpa pengecualian bahasa penjelas, studi empiris perusahaan real estate properti tahun 2013 analisis tingkat underpricing saham saat penawaran umum perdana bursa efek indonesia analisis potensi pengaruh waktu penyimpanan buah mutu minyak kelapa sawit tipe dura, pisifera, tenera kebun bangun bandar, dolok masihul, sumatera utara studi sistem informasi geografis (sig) bagi perencanaan penghijauan kota tebing tinggi implementasi program penanggulangan tb paru puskesmas pijorkoling kota padangsidimpuan tahun 2015 analisis pengaruh display produk minat beli konsumen swalayan willow mart binjai pengaruh penambahan ekstrak kulit manggis (garcinia x mangostana l.) nilai spf krim tabir surya kombinasi avobenson oktil metoksisinamat pengaruh penambahan minyak biji anggur (grape seed oil) efektivitas sediaan tabir surya kombinasi oksibenzon oktilmetoksisinamat basis vanishing cream analisis pelaksanaan posyandu lansia kecamatan medan deli tahun 2015 analisis implementasi penanganan hiv aids rumah sakit hkbp balige tahun 2015 penetapan strategi bisnis pt. pabrik es siantar, pematangsiantar analisis faktor-faktor mempengaruhi kinerja karyawan pabrik kue cv fawas jaya medan pengaruh motivasi kerja kepuasan kerja prestasi kerja karyawan pt. angkasa pura ii (persero) bandara internasional kualanamu pengaruh kualitas pelayanan kepuasan pelanggan (studi kentucky fried chicken mongonsidi, medan) pengaruh kualitas pelayanan publik loyalitas konsumen (studi pt telkom medan) pengaruh konsentrasi inhibitor ekstrak metanol daun lamtoro (leucaena leucocephala l) laju korosi baja karbon schedule 40 grade b serta jumlah fe c terkorosi natrium klorida 3 % efek aplikasi pasta cpp-acp mikrostruktur permukaan enamel gigi setelah bleaching pengukuran indeks kepuasan masyarakat pelayanan publik kecamatan medan deli, medan barat medan timur kota medan penerapanelectronic voting sebagai perwujudan asas langsung, umum, bebas, rahasia, jujur, adil pemilihan umum kepala daerah indonesia pemberian jaminan produk halal konsumen muslim ditinjau dari undang-undang nomor 33 tahun 2014 tentang jaminan produk halal strategi bisnis usaha jasa doorsmeer menarik konsumen (studi sabena doorsmeer medan) identifikasi senyawa penyusun minyak atsiri kulit kayu manis (cinnamomum burmannii)dari lubuk pakam, laguboti dolok sanggul menggunakan gc-ms peran perawat mengatasi dampak hospitalisasi anak rsup haji adam malik medan gambaran perawatan diri narapidana wanita lembaga pemasyarakatan klas iia wanita tanjung gusta medan determinan pemanfaatan ulang sarana pelayanan kesehatan oleh anggota polri keluarganya rumah sakit bhayangkara tebing tinggi tahun 2015 analisis penatalaksanaan program penanggulangan tuberkulosis paru strategi dots puskesmas desa lalang kecamatan medan sunggal tahun 2015 pengaruh kualitas pelayanan, harga, citra merek kepuasan pelanggan pemakaian jasa transportasi bus pt. ats (aceh transport) strategi pengembangan usaha baju impor bangkok (studi toko daju “dscarpashop jl. sei padang 1 no. 24 medan) analisis pengaruh prestasi kerja karyawan promosi jabatan ( karyawan pt. sumber cipta multiniaga medan) strategi bauran pemasaran meningkatkan penjualan toko naufal fashion binjai pengaruh keselamatan kesehatan kerja produktivitas kerja karyawan pt. multi structure duri-riau pengaruh kualitas pelayanan jasa perbankan kepuasan nasbah bank sumut cabang pembantu seribudolok analisis faktor-faktor mempengaruhi keputusan konsumen membeli produk fashion handmade bangkok (studi penelitian isaura fashion) pengaruh strategi bauran pemasaran ritel keputusan pembelian konsumen maximart thamrin plaza medan kualitas tidur pola tidur ibu hamil trimester iii datang memeriksakan kehamilan klinik bersalin mariyati labuhan deli kecamatan medan marelan tahun 2013 hubungan pengetahuan ibu tentang manfaat jahe penurunan mual muntah kehamilan trimester i klinik nining lubuk pakam tahun 2013 efektifitas teknik relaksasi nafas mengurangi dismenore smk nusa penida medan provinsi sumatera utara tahun 2013 hubungan antara suami perokok bayi berat badan lahir rendah rsud dr. pirngadi medan tahun 2013 faktor-faktor mempengaruhi rendahnya minat ibu memilih implant sebagai alat kontrasepsi kelurahan madras hulu kecamatan medan polonia tahun 2013 analisis pengaruh nilai tukar rupiah dolar amerika, tingkat suku bunga tingkat inflasi harga saham perusahaan perkebunan terdaftar bei tahu 2007 –2012 hubungan usia ibu paritas ibu kejadian abortus rsud dr.pirngadi medan asuhan keperawatan prioritas masalah kebutuhan dasar nutrisi kurang dari kebutuhan klien diabetes melitus kelurahan harjosari i medan amplas asuhan keperawatan tn.m prioritas masalah kebutuhan dasar oksigenasi; bersihan jalan nafas rsup h. adam malik medan analisis faktor - faktor pengaruh kepadatan penduduk kabupaten asahan tahun 2012 formulasi sediaan losio tangan badan menggunakan sari kentang (solanum tuberosum l.) sebagai bahan pelembab medan science museum (arsitektur rekreasi) pusat transportasi belawan (arsitektur high-tech) medan modification centre arsitektur high tech penerapan jaringan saraf tiruan memprediksi pergerakan harga minyak mentah dunia menggunakan metode backpropagation faktor-faktor mempengaruhi tingkat keberhasilan usaha perikanan rakyat( desa sei bamban, kec. sei bamban, kab. serdang bedagai) peranan instagram sebagai media komunikasi pemasaran bisnis online (studi deskriptif kualitatif bisnis online floshablee) pengaruh karakteristik keluarga dukungan sosial pemberian makan balita kecamatan medan helvetia kota medan analisis strategi pembiayaan kredit mikro pt. bank sumut (studi pt. bank sumut kcp belawan) pola budaya matrilineal politik ( keterwakilan perempuan dprd sumatera barat tahun 2014) pengaruh sistem pemilu proporsional terbuka sosialisasi ideologi partai kampanye (studipada dpc partai pdi perjuangankabupatenlangkat) mata pencaharian petani desa hutajulu, kecamatan pollung, kabupaten humbang hasundutan (studi etnografi) pengaruh pelayanan customer service citra perusahaan (studi korelasional pengaruh pelayanan customer service citra terminal terpadu amplas medan) public relations sebagai tools marketing pengaruh lingkungan kerja fisik kinerja karyawan bank perkreditan solider cabang pematangsiantar peran koordinasi badan pelaksana penyuluhan ketahanan pangan peningkatan aksesibilitas pangan bagi daerah rawan pangan kabupaten serdang bedagai partisipasi masyarakat pelaksanaan program gerakan pembangunan swadaya masyarakat (gerbang swara) desa melati ii kecamatan perbaungan kabupaten serdang bedagai penghapusan perdagangan perempuan anak (studi implementasi peraturan daerah provinsi sumatera utara nomor 6 tahun 2004 oleh biro pemberdayaan perempuan, anak, keluarga berencana sekretariat daerah provinsi sumatera utara) efektivitas pelayanan pembuatan nomor pokok wajib pajak (npwp) melalui sistem e- registration kpp pratama medan barat koordinasi camat melaksanakan pembangunan kecamatan silima pungga-pungga kabupaten dairi implementasi peraturan menteri negara bumn nomor per-09/mbu/2012 tentang penerapan tata kelola perusahaan baik (good corporate governance) badan usaha milik negara (analisis penerapan prinsip-prinsip good corporate governance lingkungan internal perusahaan umum bulog divisi regional sumatera utara) dampak pembentukan kota gunungsitoli sosial ekonomi masyarakat desa madula kecamatan gunungsitoli kota gunungsitoli sistem informasi geografis pencarian rute terdekat jasa pengiriman barang menggunakan algoritma a* (star) berbasis mobile uji aktivitas antibakteri ekstrak etanol fraksi n-heksana serta fraksi etil asetat herba sawi tanah (adenostemma lavenia (l.) kuntze) beberapa bakteri distribusi markov-binomial negatif uji klinis pendahuluan pengaruh pemberian kapsul kombinasi ekstrak herba sambiloto (andrographis paniculata (burm.f.) nees) daun salam (syzygium polyanthum (wight) walp.) fungsi ginjal pasien dislipidemia biosintesis vitamin c dari substrat d-sorbitol oleh acetobacter xylinum metode fermentasi sistem batch culture teraduk kontinu pemanfaatan karbon aktif dari biji alpukat (persea americana mill.) sebagai adsorben logam besi tembaga limbah cair sawit menentukan jenis-jenis diatom sungai-sungai kota medan analisis kandungan besi, kalium, kalsium, magnesium bunga kecombrang (etlingera elatior) secara spektrofotometri serapan atom karakterisasi simplisia isolasi senyawa alkaloida ekstrak etanol sponge xestospongia sp de laubenfels menentukan tinggi badan dari tinggi sternum analisis kandungan kalsium, kalium, magnesium daun kelor (moringa oleifera lam.) segar direbus secara spektrofotometri serapan atom formulasi evaluasi pemakaian cangkang kapsul alginat pembuatan sediaan floating dari dispersi padat aspirin uji aktivitas antioksidan ekstrak etanol daun kangkung air (ipomoea aquatica forsk.) kangkung darat (ipomoea reptans poir.) ditanam daerah berbeda ketinggian pendugaan karbon tersimpan berbagai jalur hijau jalan arteri sekunder kota medan bagian tengah penggunaan berbagai jenis kompos pertumbuhan sukun (artocarpus communis forst ) daerah tangkapan air danau toba, kecamatan haranggaol horison gangguan humus hutan tahura berbatasan lahan pertanian masyarakat, desa dolat rayat kabupaten karo pengaruh post-treatment papan stabilitas dimensi sifat durabilitas papan partikel dari bagase sorghum evaluasi sistem pelaksanaan program pengendalian malaria wilayah kerja puskesmas sei apung kecamatan tanjung balai kabupaten asahan tahun 2015 subtitusi tepung pisang awak (musa paradisiaca var awak) ikan lele dumbo (clarias garipinus) pembuatan biskuit serta uji daya terimanya analisis perbandingan hasil antara metode certainty factor metode dempster shafer sistem pakar implementasi pengkombinasian antara metode dempster shafer theorema bayes sistem pakar determinan pemanfaatan ulang klinik diabetes mellitus puskesmas sering kecamatan medan tembung tahun 2015 prediksi inflasi indonesia menggunakan algoritma k- nearest neighbor (knn) efektivitas media leafleat media brosur peningkatan pengetahuan sikap pasien perawatan diabetes mellitus rsud dr. r. m djoelham binjai tahun 2015 kajian indeks kerusakan struktur bangunan baja berdasarkan pendekatan energi akibat gempa kuat pertanggungjawaban pidana illegal logging (pembalakan liar) sebagai kejahatan kehutanan berdasarkan undang-undang no.41 tahun 1999 tentang kehutanan undang-undang no. 18 tahun 2013 tentang pencegahan pemberantasan perusakan hutan aplikasi wet letter fermentasi produktivitas pastura campuran efektifitas badan pelaksana penyuluhan pertanian, perikanan kehutanan peningkatan kinerja penyuluh pertanian, perikanan kehutanan sumatera utara pemetaan fasilitas kesehatan berbasis web respons pasien kinerja pelayanan instalasi rawat jalan rumah sakit stroke nasional bukittinggi tahun 2015 determinan partisipasi suami program keluarga berencana desa dolat rayat kecamatan dolat rayat kabupaten karo tahun 2015 perbedaan tingkat konsentrasi sebelum sesudah adanya bising akibat aktifitas perlintasan kereta api siswa sekolah dasar negeri 067240 kecamatan medan tembung kota medan tahun 2015 analisis penerapan sistem informasi manajemen puskesmas (simpus) puskesmas pegang baru kecamatan panti kabupaten pasaman sumatera barat tahun 2014 virtualisasi objek kegiatan universitas sumatera utara (usu) berbasis animasi 3d hubungan pengetahuan sikap ibu rumah tangga pemakaian botol minuman berplastik kelurahan tanjung mulia hilir kecamatan medan deli kota medan 2015 uji daya terima selai kulit jeruk manis (citrus sinensis l) nilai gizinya pengaruh calling orientation well-being pemimpin kegiatan pelayanan rohani kristen universitas sumatera utara (usu) gambaran pengetahuan, sikap tindakan pemakaian alat pelindung diri penanganan sampah medis petugas cleaning service rsud dr. pirngadi medan tahun 2015 apakah kepercayaan citra jokowi berpengaruh signifikan secara simultan, berpengaruh signifikan secara parsial minat memilih mahasiswa jurusan ilmu politik fakultas ilmu sosial ilmu politik universitas sumatera utara pemilihan presiden 2014 pengaruh kondisi kerja stres kerja supir mobil tangki bbm pt elnusa petrofin dumai pengaruh price earning ratio (per), economic value added (eva), market value added (mva) return saham gambaran preferensi pemilihan pasangan mahasiswa karo universitas sumatera utara pencarian kata sinonim kata dokumen menggunakan algoritma two sliding windows pengaruh efektivitas kepemimpinan motivasi kerja karyawan pdam tirtauli pematangsiantar hubungan kecemasan eudaimonic well-being men who have sex with men (m-s-m) hubungan harga diri resiliensi anak multietnis batak–tionghoa pendeteksian logam fe,mn,dan cu air menggunakan sensor kitosan terintegrasi mikrokontroller at mega 8535 pola analisi jaringan sosial dinamis hubungan antara sense of humor kebahagiaan lansia pengaruh persepsi risiko pengalaman niat bertransaksi secara secara online persepsi manfaat kemudahan penggunaan teknologi sebagai variabel moderating faktor-faktor berhubungan keikutsertaan suami program keluarga berencana wilayah kerja puskesmas medan tuntungan tahun 2015 gambaran pengetahuan sikap ibu upaya penanganan diare secara dini balita wilayah kerja uptd puskesmas kecamatan gunungsitoli utara tahun 2015 gambaran higiene sanitasi penyelenggaraan makanan keberadaan bakteri escherichia coli peralatan makan lingkungan kantin universitas sumatera utara tahun 2015 peran pemulung pengelolaan sampah timbulan sampah tpa terjun kecamatan medan marelan kota medan tahun 2015 analisis implementasi peraturan daerah kota medan nomor 3 tahun 2014 tentang kawasan tanpa rokok sekolah kota medan tahun 2014 hubungan nilai anak pasangan usia subur akseptor non akseptor keluarga berencana kelurahan pekan gebang kecamatan gebang kabupaten langkat tahun 2015 perilaku mahasiswa fakultas kedokteran universitas sumatera utara tentang konsumsi makanan siap saji (fast food) medan tahun 2015 hubungan pengetahuan sikap rokok kebiasaan merokok penghuni rumah susun kecamatan sei tualang raso kota tanjungbalai tahun 2015 virtualisasi fasilitas umum kampus universitas sumatera utara (usu) virtual reality pengenalan kampus universitas sumatera utara optimalisasi penyusunan barang mobil box menggunakan algoritma firefly implementasi penggunaan metode exponential smoothing meramalkan penjualan pakaian ( toko pakaian p. tarigan) peningkatan daya serap filter air dari karbon aktif tempurung kelapa memvariasikan suhu pemanasan survey awal pengembangan potensi kota medan sebagai kota wisata optimalisasi gabungan filter arang tempurung kelapa, zeolit, pasir kuarsa penjernihan air sungai tamiang elektrokoagulasi pengaruh body image self-esteem remaja penderita skoliosis penerimaan diri individu mengalami kekerasan emosi pemanfaatan tepung buah alpukat (persea americana mill.) pembuatan bolu daya terima kandungan gizinya gambaran sikap kerja keluhan muskuloskeletal pemetik kopi dusun banua, desa purba sipinggan, kabupaten simalungun tahun 2015 hubungan intensitas kebisingan tekanan darah pekerja bengkel pt. capella medan daihatsu amplas medan tahun 2015 perbandingan algoritma simple additive weighting (saw) preference ranking organization for enrichment evaluation (promethee) pemilihan sepeda motor analisis pemanfaatan dana bantuan operasional kesehatan program promotif preventif puskesmas marike kecamatan kutambaru kabupaten langkat tahun 2015 hubungan antara psychological capital organizational citizenship behavior kkaryawan pt. telkom h.m yamin medan pengaruh konflik hubungan kerja sama franchise gerai alfamart kota medan pelaksanaan standar pelayanan minimal bidang kesehatan bayi balita puskesmas darusallam medan tahun 2013 pengetahuan sikap ibu manajemen terpadu balita sakit berbasis masyarakat desa ronga-ronga kecamatan gajah putih kabupaten bener meriah tahun 2013 sistem pengawasan internal gaji upah pegawai ptp. nusantara iii medan formulasi lipstik menggunakan ekstrak bunga tasbih (canna hybrida l) sebagai pewarna asuhan keperawatan ny.p priorotas masalah kebutuhan dasar nutrisi asuhan keperawatan ny.dh prioritas masalah kebutuhan dasar mobilisasi ruang v tanjung ii rsud. dr. pirngadi medan efektivitas terapi pijat konsentrasi belajar siswa kelas v sd negeri no. 060894 medan hubungan pengetahuan sikap personal hygiene remaja putri tindakan pencegahan keputihan sma sutomo 2 medan tahun 2015 hubungan pengetahuan sikap tindakan kebersihan organ genitalia eksterna sebagai upaya pencegahan keputihan mahasiswi fakultas kesehatan masyarakat usu medan tahun 2015 pemenuhan hak atas kesehatan anak didik pemasyarakatan (studi lembaga pemasyarakatan anak klas ii a tanjung gusta medan) analisis daya dukung pondasi tiang pancang & penurunan konsolidasi proyek pembangunan jembatan sei deli - belawan kemampuan batang jagung (zea mays) mengadsorpsi ion logam cu (ii) pembuatan karakterisasi papan partikel menggunakan serat batang kecombrang (nicolaia speciosa horan) campuran sio2 resin polyester kemampuan batang jagung (zea mays) sebagai adsorben logam fe hubungan pengetahuan, sikap tindakan sadari sebagai deteksi dini kanker payudara mahasiswi fakultas kesehatan masyarakat usu medan tahun 2015 analisis jamur penicillium khamir minuman susu kemasan susu segar beredar kota medan tahun 2015 analisis implementasi program deteksi dini kanker serviks metode iva puskesmas tanjung morawa kabupaten deli serdang tahun 2015 dukungan sosial suami kelengkapan imunisasi dasar bayi wilayah kerja puskesmas pagar jati kecamatan lubuk pakam kabupaten deli serdang tahun 2015 karakteristik penderita hiv/aids rumah sakit umum daerah dr. djasamen saragih pematangsiantar tahun 2013 – 2014 karakteristik ibu bersalin seksio sesarea rumah sakit santa elisabeth medan tahun 2013-2014 analisis penatalaksanaan program penanggulangan tuberkulosis multi drugs resisten (tb-mdr) puskesmas helvetia medan tahun 2015 perilaku remaja mengenai penggunaan gadget keluhan kelelahan mata sma negeri 6 medan tahun 2015 pemanfaatan kulit pisang raja (musa textilia )menjadi selai sebagai isian roti serta daya terima kandungan zat gizinya hubungan perilaku konsumsi makanan status gizi pns bappeda kabupaten langkat tahun 2015 pembuatan biodiesel dari minyak kemiri sunan (reutealis trisperma (blanco) airy shaw) keberadaan co-solvent aseton katalis heterogen natrium silikat terkalsinasi faktor-faktor berhubungan kejadian filariasis wilayah kerja puskesmas gambok kabupaten sijunjung provinsi sumatera barat tahun 2013 anatomi manusia berdimensi tiga menggunakan leap motion controller analisis simulasi keefektifan alat penukar kalor tabung sepusat aliran sejajar variasi kapasitas aliran pembuatan karakterisasi dekstrin dari pati umbi talas (xanthosoma sagittifolium (l.) schott) metode katalis asam enzimatis prevalensi distribusi geographic tongue pasien rsgmp fkg usu analisis pemanfaatan koleksi terbitan pemerintah perpustakaan umum kota medan persepsi pengguna sarana prasarana perpustakaan umum kantor perpustakaan arsip daerah kabupaten aceh singkil provinsi aceh lensa kontak terapeutik rehabilitatif pengaruh bauran pemasaran kualitas pelayanan kepuasan konsumen real estate puri zahara 2 kota medan penggunaan filter passive single tuned mereduksi harmonisa beban non periority stasiun kereta api bandara kualanamu modifikasi aspal menggunakan karet alam siklik (cyclic natural rubber) pembuatan karakterisasi karbon aktif kayu bakau aktivasi fisika sebagai filter penjernih air sungai tamiang melalui proses elektrokoagulasi laporan praktik kerja profesi farmasi rumah sakit rumah sakit umum daerah dr. pirngadi kota medan laporan praktik kerja profesi farmasi rumah sakit rumah sakit umum daerah dr. pirngadi kota medan gambaran spiritual lansia menderita penyakit kronis upt pelayanan sosial lansia anak balita wilayah binjai medan tingkat stres ibu primigravida multigravida menjelang proses persalinan dampak pendidikan kesehatan tentang hipertensi pemeliharaan tekanan darah ibu hamil puskesmas amplas kecamatan medan amplas analisis pelaksanaan asuhan keperawatan preoperatif pascaoperatif rsud dr.pirngadi medan stres mekanisme koping remaja pasca gempa desa cang duri kecamatan ketol kabupaten aceh tengah tahun 2014 penerapan lingkungan terapeutik oleh perawat meminimalkan reaksi hospitalisasi negatif anak ruang rawat anak hijir ismail rumah sakit umum haji medan tahun 2014 pengalaman pasien fraktur penyembuhan luka kecamatan kuala kabupaten langkat 2014 pengetahuan sikap ibu metode amenorea laktasi dusun mawar desa mancang kecamatan selesai kabupaten langkat tahun 2014 pengaruh terapi hijamah penurunan tekanan darah penderita hipertensi rumah sehat wahida medan respon stres adaptasi remaja putri dismenorea sma raksana medan status nutrisi tingkat perkembangan anak usia 3-5 tahun kelurahan denai kecamatan medan denai kota medan tahun 2014 penetapan kadar kalium daun salam (eugenia polyantha wight) segar, simplisia infusa secara spektrofotometri serapan atom pendekatan program stokastik dua tahap multi objektif desain rantai suplai mempertimbangkan risiko keuangan pembuatan pati sitrat dari pati singkong (manihot utilissima p.) metode klaushfer pemanfaatannya sebagai disintegran formolasi tablet parasetamol dibuat metode granulasi basah penggunaan zat warna kulit batang jamblang (syzygium cumini (l.) skeels) formulasi sediaan pewarna rambut efek ekstrak etanol daun belimbing wuluh (averrhoa bilimbi l.) kontraksi otot polos ileum marmut jantan (cavia porcellus) terisolasi efek ekstrak etanol daun keji beling (strobilanthus crispus (l.) blume) kontraksi otot polos ileum marmut jantan (cavia porcellus) terisolasi secara kualitatif analisis kelaikan fungsi jalan secara teknis berdasarkan peraturan menteri pekerjaan umum nomor 11/prt/m/2010 analisis pengaruh manajemen modal kerja profitabilitas perusahaan manufaktur sub sektor farmasi terdaftar bursa efek indonesia tahun 2009-2014 penerapan metode statistiqal quality control (sqc) failure mode and effect analysis (fmea) perbaikan kualitas produk pt. tirta sibayakindo pengembangan sistem pemeliharaan mesin pendekatan reliability centered maintenance (rcm) failure and mode effect analysis (fmea) pabrik kertas rokok pt. pusaka prima mandiri aplikasi business process reengineering peningkatan fungsi sales and marketing pt. abdi wibawa press analisis perbandingan metode playfair cipher elgamal kriptografi citra analisis kinerja keuangan pt perusahaan gas negara (persero) tbk medan analisis rasio profitabilitas mengukur pertumbuhan laba usaha pt. perusahaan gas negara (persero) tbk medan analisis laporan keuangan pt. perusahaan gas negara (persero) tbk, medan analisa laporan keuangan ppks ( pusat penelitian kelapa sawit ) unit marihat analisis laporan keuangan koperasi karyawan pt.pos indonesia (persero) pematang siantar perencanaan pengawasan biaya operasional pt pln (persero) cabang medan analisa manajemen aliran kas pt.pln (persero) area medan analisis rasio likuiditas berdasarkan laporan keuangan pt bank rakyat indonesia (persero) bursa efek indonesia evaluasi laporan keuangan pt pln (persero) area medan aspek ratio financial penetapan kadar hidrogen peroksida sediaan pewarna rambut secara titrasi redoks menggunakan alat autotitrator penetapan kadar protein biskuit metode kjeldahl uji disolusi tablet parasetamol diproduksi oleh pt mutiara mukti farma (mutifa) medan secara spektrofotometri uv-vis identifikasi zat warna sintetis saos cabai secara kromatografi kertas (kkt) analisisperbandingan kadar aluminium (al) air baku air reservoir pdam tirtanadi ipa sunggal secara kolorimetri penetapan bobot jenis kadar eugenol total serta kelarutan etanol dari minyak daun cengkih (syzygium aromaticum l.) penetapan kadar zinc pyrithione shampo metode iodimetri penetapan kadar logam besi (fe) air reservoir instalasi pengolahan air pdam tirtanadi sunggal secara kolorimetri identifikasi zat warna saus beredar pasar pancur batu kabupaten deli serdang secara kromatografi kertas penetapan kadar sukrosa kembang gula metode titrimetri analisis bakteri golongan coli menggunakan metode most probable number (mpn) air konsumen perumahan setia budi residence blok 1-a identifikasi asam retinoat sediaan kosmetik secara kromatografi lapis tipis peranan kompetensi pegawai teknologi informasi kinerja pegawai pt.perusahaan gas negara (pgn) tbk area medan sistem informasi manajemen (sim) kearsipan berbasis komputer pt perkebunan nusantara iii (persero) medan pelayanan prima sekretaris pt. perkebunan nusantara iii (persero) medan sistem pengendalian internal kas bmkg stasiun geofisika kelas i tuntungan sistem pengendalian internal kas pt. (persero) angkasa pura ii bandar udara internasional kualanamu sistem pengendalian internal aktiva tetap pt. (persero) angkasa pura ii bandar udara internasional kualanamu analisis tingkat kesehatan pt. bank mandiri (persero) tbk metode camel evaluasi penyusunan anggaran biaya medical karyawan pt pertamina perseromarketing operation region (mor) i medan mengukur kinerja keuangan menggunakan rasio keuangan analisis arus kas pt pertamina (persero) pengaruh sistem pemungutan pajak kendaraan bermotor upaya peningkatan pendapatan asli daerah (pad) dinas pendapatan daerah provinsi sumatera utara analisis laporan keuangan koperasi pegawai republik indonesia (kp-ri mutiara) kisaran analisis laporan keuangan koperasi pegawai republik indonesia (kp-ri mutiara) kisaran analisis rasio keuangan pt taspen (persero) masjid raya johor johor parkview mall gambaran sikap siswa pembelajaran e-learning smk tritech informatika medan pengujian pengaruh variasi head supply panjang langkah katup limbah unjuk kerja pompa hidram hubungan pengetahuan remaja putri tentang nyeri haid pelaksanaan periksa ke pelayanan kesehatan sma dharma pancasila tahun 2013 faktor – faktor mempengaruhi ibu pemilihan penolong persalinan desa paluh manan kec. hamparan perak tahun 2012 pengaruh kegiatan komunikasi informasi edukasi tindakan kesehatan reproduksi remaja sma negeri 17 medan tahun 2013 faktor-faktor mempengaruhi motivasi ibu menyusui pemberian asi(air susu ibu) eksklusif bayi wilayah kerja puskesmas dewantara kabupaten aceh utara analisis manajemen kas pt. wika beton wilayah penjualan i medan peranan gaji insentif kinerja pengadilan negeri medan asuhan keperawatan tn. s prioritas masalah kebutuhan dasar oksigenasi rsup h. adam malik medan studi penerapan metode return on investment pengukuran human capital pabrik gula sei semayang pengaruh waktu kadar vitamin c terdapat sari markisa (passiflora edulis sims) secara volumetri 2,6-diklorofenol indofenol analisa jumlah operator bagian pengepakan dengam metode work sampling biomekanika pt. mutiara mukti farma akuntabilitas transparansi pelayanan pelanggan baru listrik prabayar (studi pt.pln persero cabang medan) analysis of metaphor in psalm section 1 to 119 of bible efektivitas penggunaan arima var memproyeksi permintaan kredit indonesia an analysis of intrinsic elements as portrayed in louisa may alcott’s novel little woman tinjauan yuridis wanprestasi perjanjian sewa menyewa kapal tongkang (studi putusan perdata pengadilan negeri medan no. 503/pdt.g/2009/pn-mdn) pengaruh konflik hubungan kerja sama franchise gerai alfamart kota medan sistem akutansi penerimaan pengeluaran kas pt. inalum (persero) kuala tanjung batu bara simulasi aliran fluida pompa hidram tinggi air jatuh 2,3 m menggunakan perangkat lunak cfd sistem pengendalian kredit mempertahankan likuditas pt. bank sumut kcp gubsu tinjauan hukum pelaksanaan jaminan sosial tenaga kerja atas kecelakaan kerja ptpn-iv ( ptpn – iv unit kebun bah jambi, pematang siantar) tipe pengambilan keputusan membeli tipe technographics konsumen scrambling index dari kelas digraf hamilton dwiwarna n titik ganjil situation types in the novel harry potter and the prisoner of azkaban penggunaan ekstrak pucuk daun jati (tectona grandis l.f) sebagai pewarna rambut nilai kesukaan konsumen teh daun gaharu (aquilaria malaccensis lamk.) berdasarkan letak daun pohon pengaruh faktor internal eksternal kesembuhan penderita tuberkulosis wilayah kerja puskesmas pidie kabupaten pidie analisis pengaruh kualitas pelayanan, promosi lokasi minat berkunjung kebun binatang medan tanggung jawab direksi atas laporan keuangan perusahaan publik pengaruh kepemilikan institusional, struktur aset, ukuran perusahaan profitabilitas kebijakan utang perusahaan makanan minuman terdaftar bursa efek indonesia pengaruh aplikasi probiotik kualitas air pertumbuhan udang litopenaeus vannamei analisis nilai ability to pay willingness to pay pengguna jasa bus rapid transit medan-binjai-deliserdang identifikasi zat pewarna kosmetik beredar pasar aksara medan secara kromatografi kertas identifikasi siklamat madu secara kualitatif reaksi pengendapan analisisperbandingan kadar besi (fe) air baku air reservoir pdam tirtanadi ipa sunggalsecara kolorimetri penentuan bobot jenis kelarutan etanol serta sisa penguapan dari minyak buah pala (myristica fragrans h.) perilaku keluarga pencegahan penanganan diare balita wilayah kerja puskesmas bromo penyediaan karakterisasi kitosan dari kulit udang lipan (squilla mantis) sebagai adsorben menurunkan kadar kolesterol roemah kebaya anne avantie (arsitektur metafora) perbandingan hasil komposisi tangkapan jaring insang permukaan jaring insang dasar perairan desa sei nagalawan serdang bedagai pengaruh faktor psikologis faktor ekonomi minat anggota menggunakan jasa koperasi pegawai negeri keluarga besar kopertis wilayah i medan hubungan pemberian asi penambahan berat badan bayi klinik bersalin bersama medan tahun 2013 faktor-faktor mempengaruhi kesiapan berhubungan seksual pasca melahirkan klinik marelan indri medan tahun 2013 faktor-faktor mempengaruhi penggunaan partograf asuhan persalinan normal oleh bidan praktik mandiri kecamatan tanjung pura kabupaten langkat tahun 2013 faktor-faktor mempengaruhi rendahnya minat ibu memilih implant sebagai alat kontrasepsi kelurahan madras hulu kecamatan medan polonia tahun 2013 pengaruh penyuluhan pengetahuan siswi tentang dismenore primer sma istiqlal deli tua tahun 2013 pengetahuan tentang osteoporosis asupan kalsium wanita pramenopause puskesmas plus perbaungan kabupaten serdang bedagai tahun 2013 hubungan cakupan imunisasi campak angka insiden campak wilayah kerja puskesmas petisah medan tahun 2012 hubungan usia menarche siklus menstruasi kejadian mioma uteri rsup h. adam malik medan tahun 2012 asuhan keperawatan prioritas masalah kebutuhan dasar oksigenasi klien tb paru kelurahan harjosari kecamatan medan amplas analisis nilai korelasi beberapa faktor mempengaruhi wanita indonesia keikutsertaan program keluarga berencana (kb) tahun 2011 pelayanan perpustakaan keliling perpustakaan umum kota binjai sistem pengendalian internal atas biaya operasional fakultas ekonomi universitas sumatera utara faktor-faktor memengaruhi pemasungan penderita skizofrenia kota binjai tahun 2014 implementasi kriptografi algoritma elgamal kombinasi steganografi teknik end of file (eof) keamanan file text file citra pusat terapi rekreasi anak berkebutuhan khusus (arsitektur perilaku) optimasi parameter pemesinan mesin sekrap model l-450 menggunakan algoritma genetika perbedaan tingkat kepuasan pasien jamkesmas pasien umum mutu pelayanan ruang rawat inap kebidanan rsud dr. pirngadi medan tahun 2013 hubungan pengetahuan karakteristik ibu pemberian asi eksklusif bayi usia 6-12 bulan kelurahan persiakan wilayah kerja puskesmas pabatu kota tebing tinggi tahun 2013 analisis rasio camel kinerja perusahaan perbankan terdaftar bursa efek indonesia (bei) periode 2008- 2011 analisis fungsi sosial lembaga agama meningkatkan pendidikan anak keluarga ekonomi lemah (studi deskriptif gereja bethel indonesia medan) asuhan keperawatan gangguan termoregulasi hipertermi an. n ruang ix bedah anak rsud dr. pirngadi kota medan asuhan keperawatan ny. m prioritas masalah kebutuhan dasar aktivitas mobilisasi kelurahan harjosari i gambaran morfologi sagital skeletal wajah berdasarkan analisis steiner jefferson pengaruh debt to equity ratio, ukuran perusahaan momentum return saham perusahaan manufaktur terdaftar bursa efek indonesia (bei) analisis reaksi pasar penerapan international financial reporting standard (ifrs) perusahaan manufaktur terdaftar bursa efek indonesia bursa malaysia 2012 pengenaan pajak hotel dinas pendapatan daerah kabupaten tapanuli tengah employee relations kepuasan komunikasi pegawai (studi korelasional tentang employee relations kepuasan komunikasi pegawai dinas kebudayaan pariwisata provivinsi sumatera utara) sistem administrasi pph pasal 21 fakultas ekonomi universitas sumatera utara pengujian angka kapang/khamir roti pasaran pengaruh penerapan relationship marketing customer satisfaction tabungan simpedes pt bank rakyat indonesia (bri), tbk unit brigjen katamso, medan analisis zat pewarna kepah asin (polymesoda erosa) dijual pasar sentral pasar sukaramai kota medan tahun 2013 analisis jumlah penduduk pendapatan perkapita pertumbuhan ekonomi kota medan analisis faktor-faktor mempengaruhi keterlambatan proyek konstruksi ( proyek pembangunan jembatan rel kereta api kuala tanjung – sumatera utara) hubungan motivasi intrinsik ekstrinsik psikologi ibu menopause hubungan pengetahuan sikap ibu pemberian stimulasi pertumbuhan perkembangan neonatus asuhan keperawatan ny.m gangguan mobilitas fisik rsup haji adam malik kota medan asuhan keperawatan ny. b prioritas masalah kebutuhan dasar nyaman (nyeri) rsup. h. adam malik medan hubungan preferensi makanan asrama konsumsi pangan status gizi mahasiswa/i politeknik kesehatan medan tahun 2014 identifikasi penyebab pembengkakan biaya (cost overrun) proyek perumahan hubungan gaya hidup status kesehatan lanjut usia (lansia) wilayah kerja puskesmas pasar merah medan tahun 2014 identifikasi biaya pasokan besi beton metode least total cost (ltc) pendekatan period order quantity (poq) ( proyek pembangunan jembatan rel kereta api kuala tanjung – sumatera utara) trauma kimia post enucleation socket syndrom perencanaan kebutuhan distribusi menggunakan distribution requirement planning (drp) pt. tirta sibayakindo ectropion peningkatan efektifitas mesin blowing berdasarkan evaluasi overall equipment effectiveness fmea industri manufaktur plastik penentuan rute terpendek metode floyd warshall peta digital universitas sumatera utara perancangan sistem informasi debit air berbasis arduino uno pengaruh rasio keuangan penerimaan opini audit going concern perusahaan telekomunikasi terdaftar bursa efek indonesia analisa lentur eksperimental penambahan mutu beton daerah tekan balok beton bertulang analisis hukum mengenai penguasaan penggunaan senjata api tanpa hak oleh warga sipil ( putusan nomor 261/pid.b/2013/ tanggungjawab underwriter (penjamin emisi efek) surat hutang tidak dibayar saat jatuh tempo ( atas surat hutang diterbitkan oleh indah kiat international finance b. v.) gambaran optik lensa kontak secara klinis sistem informasi geografis penentuan lokasi hydrant berbasis web metode simple additive weighting wilayah kota medan lensa intra okuler karakteristik ibu melahirkan bayi berat badan lahir rendah (bblr) rs santa elisabeth medan tahun 2009-2013 lensa kontak perubahan dimensi hasil cetakan polivinil siloksan setelah direndam larutan daun mimba 15% waktu berbeda pengaruh kepribadian kepuasan kerja pegawai dinas kebudayaan pariwisata kabupaten karo pengaruh pemberian ekstrak etanol kulit manggis (garcinia mangostana l) perubahan kadar enzim ast, alt serta perubahan makroskopik histopatologi hati mencit jantan (mus musculus l) strain ddw setelah diberi monosodium glutamate (msg) dibandingkan vitamin e pengaruh motivasi kinerja pegawai (studi badan perpustakaan, arsip dokumentasi provinsi sumatera utara) tata cara pelaporan pemyetoran pajak penghasilan pasal 25 orang pribadi kantor pelayanan pajak pratama medan belawan fungsi komunikasi budaya organisasi kepuasan kerja karyawan perum bulog divre sumut pengaruh kualitas layanan kepuasan konsumen pt. mata secure indonesia peran fungsi sekretaris perum bulog divre sumut gatot subroto medan hubungan pengetahuan tentang sadari kanker payudara pemeriksaan payudara sendiri (sadari) siswi madrasah aliyah swasta persatuan amal bakti 2 helvetia kabupaten deli serdang tahun 2014 perilaku ibu pemanfaatan pelayanan kesehatan gigi mulut anak usia sekolah sdn 054936 wonorejo kecamatan sei lepan kabupaten langkat tahun 2013 word of mouth communication keputusan penggunaan jasa” (studi korelasional kursus bahasa inggris yayasan pengembangan persahabatan indonesia-amerika medan implementasi peraturan wali kota no 35 tahun 2011 tentang pajak hiburan kota medan perancangan alat ukur tingkat kerusakan minyak goreng menggunakan prinsip penyerapan medan listrik dikarakterisasi bilangan peroksida fungsi kewenangan otoritas jasa keuangan kegiatan jasa keuangan sektor perbankan (studi otoritas jasa keuangan) hubungan paparan asap rokok orang tua lingkungan rumah kejadian leukemia anak rsup h adam malik medan pertanggungjawaban yuridis tentang keabsahan akta perikatan hak tanggungan sebagai jaminan kredit pt. bank rakyat indonesia (studi pt. bank rakyat indonesia cabang blang pidie) analisa nilai tambah (value added) pembuatan sparepart pt. apindowaja ampuh persada peranan kedudukan sekretaris badan pelayanan perijinanan terpadu kota medan analisis break event point kafe baga 35h medan johor anallsis pengaruh jumlah penduduk,jumlah penghasilan biaya promosi tingkat penjualan produk asuransi jiwa bersama bumiputera 1912 kantor wilayah medan gambaran pewarnaan imunohistokimia s100 meningioma rsup. h. adam malik medan sistem informasi e-learning bahasa inggris tingkat pendidikan sekolah menengah pertama sistem informasi penjualan rumah secara online menggunakan php mysql sistem informasi pemesanan jasa percetakan berbasis web menggunakan php mysql analisis strategi bersaing salon michi krakatau melalui analisis swot sistem informasi berbasis web sekolah sma tamansiswa binjai peran dewan perwakilan rakyat daerah kabupaten padang lawas penyelesaian sengketa lahan ( sengketa lahan antara pt sumatera riang lestari pt sumatera sylva lestari masyarakat adat kecamatan aek nabara barumun) pengaruh produk, lokasi, kualitas pelayanan keputusan pembelian café roemah kopi dolok tebing tinggi orientasi memancing masyarakat perkotaan (studi etnografi mengenai memancing dua kolam pancing kota medan) hak-hak reproduksi” (studi deskriptif mengenai hak-hak reproduksi lembaga pemasyarakatan wanita klas ii a tanjung gusta medan) analisis ketimpangan distribusi pendapatan tingkat kesejahteraan kecamatan medan deli analisis ketimpangan distribusi pendapatan kesejahteraan masyarakat kota medan ( kec. medan labuhan) optimal power flow jaringan sumatera bagian utara 150 kv perbandingan efek volume intravaskular preloading cairan hipertonis nacl 3% nacl 0,9% spinal anestesi perancangan alat pengisi baterai lead acid berbasis mikrokontroler atmega 8535 analisis kinerja supplier bahan baku menggunakan integrasi supply chain operations refrence analytic hierarchy process pt. asia raya foundry uji jarak silinder pengepress kualitas emping melinjo alat pencetak keripik biji-bijian analisis kelayakan usaha tambak udang ( desa sei meran, kec. pangkalan susu, kab. langkat) hubungan antara fase siklus haid wanita normal hasil pemeriksaan audiologi strategi peningkatan produksi penangkaran benih padi bersertifikasi ( desa tumpatan nibung kec. batang kuis kab. deli serdang) peranan penyedia pelayanan kesehatan swasta pencapaian eliminasi malaria kabupaten aceh besar laju dekomposisi analisis unsur hara c, n p serasah daun rhizophora mucronata lokasi stasiun berbeda pantai serambi deli kecamatan pantai labu kabupaten deli serdang akibat hukum restrukturisasi perseroan terbatas melalui pemisahan usaha peranan tanggung jawab hukum pt. pelindo i kapal bersandar (studi pt. pelindo i ) kajian yuridis kedudukan advokat asing indonesia keberadaan masyarakat ekonomi asean tindak pidana kekerasan proses belajar mengajar ditinjau dari perspektif hukum pidana perlindungan guru uu no 14 tahun 2005 (analisis juridis putusan pt medan no 274/pid/2012/pt-mdn putusan ma no 2024 k/pid.sus/2009) hubungan pengetahuan sikap pasangan usia subur tentang pemeriksaan pap smear kelurahan bane, kecamatan siantar utara system pembersih monitoring asap rokok menggunakan tegangan tinggi tampilan pc posisi indonesia masyarakat ekonomi asean 2015 ( studi analisis realisme hubungan internasional ) pengaruh lama perendaman basis gigitiruan resin akrilik polimerisasi panas ekstrak buah lerak 0,01% stabilitas warna pengaruh pemikiran hasan al banna tentang agama politik idiologi partai keadilan sejahtera masyarakat batak toba desa serdang kecamatan beringin kabupaten deli serdang (1954-1990) peranan australia proses lepasnya timor timur dari nkri tahun 1999 pengaruh kepuasan kerja motivasi pegawai peluang promosi badan penelitian pengembangan kota medan pemberitaan kekerasan wartawan indonesia sikap mahasiswa (studi korelasional tentang hubungan antara pemberitaan kekerasan wartawan indonesia metro tv sikap mahasiswa stik-p) tingkat kepuasan ibu hamil pelayanan program jaminan persalinan klinik wipa tahun 2013 analisis mineral kalsium, kalium, magnesium beberapa jenis air minum isi ulang kota medan gangguan mobilisasi pasca seksio sesaria asuhan keperawatan tn. b prioritas masalah kebutuhan dasar eliminasi urine rsu. haji adam malik asuhan keperawatan ny.n prioritas masalah halusinasi pendengaran rsjd provsu medan sistem informasi akademik sma muhammadiyah 10 rantauprapat prosedur penyusunan anggaran fakultas ekonomi universitas sumatera utara opini mahasiswa keberadaan bus lintas usu (studi deskriptif mengenai opini mahasiswa fisip usu keberadaan bus lintas usu ) perilaku gizi primigravida muda wilayah kerja puskesmas tanah tinggi kota binjai tahun 2012 perbandingan teknik steganografi metode first-of-file, end-of-file kombinasi first-of-file end-of-file file bitmap hubungan antara job characteristics employee engagement perusahaan telekomunikasi pengendalian internal gaji upah badan pelayanan perijinan terpadu kota medan sistem akutansi penerimaan pengeluaran kas pt. inalum (persero) kuala tanjung batu bara sistem pengawasan internal aset tetap pt. perkebunan nusantara iv medan peranan komputer sebagai pengolah data akuntansi dinas pendapatan daerah kota medan fungsi anggaran sebagai alat perencanaan pengawasan dinas pendapatan daerah kota medan sistem pengendalian kredit mempertahankan likuditas pt. bank sumut kcp gubsu analisis pengaruh pembiayaan sektor perikanan kesejateraan nelayan belawan pendugaan cadangan karbon tanaman karet (hevea brasiliensis muell. arg.) perkebunan rakyat desa tarean, kecamatan silindak, kabupaten serdang bedagai pengaruh harga kualitas pelayanan kepuasan pelanggan ( toko asan sepatu sisingamangaraja-simpang limun, medan) pelabuhan air bangis sumatera barat abad xix hingga awal abad xx pengaruh karakteristik individu, gaya kepemimpinan lingkungan kerja etos kerja karyawan pt. bank mandiri (persero) tbk, unit performance and budgeting kantor wilayah i medan pengaruh diferensiasi keputusan penyewaan usaha keluarga karls kost homestay batam analisis penggunaan transaksi non-tunai kalangan pengusaha kota medan respons pertumbuhan produksi bawang merah (allium ascalonicum l.) jenis mulsa pemberian urine sapi pengaruh program pertanian berkelanjutan ekonomi masyarakat oleh serikat petani indonesia kelurahan pangkalan mansyur medan johor penerapan lean manufacturing mereduksi waste proses vulkanisir ban pt. putra sejahtera mandiri rancang bangun alat pengiris kentang spiral profil pemenuhan standar praktik kefarmasian beberapa apotek kota medan optimasi validasi metode kromatografi cair kinerja tinggi penetapan kadar natrium sakarin sirup beredar kota medan isolasi identifikasi senyawa flavonoida dari ekstrak etanol kulit batang ingul (toona sinensis (juss.) m.roem) karakterisasi simplisia isolasi minyak atsiri dari kulit buah jeruk jingga (citrus x jambhiri lush) segar kering serta analisis komponennya secara gc-ms identifikasi uji kapasitas antioksidan herba seledri (apium graveolens l.) secara spektrofotometri sinar tampak pemeriksaan kandungan mineral kalsium, kalium natrium apel hijau (pyrus malus, l.) secara spektrofotometri serapan atom teknik pemecahan kunci algoritma rivest shamir adleman (rsa) metode kraitchik aspek hukum perlindungan anak didik pemasyarakatan tindak pidana penyalahgunaan narkotika ( lemabaga pemasyarakatan klas ii a tanjung gusta medan) implementasi perbandingan optimum notch filter band reject filter mereduksi periodic noise citra digital perbandingan giro wadi’ah giro mudharabah perbankan syariah (studi pt. bank muamalat indonesia tbk, cabang tanjungbalai) analisis kandungan inulin pisang barangan (musa acuminata colla), pisang awak (musa paradisiaca var awak) pisang kepok (musa acuminata balbisiana colla) tanggung jawab perusahaan asuransi jasa raharja menyetujui klaim kecelakaan lalu lintas jalan raya (studi pt. jasa raharja medan) pengaruh penggunaan tempe sebagai bahan dasar pembuatan isian burger komposisi zat gizi daya terimanya analisis kebijakan marketing mix upaya meningkatkan volume penjualan produk jasa asuransi (studi ajb bumiputera cabang kisaran) persepsi pasien umum tentang perawat pelaksana ruang rawat inap rumah sakit umum daerah kabupaten gayo lues tahun 2014 pertanggungjawaban pidana korporasi pelaku tindak pidana perusakan pencemaran lingkungan (studi putusan ma ri no. 755k/pid.sus/2007) pengaruh produk pinjaman promosi keputusan melakukan pinjaman sumut kantor cabang pembantu usu medan faktor-faktor mempengaruhi kepuasan pelanggan (studipada boss coffee chocolate jl.dr.mansyur medan) dampak waralaba toko modern pasar tradisional (studi pasar tradisional “pajak sore” padang bulan medan) mahasiswa twitter peranan badan penanggulangan bencana (bpbd) penanggulangan bencana banjir kota medan implementasi proses kebijakan alokasi dana desa/kelurahan kabupaten tapanuli utara tahun anggaran 2013 efektivitas pelaksanaan program simpan pinjam perempuan program nasional pemberdayaan masyarakat mandiri perdesaan kecamatan bangun purba kabupaten deli serdang akibat hukum pemisahan perseroan kreditur menurut undang-undang nomor 40 tahun 2007 tentang perseroan terbatas konsekuensi kehadiran pt. sorikmas mining polarisasi sosial ekonomi masyarakat desa tarutung panjang, kec. naga juang, kab. mandailing natal keanekaragaman burung air kawasan pantai labu kabupaten deli serdang kesepakatan investasi langsung rangka asean economic community (aec) 2015 menurut perspektif hukum perjanjian internasional hukum nasional komposisi komunitas collembola permukaan tanah hutan sekunder agroforestri kopi desa kutagugung kecamatan namanteran kabupaten karo united nations convention against corruption (uncac) 2003 kaitannya pembentukan hukum nasional bidang pemberantasan tindak pidana korupsi isolasi senyawa flavonoida dari daun tumbuhan sambang darah (excoecaria cochinchinensis lour.) pelanggaran hak atas kekebalan diplomatik pejabat missi diplomatik oleh negara penerima analisis nuansa makna kata mou ato kalimat bahasa jepang analisis psikologis tokoh utama komik “yamato nadeshiko shichi henge” karya tomoko hayakawa analisis teknik permainan penggarapan tiga komposisi gondang instrumen garantung dimainkan oleh tiga pargarantung tindak tutur asertif direktif novel perahu kertas karya dewi lestari perbedaan kekuatan kompresi gips tipe iii pabrikan daur ulang pembuatan model kerja kajian gravity thickener sebagai alat pemisah lumpur keluaran fermentor pembuatan biogas dari fermentasi limbah cair pabrik kelapa sawit skala pilot. pengaruh equity multiplier, firm size, debt to equity ratio (der), net profit margin (npm) rasio profitabilitas (roe) perusahaan perbankan terdaftar bursa efek indonesia (bei) pengaruh pertumbuhan perusahaan, struktur modal leverage profitabilitas perusahaan property real estate terdaftar bursa efek indonesia analisis pengaruh lingkungan kerja kinerja karyawan keude kupie ulee kareng medan pengaruh harga kualitas produk keputusan pembelian produk oriflame mahasiswa program studi manajemen fakultas ekonomi usu analisis faktor-faktor mempengaruhi keputusan masyarakat kecamatan medan helvetia memilih lembaga keuangan sebagai sumber pendanaan redevelopment taman budaya sumatera utara louis vuitton tower medan convention & exhibition center (arsitektur ekspresionisme) sumatera air asia training center (arsitektur metafora) profil kadar zinc plasma penderita ulkus diabetikum ulkus dekubitus rsup haji adam malik medan analisis variasi karakteristik respon reflectivity side lobe strength serat optik filter fiber bragg grating status perjanjian internasional kaitannya kerjasama sister city (kota bersaudara) dibuat oleh pemerintah kota medan pemerintah kota ichikawa gambaran pemberian cairan intravena tindakan resusitasi cairan kasus trauma akibat kecelakaan lalu lintas igd rsup h.adam malik bulan oktober 2014 kedudukan swiss sebagai negara netral perspektif hukum humaniter internasional the darkness in kill me if you can by james patterson and marshall karp pembuatan selulosa hidroksi metil ester lemak sawit dari tandan kosong kelapa sawit (tkks) asam lemak sawit distilat (alsd) pengadaan barang menyebabkan kerugian keuangan negara ditinjau dari undang-undang tindak pidana korupsi ( studi putusan pengadilan tinggi medan nomor 19/pid.sus.k/2014/pt.mdn) pengaruh pendapatan asli daerah dana alokasi khusus dana alokasi umun belanja modal pemerintahan kabupaten/kota provinsisumatera barat pengaruh deskripsi kerja disiplin kerja kinerja karyawan pt. asuransi jasa indonesia (persero) medan hubungan nilai curb-65 mortalitas pasien pneumonia komunitas rsup h. adam malik medan karakteristik penderita retinoblastoma rsup haji adam malik medan periode januari 2011 – desember 2013 gambaran bakteri terdapat toilet umum dua pusat perbelanjaan modern kota medan pola kepekaan antibiotik karakteristik sepsis neonatorum unit perinatologi rsup h. adam malik medan tahun 2012-2013 prevalensi hipertensi pasien penyakit ginjal kronis rumah sakit umum pusat haji adam malik medan tahun 2013 pengaruh pengetahuan pria pasangan usia subur tentang alat kontrasepsi kondom dukungan sosial partisipasi pria keluarga berencana kecamatan hutaimbaru kota padangsidimpuan studi potensi interaksi obat pasien diabetes melitus tipe 2 rawat jalan rumah sakit umum daerah dr. zainoel abidin (rsudza) banda aceh gambaran pewarnaan imunohistokimia p53 meningioma rsup-ham pengaruh kebutuhan aktualisasi diri, harga diri, kebutuhan sosial prestasi kerja pt bank sumut,kantor cabang utama medan analisis spasial pendugaan tingkat bahaya erosi das lepan provinsi sumatera utara analisis pengaruh pengumuman bond rating harga saham volume perdagangan ( perusahaan terdaftar bursa efek indonesia tahun 2008 – 2011) pengaruh terpaan tayangan korean wave (demam korea) gaya hidup mahasiswi fakultas ilmu sosial ilmu politik universitas sumatera utara tradisi rantangan sebagai modal sosial kalangan suku jawa ( desa urung pane, kabupaten asahan) strategi petani miskin mempertahankan usaha tani ( studi deskriptif desa silima kuta, kec. sttu julu, kab. pakpak bharat ) faktor – faktor mempengaruhi alih fungsi lahan persawahan menjadi perkebunan kelapa sawit rakyat kecamatan pegajahan kabupaten serdang bedagai pertumbuhan produksi kedelai (glycine max l. merill) melalui aplikasi asam askorbat inokulasi fungi mikoriza arbuskular tanah salin kajian organologis saga-saga batak toba buatan bapak guntur sitohang desa turpuk limbong kecamatan harian boho, kabupaten samosir penggunaan sari daun rosella (hibiscus sabdariffa linn.) sediaan krim pelembab pengaruh perilaku kaum ibu kepuasan berbelanja hypermarket palladium medan hubungan koloni pseudomonas aeruginosa persentase take split thickness skin graft (stsg) pasien luka bakar rsup h. adam malik medan kajian organologis saluang darek minangkabau buatan bapak aziz mandri chaniago kelurahan mabar, kecamatan medan deli, medan psikologi tokoh utama novel 38 tahun mencari ibu karya alya zulfa analisis pengaruh jatuh tegangan torsi putaran motor arus searah penguatan shunt (aplikasi laboratorium konversi energi listrik ft-usu) analisis kinerja jaringan switching batcher- banyan analisis pengaruh karakteristik perusahaan pengungkapan tanggung jawab sosial perusahaan pertambangan terdaftar bursa efek indonesia pengaruh campuran bahan bakar premium, hidrogen etanol 99% performansi emisi gas buang mesin genset otto pengaruh audit quality, audit tenure, audit report lag, profitabilitas opini audit going concern perusahaan manufaktur terdaftar bursa efek indonesia periode 2010-2013 analisis swot sebagai landasan penetapan strategi pemasaran pt. socfindo medan sikap perilaku petani kinerja perkumpulan petani pemakai air (p3a) kelurahan tualang (kasus p3a citra mandiri kelurahan tualang, kecamatan perbaungan, kabupaten serdang bedagai) analisis pengembangan ekonomi kreatif kabupaten deli serdang ( kerajinan tangan) penerapan total productive maintenance (tpm) failure mode and effect analysis (fmea) pt. indonesia asahan aluminium (inalum) pengaruh waktu perendaman persentase serat pilus sifat mekanis bahan komposit matriks polymer pengakuan kedudukan anak luar perkawinan kajian hukum positif rancang bangun alat pengaduk sabun cair bahan baku minyak jelantah kajian distribusi air tanah inceptisol bertanaman kedelai jumlah pemberian air berbeda uji alat pengaduk sabun cair berbahan baku limbah minyak jelantah ekstrak serai wangi (cymbopogon nardus l.), pandan (pandanus amaryllifolius roxb.), jeruk nipis (citrus aurantifolia) strategi pemasaran roti kacang kota tebing tinggi analisis kelayakan usaha pembuatan batu bata tandan kosong kelapa sawit sebagai bahan bakar ( desa jentera barat, kecamatan wampu, kabupaten langkat) analisis keputusan konsumen membeli buah pasar modern kota medan ( swalayan/supermarket kecamatan medan sunggal) pengaruh faktor sosial ekonomi pendapatan pedagang hasil laut ( desa pantai percut, kecamatan percut sei tuan, kabupaten deli serdang) analisis finansial kepiting bakau (scylla serrata) ( desa pantai gading, kecamatan secanggang, kabupaten langkat) analisis faktor-faktor mempengaruhi alih fungsi lahan padi sawah pengaruhnya pendapatan petani ( desa suka maju kecamatan tanjung pura kabupaten langkat) asuhan keperawatan ny. n prioritas masalah kebutuhan dasar rasa nyaman nyeri akut lingkungan ix kelurahan harjosari ii kecamatan medan amplas asuhan keperawatan ny.n prioritas masalah nyeri kronik lingkungan ix kelurahan harjosari ii kecamatan medan amplas asuhan keperawatan prioritas masalah kebutuhan dasar konsep diri asuhan keperawatan ny. r prioritas masalah kebutuhan dasar kebutuhan dasar keselamatan rasa aman rsj prof. dr. m. ildrem provinsi sumatera utara medan sistem perancangan alat ukur viskositas menggunakan sensor ldr berbasis mikrokontroler atmega8535 uji cemaran mikroba serbuk obat tradisional uji mikrobiologi udara ruang produksi line 3 & 4 menggunakan alat mas 100 nt pt coca-cola bottling indonesia unit medan pemeriksaan senyawa boraks bakso secara kualitatif pemeriksaan total kolifom air baku sunggal metode most probable number (mpn) penetapan kadar bahan baku betametason valerat metode hplc (high performance liquid chromatography) pemeriksaan total koliform air reservoir metode most probable number (mpn) pengaruh pengungkapan corporate social responsibility (csr) kinerja keuangan perusahaan struktur kepemilikan sebagai variable moderating studi empiris perusahaan terdaftar bursa efek indonesia analisis perbandingan kelayakan usahatani cabai merah (capsiccum annum l.) cabai rawit (capsiccum frutescens l.) ( desa hinalang, kecamatan purba, kabupaten simalungun) analisis efisiensi penggunaan faktor produksi usahatani cabai merah (capsicum annum l.) ( desa sukanalu, kecamatan barusjahe, kabupaten karo) faktor-faktor mempengaruhi ketersediaan beras jagung provinsi sumatera utara analisis yuridis tanggung jawab mantan ayah anak apabila terjadi perceraian (studi putusan nomor 132/pdt.g/2011/pn.mdn) analisis nilai tambah pengolahan ubi kayu menjadi tape ubi ( kelurahan baru ladang bambu, kecamatan medan tuntungan, kota medan ) perbandingan kadar sitokin interleukin-17 serum antara penderita bukan penderita psoriasis vulgaris analisis tataniaga kepiting desa pantai gading kecamatan secanggang kabupaten langkat dampak erupsi gunung sinabung sosial ekonomi petani kopi desa guru kinayan, kecamatan payung, kabupaten karo hubungan panjang bobot reproduksi ikan kembung lelaki (rastrelliger kanagurta) perairan selat malaka tanjung beringin serdang bedagai sumatera utara analisis nilai ekonomi usaha tambak nila, bandeng udang windu kesejahteraan petambak kawasan mangrove kelurahan nelayan indah, medan labuhan pengaruh modifikasi pola hidup medis atau tanpa metformin kadar asymmetrical dimethyl arginine (adma) penderita obesitas faktor- faktor mempengaruhi peringkat obligasi perusahaan terdaftar pt. pefindo pengujian perilaku predator anti-predator ikan lele dumbo (clarias gariepinus burchell, 1822) transgenik f3 pertumbuhan laju eksploitasi ikan tongkol komo (euthynnus affinis cantor 1849) didaratkan kud gabion pelabuhan perikanan samudera belawan sumatera utara pengaruh corporate governance intellectual capital bank umum swasta nasional terdaftar bursa efek indonesia kualitas air sungai belawan kecamatan pancur batu kabupaten deli serdang provinsi sumatera utara analisis tingkat produktivitas tenaga kerja kota binjai perancangan implementasi pengendali pintu pagar otomatis berbasis arduino transmisi transgen (phgh) performa pertumbuhan ikan lele (c. gariepinus) transgenik f3 balai penelitian pemuliaan ikan sukamandi subang, jawa barat rancang bangun turbin vortex casing berpenampang spiral lingkaran sudu berdiameter 32cm tinggi 90cm 2 variasi lubang outlet 3 variasi jarak antara sudu ke outlet implementasi peraturan daerah kota medan no.11 tahun 2011 tentang penyelenggaraan reklame ditinjau dari perspektif hukum administrasi negara ( dinas pendapatan kota medan) pertumbuhan laju eksploitasi ikan tamban (sardinella albella valenciennes, 1847) perairan selat malaka tanjung beringin serdang bedagai sumatera utara kajian yuridis tentang kewenangan tembak tempat oleh aparat kepolisian tersangka dikaitkan asas praduga tidak bersalah pertanggung jawaban hukum bagi pegawai negeri sipil (pns) penyalahgunaan wewenang ditinjau dari prespektif hukum administrasi negara pertanggungjawaban nasabah bank pembayaran kartu kredit over limit (studi bank danamon cabang sutomo medan) upaya hukum pemilik barang pelaku usaha ekspedisi muatan kapal laut atas kerugian dialami akibat tenggelamnya kapal pengirim barang ditinjau dari undang-undang nomor 8 tahun 1999 tentang perlindungan konsumen analisis hukum mengenai pembatalan perkawinan (putusan no.435/pdt.g/2013/pa.mdn) penerapan unsur persamaan pokoknya penentuan sengketa merek ( putusan mahkamah agung nomor 194k/pdt.sus/2011) analisis yuridis perjanjian pekerjaan konstruksi pembangunan/rehabilitasi depo pemasaran hasil perikanan antara dinas pertanian, perikanan kehutanan kota padangsidimpuan cv. via anugrah esensi pemaknaan kata “demokratis” pemilihan kepala daerah indoneisa pasca perubahan uud nri 1945 (studi konstitusional pasal 18 ayat 4 uud nri 1945) kedudukan keterangan saksi penyidikan sebagai alat bukti sah persidangan (studi putusan pengadilan negeri stabat no.752/ pid.b/ 2012/ pn.stb) tanggung jawab penerbit uang elektronik penyalahgunaan uang elektronik merugikan pengguna uang elektronik angka kejadian mukositis oral anak menderita leukemia limfoblastik akut menjalani kemoterapi rsup haji adam malik medan akibat hukum privatisasi bumn kewenangan negara sistem informasi manajemen menigkatkan efisiensi kerja bagian kepegawaian fakultas ekonomi universitas sumatera utara pengukuran kapasitas antioksidan rimpang temulawak (curcuma xanthorrhiza roxb.) secara spektrofotometri sinar tampak a description of gender found in john mellington’s play riders to the sea the interpretation of metaphor found in 20 songs of taylor swift the abuse of toward christen in s.j. waston’s novel before i go to sleep the description of dictatorship in george orwell’s novel “nineteen eighty four (1984) the description of gerund used in veronica roth’s novel “four” analysis of metaphorin in psalm section 1 to 119 of bible an analysis of intrinsic elements as portrayed in louisa may alcott’s novel little woman kinerja pustakawan pengembangan perpustakaan umum kota medan peranan standar operasional prosedur pengelolaan dokumen/ arsip pt bank sumut kantor pusat medan peranan kualitas pelayanan kepuasan nasabah pt bank sumut cabang syariah medan respons pertumbuhan produksi bawang merah (allium ascalonicum l.) pemberian pupuk kandang ayam urine sapi perlindungan hukum saksi pelapor tindak pidana narkotika (studi polsek deli tua) tinjauan yuridis tentang status yayasan didirikan sebelum berlakunya uu no. 16 tahun 2001 jo uu no. 28 tahun 2004 tentang yayasan ( yayasan pendidikan harapan medan) analisis yuridis tndak pidana narkotika dilakukan oleh anak upaya penyelesaian kredit macet kredit usaha rakyat (kur) bank (studi bank btn cabang pemuda medan) pemberian bantuan hukum secara cuma-cuma kepada anak golongan masyarakat kurang mampu berkonflik hukum peradilan pidana anak (studi lembaga bantuan hukum medan) tinjauan yuridis tentang perlindungan konsumen oleh pt pos indonesia berkaitan pengiriman barang menurut undang-undang no 8 tahun 1999 tentang perlindungan konsumen ( pt pos indonesia cabang kabanjahe) penyelesaian kredit macet oleh bank pemberian kredit jaminan perorangan (studi pt. bank mandiri (persero) tbk unit credit operations regional i medan sensitivitas indera pengecapan rasa manis, asam, asin, pahit umami penderita diabetes mellitus tipe 2 analisis pengaruh intellectual capital kinerja perusahaan sektor properti bursa efek indonesia pengaruh konsentrasi karagenan mutu selai kelapa muda lembaran selama penyimpanan pengaruh perbandingan bubur buah pepaya belimbing konsentrasi karagenan mutu selai lembaran tanggung jawab pt. garuda indonesia pengirim kehilangan barang (studi kargo pt. garuda indonesia bandar udara kualanamu) analisis faktor mempengaruhi peningkatan jumlah nasabah bizz pt. bank central asia nasabah bank bca capem surabaya - medan analisis faktor-faktor mempengaruhi tingkat kemiskinan kecamatan gebang kabupaten langkat menentukan faktor dominan menyebabkan penyakit sosial masyarakat metode analisis diskriminan analisis pengaruh gaji, interaksi sosial, gaya kepemimpinan, fasilitas motivasi kerja prestasi kerja karyawan ptpn iii kebun bandar betsy faktor-faktor mempengaruhi kemiskinan provinsi aceh menggunakan analisis diskriminan pengaruh faktor lingkungan konsentrasi belajar mahasiswa menggunakan analisis jalur ( mahasiswa fmipa usu angkatan 2013) pengaruh pelaksanaan self assesment system tingkat kepatuhan wajib pajak menyampaikan surat pemberitahuan tahunan orang pribadi kantor pelayanan pajak pratama lubuk pakam pelaksanaan penyuluhan sosialisasi upaya meningkatkan kepatuhan wajib pajak memenuhi kewajiban perpajakan kantor pelayanan pajak pratama medan belawan pelaksaan prosedur penyitaan barang wajib pajak akibat utang pajak kantor pelayanan pajak lubuk pakam asuhan keperawatan ny.n prioritas masalah kebutuhan dasar rasa nyaman nyeri kelurahan harjo sari ii kec. medan amplas simulasi uji kebisingan (noise) pompa sentrifugal skala rumah tangga menggunakan perangkat lunak fem pengujian eksperimental kebisingan (noise) pompa sentrifugal dap skala rumah tangga menggunakan sound level meter faktor-faktor mempengaruhi keputusan petani menggunakan credit union (cu) sebagai lembaga pembiayaan usaha tani ( cu sondang nauli kab.karo- simalungun) analisis komparasi efisiensi penggunaan pakan pabrik pakan buatan biaya produksi ikan patin (pangasius pangasius) (kasus desa kuok, kecamatan kuok, kabupaten kampar, provinsi riau) pengujian kandungan kadmium, tembaga timbal pisang goreng pinggir jalan secara spektrofotometri serapan atom analisis faktor-faktor mempengaruhi minat mahasiswa berwirausaha ( mahasiswa fmipa usu) analisis faktor mempengaruhi tingkat kriminalitas kotamadya binjai tahun 2011-2014 faktor-faktor mempengaruhi ranking siswa menggunakan analisis diskriminan ( sma negeri 12 medan) rancangan alat ukur suhu ekstrim secara telemetri berbasis atmega8 tampilan pc penggunaan teknik composing pemeriksaan whole spine potongan sagital t2 weighted mri 1.5t analisis pengaruh slice thickness citra ct scan kasus sinus paranasal pengguna gigi palsu implan analisis pengaruh ukuran perusahaan, leveragedan profitabilitas nilai perusahaan kebijakan dividen sebagai variabel moderasi (pada perusahaan manufaktur sektor industri barang konsumsi terdaftar bursa efek indonesia) pengaruh financial distress, pergantian mnajemen, opini audit, ukuran kap, audittenure, fee audit auditor switching perusahaan manufaktur terdaftar bursa efek indonesia pengaruh mekanisme corporate governance, kualitas kantor akuntan publik, audit tenure integritas laporan keuangan padaperusahaan manufaktur terdaftar bursa efek indonesia sistem pengendalian internal aset tetap pt. usaha pengangkutan kurnia medan pengendalian internal gaji upah dinas pendidikan kabupaten karo analisis perbandingan kadar kalium daun kumis kucing, daun pegagan daun salam secara spektrofotometri serapan atom isolasi identifikasi steroid/triterpenoid sponge (xestospongia sp de laubenfels)dari pantai lhoknga aceh besar analisis hasil kompresi data teks algoritma elias gamma code, elias delta code levenstein code uji klinis pendahuluan pengaruh pemberian kapsul kombinasi ekstrak herba sambiloto (andrographis paniculata (burm.f.) nees) daun salam (syzygium polyanthum (wight) walp.) profil lipid pasien dislipidemia analisis faktor memengaruhi perilaku seks pranikah remaja putri kecamatan kualuh leidong kabupaten labuhan batu utara tahun 2013 peran orang tua remaja berperilaku seks pra-nikah remaja dusun viii desa bandar klippa kecamatan percut sei tuan kabupaten deli serdang tahun 2015 analisis kesejahteraan masyarakat nelayan kota sibolga analisis kadar protein total non protein nitrogen air daging buah kelapa (cocos nucifera l.) metode kjeldahl formulasi orally disintegrating tablet (odt) domperidon menggunakan superdisintegran krospovidon primogel metode sublimasi program acara televisi persepsi anak (studi deskriptif kuantitatif mengenai persepsi siswa smp st. yoseph pemuda medan program acara junior masterchef) efektivitas komunikasi antarpribadi motivasi belajar siswa (studi korelasional pengaruh pengaruh efektivitas komunikasi antarpribadi bimbingan konseling motivasi belajar siswa/i sma yayasan perguruan sutomo i medan) analisis spasial iklim kejadian tb kabupaten serdang bedagai tahun 2009-2012 pengaruh pemberian tunjangan sertifikasi tingkat kinerja guru (studi sma negeri i tigapanah, kabupaten karo) faktor risiko gagal ginjal kronis pasien menjalani terapi haemodialisa rumah sakit umum raden mattaher provinsi jambi tahun 2013 faktor-faktor menyebabkan anak menjadi pekerja seks komersial kota medan pemekatan karoten cara solvolytic micellizationdari minyak hasil ekstraksi limbah serat pengepresan buah kelapa sawit perbandingan hasil peramalan penjualan tas planet ocean pt. delimas lestari kencana metode pemulusan eksponensial ganda holt metode holt-winters analisis sifat fisis, magnet, mikrostruktur darivariasi temperatur sintering barium heksaferit denganaditif sio2 konflik tokoh utama film “the sorcerer and the white snake analisis genre abstrak skripsi bahasa mandarin mahasiswa universitas bina nusantara analisis literasi informasi mahasiswa program studi psikologi universitas hkbp nommensen medan analisis perusahaan farmasi mengalami merger indonesia pt. kalbe farma tbk pt. merck tbk pengaruh rasio camel pertumbuhan laba perbankan go public bursa efek indonesia analisis faktor-faktor mempengaruhi audit delay perusahaan food and beverage terdaftar bei evaluasi pelaksanaan peningkatan derajat kesehatan ibu melalui program expanding and neonatal survival (emas) puskesmas batang kuis rsu sembiring kabupaten deli serdang tahun 2013 kepemimpinan iklim komunikasi (studi deskriptif kuantitatif tentang peranan pemimpin iklim komunikasi kompas-usu) implementasi peraturan daerah kabupaten nias nomor 2 tahun 2010 tentang perusahaan daerah pasar yaahowu meningkatkan pendapatan asli daerah penyelenggaraan demokrasi partisipatif pembentukan kebijakan rencana tata ruang wilayah kota medan tahun 2011-2031 pengaruh investasi teknologi informasi sumber daya manusia return on investment (roi) melalui intellectual capital perusahaan perbankan indonesia (bei) pelaksanaan corporate social responsibility (csr) pt. perkebunan nusantara iiidalam pemberdayaan umkm kabupaten asahan (studi program kemitraan pt. perkebunan nusantara iiidistrik asahan) studi sintesis metil ester asam lemak dari pitch cair melalui tahap reaksi esterifikasi transesterifikasi pengaruh pendelegasian wewenang komitmen organisasi prestasi kerja karyawan perum bulog divisi regional sumatera utara pengunaan surfaktan polivinil alkohol sebagai bahan aditif pembuatan aspal emulsi analisis penerapan peraturan bank indonesia no.13/1/pbi/2011 nilai perusahaan perbankan studi empiris perusahaan perbankan terdaftar bursa efek indonesia hubungan pembagian kerja pendelegasian wewenang prestasi kerja bagian sumber daya manusia (sdm) rs dr g.l tobing tanjung morawa analisis penyelesaian perselisihan kontrak akibat keterlambatan pembayaran (studi perjanjian kerjasama jual beli tandan buah segar antara pks kwala sawit ptpn ii rekanan/pemasok) model loglinier tiga dimensi mengetahui hubungan jalur masuk, asal sekolah, nilai ipk mahasiwa fmipa universitas sumatera utara analisis pengaruh retailing mix kepuasan pelanggan loyalitas pelanggan surya swalayan jalan jamin ginting, medan model persamaan struktural mengetahui loyalitas konsumen, studi toko parfum cinta aroma (ca perfumerry) medan pengaruh strategi positioning keputusan pembelian produk jasa asuransi pt. jiwasraya medan utara pengaruh kemampuan pegawai, kepuasan masyarakat kualitas pelayanan kesehatan puskesmas pasar gambir tebing tinggi kota verba ‛potong’ bahasa batak toba implikatur jargon politik partai pdi perjuangan partai gerindra pemilihan presiden wakil presiden periode 2014-2019 determinan perilaku oportunistik penyusunan anggaran pemerintah kabupaten/kota provinsi sumatera utara pengaruh self cure activator sistem total etsa menggunakan pasak customized pita polyethylene fiber ketahanan fraktur pola fraktur hubungan antara gigi berjejal ukuran gigi dimensi lengkung mahasiswa fakultas kedokteran gigi universitas sumatera utara perbedaan laju aliran saliva distimulasi mengunyah menghisap permen karet pasien mengonsumsi antidepresan xerostomia rsup haji adam malik medan pengaruh rasio keuangan pertumbuhan laba perusahaan pertambangan terdaftar bursa efek indonesia pengaruh debt to asset ratio (dar), debt to equity ratio (der) return on asset (roa) perusahaan pertanian terdaftar bursa efek indonesia pengaruh implementasi pemasaran relasional loyalitas pelanggan hotel inna dharma deli medan analisis sistem informasi akuntansi sistem penerimaan pengeluaran kas mengevaluasi pengendalian internal kas pt bank syariah mandiri cabang pematangsiantar analisis pengaruh ketidakpuasan konsumen, kebutuhan mencari variasi iklan pesaing keputusan perpindahan merek dari pasta gigi pepsodent ke pasta gigi lain mahasiswa program s-1 reguler fakultas ekonomi usu pengaruh kesehatan bank profitabilitas perbankan terdaftar bursa efek indonesia (bei) periode 2010-2014 pengaruh kompensasi konflik kerja kinerja karyawan hotel grand orri berastagi (kabupaten karo) pengaruh kreativitas kualitas pelayanan kepuasan pelanggan usaha surabi bandung medan pengaruh penendalian internal, budaya organisasi kompensasi perilaku etis pegawai negeri sipil badan kepegawaian daerah kabupaten karo kewajiban perusahaan karyawan pelanggan (studi etika pt. lion air medan) peranan corporate social responsibility (csr) pt astra auto 2000 cabang amplas pengembangan ukm medan pelaksanaan eksekusi diatas hak pengelolaan (hpl) no. 3 milik pt. kawasan industri medan (persero) ( putusan peninjauan kembali no. 94 pk/pdt/2004) analisis pengendalian internal, kesesuaian kompensasi, komitmen organisasi kecendrungan kecurangan akuntansi menggunakan perilaku tidak etis sebagai variabel intervening studi perancangan antena susun mikrostrip patch segiempat dual-band (2.4 ghz 3.3 ghz) rancang bangun turbin vortex casing berpenampang lingkaran menggunakan sudu diameter 46cm 3 variasi jarak antara sudu saluran keluar the characteristic of ocular trauma in adulthood patients at adam malik hospital period 2011-2012 a hospital based study pengetahuan ibu tentang faktor maternal kualitas pelayanan antenatal berisiko kejadian berat badan lahir rendah klinik hj. t. syarifah amelia silvia tahun 2013 prodesur pendaftaran wajib pajak pengukuhan pengusaha kena pajak kantor pelayanan pajak pratama medan kota prosedur penagihan meningkatkan kepatuhan wajib pajak memenuhi kewajiban perpajakannya kantor pelayanan pajak pratama medan kota analisa tingkat kepatuhan wajib pajak menyampaikan surat pemberitahuan pajak penghasilan (spt pph) orang pribadi kantor pelayanan pajak pratama medan barat pemeriksaan pajak sebagai tindakan pengawasan atas pelaksanaan sistem self assessment kantor pelayanan pajak pratama medan kota prosedur pelaksanaan penyitaan oleh juru sita pajak wajib pajak badan kantor pelayanan pajak pratama medan belawan tata cara pemungutan pajak pertambahan nilai impor kantor pelayanan pajak pratama medan timur pemeriksaan pajak sebagai tindakan pengawasan atas pelaksanaaan sistem self assesment kantor pelayanan pajak pratama lubuk pakam prosedur pelaksanaan pemungutan bea balik nama kendaraan bermotor ( bbn-kb ) kantor bersama satuan administrasi manunggal satu atap ( samsat ) medan utara asuhan keperawatan tn.a gangguan rasa rasa nyaman nyeri penetapan kadar betametason valerat sediaan krim secara kromatografi cair kinerja tinggi (kckt) aplikasi pembelajaran membaca balita menggunakan adobe flash profesionalcs 5 determinan pemanfaatan pos kesehatan desa (poskesdes) keluarga kecamatan kutalimbaru kabupaten deli serdang penetapan kadar air sukade metode gravimetri identifikasi kandungan senyawa siklamat sekilas tentang kiyomizu-dera ichi moku no kiyomizu-dera ni tsuite perancangan simulasi mesin cuci umum menggunakan koin perancangan aplikasi simulasi vending machine berbasis web manajemen sumber daya manusia perpustakaan universitas negeri medan perancangan kamus digital bahasa indonesia – nias efek suara menggunakan visual basic 6.0 perbandingan konsentrasi sianida (cn¬-) ph inlet outlet dari instalasi pengolahan air limbah (ipal) industri pengolahan tepung tapioka pengaruh motivasi kerja prestasi kerja pegawai bagian tanaman pangan dinas pertanian provinsi sumatera utara peranan pramuwisata sebagai penunjang perkembangan objek wisata rumah tjong a fie analisis kinerja petugas malaria penemuan pengobatan kasus malaria puskesmas kabupaten deli serdang tahun 2014 strategi meningkatkan kualitas pelayanan makanan minuman jl long chinese restaurant hotel grand aston city hall medan peranan sekretaris bidang penilaian kantor wilayah dikretorat jenderal kekayaan negara etika pola makan orang jepang a conflicts pictured in antoine de saint’s novel the little prince prosedur pelaksanaan surat masuk surat keluar kantor wilayah kementrian agama provinsi sumatera utara the analysis of slang words in selected hip hop songs the analysis of conjunctions found in the reader’s digest’s article “the faith dealer” prosedur kearsipan mengumpulkan dokumen kementerian agama kantor wilayah provinsi sumatera utara virgin tragic perfume in patrick suskind novel “perfume the story of a murderer” pelaksanaan etika perbankan pelayanan nasabah pt bank sumut cabang syariah medan perilaku orang hiv aids (odha), stigma diskriminasi rumah singgah moderamen gbkp kecamatan berastagi kabupaten karo tahun 2014 the analysis of plot pictured in “the perks of being a wallflower” by stephen chobosky pengendalian internal penggajian upah pegawai biro perlengkapan pengelolaan aset setdaprovsu the analysis of the main characters in seré prince halverson’s novel the underside of joy the description of english phrasal verbs sistem akuntansi pembelian peralatan operasional pdam tirtanadi provinsi sumatera utara pengadaan bahan pustaka perpustakaan sma negeri 1 peureulak peranan sistem informasi akuntansi atas aktiva tetap badan kepegawaian daerah provinsi sumatera utara konservasi preservasi bahan pustaka badan perpustakaan, arsip dokementasi daerah provinsi sumaterautara sistem penataan arsip bagian kemahasiswaan fakultas ekonomi universitas sumatera utara sistem pengawasan internal gaji upah pt railink medan peranan struktur organisasi meningkatkan koordinasi kerja pegawai bagian kemahasiswaan fakultas ekonomi universitas sumaterautara sistem pengendalian internal kas koperasi eka bakti dinas koperasi umkm provinsi sumatera utara peranan administrasi perkantoran memperlancar pekerjaan kantor bagian akademik fakultas ekonomi universitas sumatera utara pelaksanaan manajemen perkantoran departemen manajemen fakultas ekonomi universitas sumatera utara sistem pengendalian internal penerimaan pengeluaran kas biro keuangan usu peranan sistem pengendalian manajemen meningkatkan kinerja pegawai fakultas ekonomi universitas sumatera utara peranan fasilitas kerja meningkatkan produktivitas kinerja staf pegawai fakultas ekonomi universitas sumatera utara penerapan komputer sebagai pengolah data sistem informasi akuntansi fakultas ekonomi universitas sumatera utara faktor risiko kejadian penyakit jantung koroner (pjk) lansia berobat jalan rsud langsa tahun 2014 analisis implementasi pemenuhan standar kesehatan keselamatan kerja berbasis kepmenkes ri no.1087/menkes/sk/viii/2010 rumah sakit tingkat ii putri hijau kesdam i bb medan pengaruh teknik komunikasi sbar komunikasi interpersonal perawat-dokter keselamatan pasien rawat inap rs islam malahayati medan tahun 2014 peranan sistem informasi akuntansi gaji pegawai fakultas ekonomi universitas sumatera utara sistem pengendalian internal aktiva tetap fakultas ekonomi universitas sumatera utara peranan kompensasi finansial motivasi kerja karyawan salamander energy north p.berandan pengaruh profitabilitas, kebijakan hutang, kebijakan dividen, keputusan investasi, insider ownership nilai perusahaan karakterisasi simplisia isolasi minyak atsiri dari daun salam koja (murraya koenigii l. spreng) segar kering serta analisis komponennya secara gc-ms pengaruh kualitas produk, kualitas layanan, harga kepuasan konsumen toko kopinkra-kotama shoes pengaruh store atmosphere keputusan pembelian konsumen next salon for men (salon khusus pria) jalan dr. mansyur no 94 medan subordinasi perempuan adat batak toba ( perempuan sebagai orangtua tunggal filosofi dalihan na tolu masyarakat batak toba) komunikasi antarpribadi suami istri ( kualitatif pasangan suami istri menikah tanpa pacaran kota medan) peranan anggaran barang jasa badan pengelola keuangan daerah (bpkd) kota medan sistem informasi akuntansi kas pt railink medan prosedur pemberian kredit pemilikan rumah sumut sejahtera (kpr sumut sejahtera) pt bank sumut kantor cabang utama medan analisis target realisasi penerimaan pajak penerangan jalan (ppj) dinas pendapatan daerah kota medan analisis anggaran biaya produksi tanaman tebu sebagai alat pengawasan pt. perkebunan nusantara ii kebun sampali analisis anggaran biaya produksi tanaman tebu sebagai alat pengawasan pt. perkebunan nusantara ii kebun sampali analisis anggaran penerimaan pengeluaran kas pt. perkebunan nusantara iii (persero) medan analisis rasio keuangan pt. alam sutera realty tbk periode 2009-2013 sistem pengendalian intern kas bagian marketing and sales budget pt. telkom medan perencanaan pengawasan biaya operasional pt. asuransi ramayana, tbk medan prosedur penugasan personal polri menjadi pengajar pendidikan kepolisian ditinjau dari hukum administrasi negara (studi sampali medan) hubungan pengetahuan sikap ibu hamil trimester iii tentang antenatal care kesesuaian kunjungan antenatal care klinik sumiariani tahun 2013 hubungan antar pengetahuan ibu tentang gizi obesitas balita tk yayasan pendidikan shafiyyatul amaliyyah medan tahun 2013 faktor-faktor mendorong ibu memakai kontrasepsi implant desa patumbak i kecamatan patumbak kabupaten deli serdang tahun 2013 faktor-faktor ibu memilih pemberian susu formula bayi 0-6 bulan desa lubuk rotan kecamatan perbaungan kabupaten serdang bedagai tahun 2013 hubungan pengetahuan tingkat kecemasan ibu perimenopause menghadapi menopause desa patumbak i kecamatan patumbak kabupaten deli serdang tahun 2013 efektifitas penyuluhan pengetahuan remaja tentang sindrom premenstruasi sma tri sakti medan tahun 2013 hubungan pengetetahuan ibu hamil kecemasan menghadapi kehamilan klinik bersalin hadijah medan tahun 2013 pengetahuan sikap ibu hamil tentnag persalinan metode hypnobirthing klinik diana brayan medan tahun 2013 faktor-faktor mempengaruhi terjadinya asfiksia neonatorum ibu mengalami ketuban pecah dini rumah sakit umum dr. pringadi medan tahun 2010 -2012 pengetahuan bidan tentang sistem rujukan ibu bersalin wilayah kerja puskesmas perbaungan plus kabupaten serdang bedagai tahun 2013 perilaku ibu bersalin secara seksio sesaria pemberian air susu ibu (colustrum) rumah sakit fajar medan 2013 peran bidan pelaksanaan inisiasi menyusui dini klinik bersalin swasta medan tembung tahun 2013 pengalaman ibu hamil kehamilan ganda kabupaten deli serdang tahun 20013 hubungan pengetahuan ibu tentang menopause aktifitas seksual ibu masa menopause lingkungan iv kelurahan titi papan tahun 2013 hubungan pengetahuan pendidikan ibu hamil kunjungan pemeriksaan antenatal klinik cahaya kelurahan pulo brayan kecamatan medan timur tahun 2013 karakteristik tingkat pengetahuan ibu bayi usia 0-7 hari mendapatkan imunisasi hepatitis b klinik martini medan tembung tahun 2013 hubungan status gizi kejadian dismenore primer remaja putri sma swasta istiqlal kecamatan deli tua kabupaten deli serdang faktor-faktor mempengaruhi pelaksanaan mobilisasi dini ibu pascasalin klinik bersalin surya medan tahun 2013 hubungan pengetahuan bidan tentang vitamin a cakupan pemberian vitamin a ibu nifas bps wilayah kerja puskesmas tegal sari kecamatan medan denai tahun 2013 implementasi metode analytic hierarchy process (ahp) simple additive weighting (saw) pemilihan operator seluler terbaik proses pelaksanaan penyitaan dilakukan oleh juru sita pajak kantor pelayanan pajak (kpp) pratama medan kota tata cara pemotongan pelaporan pajak penghasilan pasal 23 kantor pelayanan pajak pratama medan timur evaluasi 11 (sebelas) layanan unggulan perpajakan kantor pelayanan pajak (kpp) pratama medan barat tata cara pelaksanaan sita wajib pajak badan mengurangi tunggakan pajak kantor pelayanan pajak pratama (kpp) medan polonia asuhan keperawatan tn. r prioritas masalah kebutuhan dasar gangguan keseimbangan cairan elektrolit rsu dr. pirngadi hubungan kadar zinc plasma gradasi ulkus diabetikum penderita dm tipe ii analisis sistem kemitraan dinas kesehatan pt.exxon mobil indonesia pemanfaatan dana corporate social responsibility (csr) bidang kesehatan kabupaten aceh utara tahun 2013 pengaruh persepsi provider swasta tentang implementasi jaminan kesehatan nasional keikutsertaan sebagai provider pratama bpjs kesehatan kota medan tahun 2014 analisa faktor-faktor memengaruhi perilaku karyawan kilang papan penggunaan alat pelindung diri pt hidup baru kota binjai tahun 2014 asuhan keperawatan prioritas masalah gangguan oksigenasi rsud dr. pirngadi medan asuhan keperawatan prioritas masalah gangguaan istirahat tidur rsud dr. pirngadi medan asuhan keperawatan tn.a prioritas masalah kebutuhan dasar oksigenasi rsud pirngadi medan asuhan keperawatan an. k kebutuhan dasar personal hygiene rsud. dr. pirngadi medan tahun 2014 asuhan keperawatan tn.e prioritas masalah kebutuhan istirahat tidur rumah sakit jiwa daerah provinsi sumatera utara medan asuhan keperawatan tn. h prioritas masalah kebutuhan dasar cairan elektrolit rsud dr. pirngadi medan asuhan keperawatan tn.j prioritas masalah kebutuhan dasar oksigenasi rsud.dr.pirngadi medan evaluation of the association between m98k and t34t polymorphisms of the optineurin (optn) gene and primary open angle glaucoma in indonesia vitamin d deficiency occur in healthy tropical country women, not depending on adipocyte status penentuan kadar air kertas rokok hasil cetakan kertas pt. pusaka prima mandiri titi kuning penentuan persentase kehilangan minyak(losses) cpo terdapat tandan kosongdi ptp. nusantara iv (persero) unit kebun pabatu tebing tinggi the meanings of imlek for the society of chinese in medan analisis faktor-faktor penghambat penyaluran kredit pt. bank sumut kantor cabang pembantu aksara medan faktor risiko memengaruhi kasus penderita diabetes melitus tipe ii wilayah kerja puskesmas banda sakti kecamatan banda sakti kota lhokseumawe tahun 2014 analisis rasio laporan keuangan perusahaan real estate property bursa efek indonesia tahun 2009-2013 pemanfaatan ekstrak buah senduduk (melastoma malabathricum l.) sebagai pewarna sediaan tablet isolasi senyawa alkaloida dari biji tumbuhan jintan hitam (nigella sativa l.) serta karakterisasi isolat secara spektrofotometri sinar ultraviolet inframerah perilaku akseptor vasektomi dukungan keluarga wilayah kerja kecamatan porsea kabupaten toba samosir implementasi algoritma apriori fp-growth market basket analysis pembelian obat suatu apotek perawatan ibu nifas perspektif budaya leukhon kecamatan alafan kabupaten simeulue analisis higiene sanitasi pengolahan pemeriksaan bakteri e. coli minuman air kelapa muda dijual kelurahan lauchi kecamatan medan tuntungan medan tahun 2013 pengaruh kolerasi variabel ffd, fod ofd image foto rontgen menggunakan pesawat virtu x klinik usg rontgen fauzi medan penerapan automasi perpustakaan meningkatkan kualitas layanan perpustakaan umum kota medan ( layanan pengguna) evaluasi pemanfaatan koleksi institutional repository website digital repository perpustakaan unimed evaluasi kualitas layanan perpustakaan menggunakan metode libqual universitas negeri medan analisis fungsi makna iroiro samazama majalah nipponia analisis persepsi pelaku usaha rencana redenominasi analisis pengaruh ukuran perusahaan, profitabilitas, debt to equity ratio opini audit ketidaktepatan waktu pelaporan keuangan perusahaan properti real estate terdaftar bei pengaruh jam kerja imbalan produktivitas kerja karyawan pt. adira dinamika multi finance cabang lubuk pakam studi perancangan antena mikrostrip array patch segitiga dual-band aplikasi wlan (2,45 ghz) wimax(3,35 ghz) pengaruh good corporate governance, earnings quality, rasio profitabilitas aktivitas kinerja perusahaan makanan minuman terdaftar bursa efek indonesia tanggap pertumbuhan produksi bawang merah (allium ascalonicum l.) varietas lokal samosir beberapa dosis iradiasi sinar gamma morfologi bahasa melayu tamiang tinjauan yuridis tentang perjanjian pelaksanaan pekerjaan (kontrak) antara dinas penataan ruang pemukiman provinsi sumatera utara cv. rymandho medan analisis makna peribahasa bahasa melayu riau kabupaten kepulauan meranti kajian semantik penetapan kadar air cpo metode gravimetri pt perkebunan nusantara iv unit usaha adolina disfungsi keluarga novel cinta masih ada karya embart nugroho suatu tinjauan sosiologi sastra sistem dokumentasi nilai akademik smk ywka medan php mysql relasi laki-laki perempuan menurut pandangan islam novel maha cinta adam-hawa karya muhammad el-natsir sosiologi sastra perubahan kekasaran permukaan resin komposit mikrohibrid penyikatan pasta gigi zact smokers analisis faktor-faktor mempengaruhi pembelian ulang produk depot lia water perumahan kuis indah, batang kuis deli serdang penyusunan sistem prosedur akuntansi pengendalian internal efektif pt. sahabat jaya tio perkasa fungsi legislasi dprd (suatu kajian fungsi legislasi dprd provinsi sumatera utara periode 2009 – 2014) analisis pengaruh bid-ask spread, market value variance return holding period saham sektor pertambangan analisis perilaku konsumen sebagai dasar penyusunan kebijakan pemasaran perumahan marien garden kota medan perubahan bunyi bahasa proto austronesia kedalam bahasa melayu riau dialek kampar (kajian linguistik historis komparatif) analisis biomekanika buruh panen berondolan guna peningkatan produktivitas kerja (kasus ptpn iii kebun rambutan) pengaruh konsentrasi waktu kontak ekstrak etanol lerak (sapindus rarak dc) sebagai alternatif bahan irigasi saluran akar kelarutan jaringan pulpa (penelitian in vitro) keanekaragaman jamur makroskopis hutan pendidikan universitas sumatera utara desa tongkoh kabupaten karo sumatera utara ukuran dimensi rahang atas etnik india malaysia usia 21-28 tahun medan studi perencanaan program interpretasi alam jalur trekking hutan pendidikan usu, taman hutan raya bukit barisan kabupaten karo pengaruh penambahan serat kaca bahan basis gigitiruan resin akrilik polimerisasi panas bentuk reparasi berbeda kekuatan transversal karakteristik penderita kejang demam balita rawat inap rsud dr. pirngadi medan tahun 2010-2011 penentuan nilai dobi (deterioration of bleachability index) minyak sawit mentah (crude palm oil) spektrofotometri uv sistem pengadaan bahan pustaka perpustakaaan universitas dharmawangsa tingkat kebutuhan perawatan ortodonti berdasarkan aesthetic component murid smp putri cahaya medan perilaku konsumen penggunaan plastik kresek hitam daur ulang sebagai wadah makanan siap santap pusat pasar tavip binjai tahun 2012 strategi pengembangan usaha jamur tiram (studi usaha budidaya jamur tiram bapak koko tanjung slamet, medan sunggal) analisis strategi pengembangan usaha mikro kecil menengah (studi usaha batu bata kembar desa saba sitahul-tahul, kecamatan padang bolak, kabupaten padang lawas utara) pengetahuan sikap orangtua tentang penanganan darurat trauma avulsi gigi permanen anak kecamatan medan sunggal kecamatan medan kota formulasi gel ekstrak daun kembang bulan (tithonia diversifolia (hemsley) a. gray) efek penyembuhan luka eksisi persepsi masyarakat susilo bambang yudhoyono (suatu penelitian deskriptif kuantitatif desa sukaraja kecamatan darul makmur kabupaten nagan raya propinsi aceh) analisa faktor-faktor mempengaruhi pemilihan metode kontrasepsi pasangan usia subur (pus) wilayah kerja puskesmas pancur batu penggunaan kitosan nanopartikel sebagai adsorben limbah cair industri benang karet menurunkan kadar logam zn na, nilai cod, bod5, tss, tds pengetahuan sikap orangtua tentang penanganan darurat trauma avulsi gigi permanen anak kecamatan medan petisah kecamatan medan perjuangan. pengaruh rasio keuangan harga saham perusahaan real estate properti terdaftar bursa efek indonesia 2008-2011 pengaruh pelaksanaan good governance kinerja organisasi (studi kantor upt samsat medan selatan) pengaruh variasi ketidakseimbangan tegangan kinerja motor induksi tiga fasa nilai faktor ketidakseimbangan tegangan sama jumlah akar konfigurasi saluran akar gigi molar satu mandibula permanen medan respons pertumbuhan produksi kacang tanah (arachis hypogaeal.) pemberian pupuk kandang ayamdan pupuk npk (15 15 15) studi penyediaan nanokristal dari tandan kosong sawit (tks) analisis persepsi masyarakat tentang baitul maal wat tamwil kota medan pengaruh modifikasi pola hidup atau tanpa metformin kadar fetuin-a penderita obesitas the effect of phytosterol on serum beta-carotene concentration of hypercholesterolaemic subjects is micro evolution in tropical country women resulting low 25(oh)d level? a cross sectional study in indonesia pengaruh deskripsi kerja, penempatan kerja, disiplin kerja kinerja karyawan pt east west seed indonesia penentuan kadar triklosan cairan antiseptik resik-v manjakani pasta gigi formula secara kromatogarfi cair kinerja tinggi the description of modals used in stephenie meyer’s novel “the host” sistem informasi geografis berbasis web menentukan jarak terpendek menggunakan algoritma dijkstra ( plaza / mall dikota medan) analisis faktor-faktor mempengaruhi keputusan pembelian konsumen youlanda bakery and cake shop delitua pengaruh program pertanian berkelanjutan oleh serikat petani indonesia sosial ekonomi petani desa damak maliho kecamatan bangun purba kabupaten deli serdang hubungan karakteristik rumah kejadian ispa balita keluarga perokok kelurahan gundaling i tahun 2014 analisis perilaku perpindahan merek sampo sunsilk mahasiswi fakultas ekonomi bisnis universitas sumatera utara tugas fungsi badan kepegawaian daerah meningkatkan disiplin pegawai negri sipil ditinjau dari hukum administrasi negara ( kabupaten labuhanbatu utara provinsi sumatera utara) optimasi produksi program dinamis pabrik frf pt. socfindo kebun tanah gambus penerapan metode bayes empiric pendugaan area kecil (studi tentang proporsi status kepemilikan kartu jaminan kesehatan masyarakat (jamkesmas) perbandingan diameter indurasi uji mantoux anak kontak serumah tuberkulosis dewasa bta positif negatif analisa perbandingan efisiensi motor dc kompon pendek motor dc kompon panjang akibat penambahan kutub penggunaan jenis penjerap oksigen karbondioksida penyimpanan buah terung belanda kemasan termodifikasi aktif penggunaan metode backward menentukan persamaan regresi linier berganda ( jumlah penyalahgunaan narkoba polresta medan) pelaksanaan peraturan pemerintah nomor 46 tahun 2013 tentang pajak penghasilan atas penghasilan dari usaha diterima atau diperoleh wajib pajak memiliki peredaran bruto tertentu kantor pelayanan pajak pratama medan polonia pembuatan baterai lithium menggunakan bahan aktif mesocarbon microbead (mcmb) sebagai anoda variasi persentase berat pelarut n,n-dimethyl acetamide (dmac) nilai shock index sebagai prediktor mortalitas penderita sepsis sepsis berat tinjauan atas penerimaan pajak penghasilan pasal 21 setelah penyesuaian penghasilan tidak kena pajak kantor pelayanan pajak pratama medan polonia pengaruh modal kerja investasi aktiva tetap profitabilitas perusahaan grosir eceran terdaftar bursa efek indonesia pengaruh temperatur sintering sifat fisis,magnet mikrostruktur dari bafe12o19 aditif al2o3 uji disolusi kaplet asam mefenamat produksi pt. mutiara mukti farma (mutifa) medan perubahan bentuk baishun sejarah jepang analisis faktor mempengaruhi hasil produksi padi kabupaten serdang bedagai evaluasi preservasi konservasi koleksi tercetak (buku) museum pusaka karo analisis penerapan metadata dublin core database repository universitas negeri medan analisis tekstual musikal marsialop ari karya taralamsyah saragih studi deskriptif analitis identitas musikal nias terkandung “zinunö bnkp” analisis tekstual musikal nyanyian ayun-ayun tajak upacara turun karai budaya suku pesisir sibolga the morality reflected in characters through sidney sheldon’s the sands of time sikap berbahasa masyarakat batak simalungun desa tonduhan kecamatan hatonduhan kabupaten simalungun kajian sosiolingistik pembuatan karakterisasi papan komposit polimer dari campuran polipropilena, serat sabut kelapa, kulit tanduk kopi perbedaan proporsi lebar gigi anterior rahang atas konsep golden proportion, preston’s proportion, red proportion mahasiswa indonesia fkg usu angkatan 2011 – 2014 hubungan pengetahuan keterampilan intara natal care mahasiswa menjalankan praktek klinik kebidanan ii akademi kebidanan senior medan tahun 2013 analisa pengaruh tingkat modulasi transmisi qam kualitas video call (aplikasi laboratorium sistem komunikasi radio ft-usu) analisis simbol upacara kematian masyarakat suku hokkian kota medan rasio platelet-limfosit preoperatif sebagai faktor prognostik kanker ovarium epitel pengaruh ibu hamil perokok pasif berat badan lahir rumah sakit umum haji medan tahun 2014 pengaruh stress decreasing resin (sdr) resin flowable sebagai intermediate layer restorasi klas v resin komposit celah mikro (in vitro) respons pertumbuhan produksi tanaman jagung varietas nonhibrida hibrida pemberian bokashi pupuk k pengaruh anemia kehamilan kejadian perdarahan post partum persalinan normal rumah sakit umum haji medan periode 2011-2013 peranan polri pemberantasan penyalahgunaan narkotika ( polsekta pancur batu) karakteristik ibu hamil memeriksakan kehamilannya menggunakan usg praktek swasta dokter spesialis obgin kepatuhan bidan melaksanakan asuhan standar minimal pelayanan antenatal wilayah kerja puskesmas helvetia medan tahun 2014 analisis perbandingan kinerja keuangan menggunakan rasio keuangan economic value added (eva) pt. adhi karya (persero), tbk pt. total bangun persada, tbk pengetahuan sikap ibu tentang imunisasi bcg bayi usia 0-2 bulan 3 (tiga) posyandu wilayah kerja puskesmas helvetia medan tahun 2014 hubungan pemanfaatan pik-krr perilaku kesehatan reproduksi siswa sman 13 medan pengaruh pendapatan asli daerah dana transfer belanja modal pemerintahan kabupaten/kota sumatera utara penatalaksanaan pencegahan infeksi persalinan klinik bersalin swasta wilayah kerja puskesmas tembung medan hubungan tingkat pengetahuan tindakan ibu menyusui mencegah bendungan asi angka kejadian relaps sindrom nefrotik anak diterapi kortikosteroid rumah sakit umum pusat haji adam malik dari tahun 2009 sampai 2010 analisis perbedaan berat badan ibu sebelum sesudah menggunakan kontrasepsi suntik 3 bulan klinik bersalin sumiariani kecamatan medan johor kota medan tahun 2013 rekonstruksi celah bibir unilateral metode cronin analisis pemberian kredit resiko kredit serta pengaruhnya tingkat profitabilitas pt. bpr nbp 20 delitua pengaruh pengalaman, pendidikan pelatihan (diklat) peningkatan keahlian auditor bidang auditing kantor akuntan publik (kap) kota medan pengaruh pertumbuhan ekonomi, pendapatan asli daerah, dana alokasi umum, belanja modal pemerintah provinsi se indonesia hubungan kadar estradiol serum densitas tulang wanita menopause evaluasi kesesuaian lahan desa sihiong kecamatan bonatua lunasi kabupaten toba samosir tanaman anggur, stroberi, apel jambu biji pengaruh auditor switching, financial distress, debt default penerimaan opini audit going concern perusahaan manufaktur terdaftar bursa efek indonesia analisis pengaruh economic value added, price earning ratio, debt to equity ratio, price book value, pertumbuhan penjualan harga saham dividend per share sebagai variabel moderating perusahaan manufaktur terdaftar bei tahun 2010-2013 pengaruh modal intelektual kinerja keuangan perusahaan perbankan terdaftar bursa efek indonesia (bei) tahun 2011-2014 an analysis of code switching and code mixing used in a talk show hitam putih estimasi rugi-rugi energi sistem distribusi radial 20 kv ( penyulang ki. 4 – mawas gi. kim) pengaruh store atmosfer kualitas pelayanan kepuasan pelanggan supermarket maju bersama letda sujono analisis usahatani jeruk faktor-faktor mempengaruhi penerimaan petani desa perjuangan, kecamatan sumbul, kabupaten dairi kedudukan hukum lembaga penjamin kredit daerah sebagai penjamin pemberian kredit usaha kecil menengah (ukm) analisis faktor-faktor mempengaruhi konsumen keputusan pembelian koran harian tribun medan pemetaan konflik nelayan tradisional nelayan pukat tarik menggunakan model sipabio (kajian konflik masyarakat nelayan desa bagan asahan, kec. tanjung balai, kab. asahan tahun 2011-2013) pembuatan susu jagung pengayaan kacang hijau bergerminasi penambahan cmc sebagai penstabil mempelajari pengaruh lama pelayuan penambahan teh sirsak mutu teh hitam pembajakan kapal laut lepas ditinjau dari hukum internasional ( kapal mv jahan moni) pengaruh kualitas pelayanan kepuasan pelanggan grapari telkomsel binjai perspektif budaya minang perawatan ibu pospartum kelurahan tegal sari mandala 3 kecamatan medan denai tahun 2014 asuhan keperawatan pada pasien prioritas masalah pemenuhan kebutuhan personal hygiene” rsud.dr. pirngadi medan asuhan keperawatan tn. t prioritas masalah kebutuhan dasar kenyamanan nyeri strategi peningkatan pemasaran sub terminal agribisnis hessa air genting kecamatan air batu kabupaten asahan asuhan keperawatan ny. k prioritas masalah kebutuhan dasar mobilisasi rsud dr. pirngadi medan pengaruh promosi keputusan pembelian smartphone merek samsung mahasiswa ilmu administrasi niaga/bisnis fisip usu pengaruh carbon black sebagai bahan pengisi kekerasan (hardness) kompon proses pembuatan ban berjalan (conveyor belt) pt. industri karet nusantara analisis swot pentapan strategi pemasaran sas printing house medan pengaruh suhu waktu pemanasan nila ffa (free fatty acid) produk menara eifel margarin krim pt. smart tbk. belawan analisis filter pasif single tuned mengurangi arus harmonisa mixer pengaruh kompensasi semangat kerja kinerja karyawan (studi bank danamon kacab. pembantu unit medan deli ) pengaruh kinerja keuangan tanggung jawab sosial profitabilitas bank syariah indonesia periode 2010-2014 pengaruh globalisasi kebijakan ekonomi politik (studi interlinkages kebijakan ekonomi politik maraknya pembangunan ritel kota medan) analisis permintaan penawaran cabai merah provinsi sumatera utara analisis wacana kritis pidato kenegaraan presiden soekarno tanggal 17 agustus 1966 konsep diri orang hiv-aids (odha) kota medan akibat hukum pembatalan hasil keputusan rapat umum pemegang saham oleh kemenkumham perseroan terbatas (studi putusan mk nomor 84/puu-xi/2013) pertanggungjawaban serta pelaksanaan ganti rugi kecelakaan air asia qz8501 ditinjau dari konvensi internasional eksistensi lelang sebagai akibat hukum dari wanprestasi oleh nasabah pt pegadaian. (studi pt pegadaian kanwil i medan) efektivitas pelayanan pemberian izin mendirikan bangunan (imb) wilayah kota pematangsiantar pertimbangan hakim tindak pidana korupsi dilakukan oleh pejabat negara (studi putusan nomor 01/pid.sus.k/2011/pn.mdn) evaluasi pelaksanaan pemungutan pajak bumi bangunan (pbb) sektor perkotaan kecamatan medan selayang implementasi peraturan walikota medan nomor 28 tahun 2011 tentang perizinan usaha warnet (tinjauan kebijakan sosial mencegah mengatasi perilaku menyimpang pengguna warnet) formulasi uji efektivitas sedian krim mengandung minyak biji anggur (grapeseed oil) faktor-faktor penyebab anak menjadi anak jalanan ( terminal amplas kota medan) analisis potensi pengembangan bandara silangit kabupaten tapanuli utara tinjauan sosial ekonomi pengemis kota binjai perbandingan kecepatan ketepatan antara learning vector quantization kohonen identifikasi penyakit leukemia strategi lanjut usia (lansia) miskin pemenuhan kebutuhan keluarga kelurahan sempakata, kecamatan medan selayang, kota medan orientasi nilai keluarga etnis tionghoa menitipkan orangtua panti jompo (studi deskriptif keluarga etnis tionghoa menitipkan orangtuanya panti jompo karya kasih medan) aspek hukum pembuktian transaksi transfer dana menggunakan telepon seluler tingkat kepatuhan wajib pajak pembayaran pajak restoran dinas pendapatan daerah kota medan prosedur pengembalian kelebihan pembayaran pajak penghasilan orang pribadi kantor pelayanan pajak pratama lubuk pakam optimalisasi penerimaan pajak hotel meningkatkan pendapatan asli daerah (pad) dinas pendapatan daerah kota tebing tinggi pelaksanaan penyuluhan upaya meningkatkan kepatuhan wajib pajak kantor pelayanan pajak pratama lubuk pakam prosedur permohonan pengurangan pajak bumi bangunan sektor perdesaan perkotaan dinas pendapatan kota medan asuhan keperawatan ny. l prioritas masalah kebutuhan dasar intoleransi aktivitas kelurahan harjosari ii kecamatan medan amplas asuhan keperawatan ny. c prioritas masalah kebutuhan dasar mobilisasi kelurahan harjosari ii lingkungan ix kecamatan medan amplas penentuan jumlah karbon aktif proses penurunan kandungan klorin air olahan pt. coca cola bottling indonesia penentuan jumlah h2so4 proses penurunan alkalinitas air olahan pt. coca cola bottling indonesia aplikasi sensor lm35 sebagai thermometer digital output suara peran serta masyarakat penanggulangan bencana kelompok masyarakat peduli bencana desa tanjung mulia kecamatan sitelu tali urang jehe kabupaten pakpak bharat sistem perancangan pengendalian tekanan digital menggunakan loadcell ic hx711 berbasis mikrokontroler atmega32 cetakan komposit pengaruh media televisi perilaku menyimpang remaja ( smp negeri 1 bandar kelurahan perdagangan i kecamatan bandar kabupaten simalungun) respon residen program therapeutic community (tc) oleh panti rehabilitasi narkoba al-kamal sibolangit centre kontribusi anak jalanan sosial ekonomi keluarga kelurahan bantan timur, kecamatan medan tembung, kota medan peranan analisis swot fakultas ekonomi universitas sumatera utara analisis strategi peningkatan produktivitas karyawan pt. maximize informa studio indonesia makna hidup wanita aceh bergelar syarifah melajang pengaruh tempat tinggal tingginya angka anak putus sekolah perumnas mandala ii kelurahan kenangan, kecamatan percut sei tuan, kabupaten deli serdang perancangan turbin uap tekanan masuk 20 bar temperatur 350 oc sebagai penggerak alternator karakterisasi simplisia isolasi senyawa karagenan dari alga merah jenis kappaphycus alvarezii (doty) dari pulau terung provinsi kepulauan riau pola hubungan sosial ekonomi petani kemenyan toke desa pandumaan, kecamatan pollung, kabupaten humbahas variasi berat labur perekat phenol formaldehida kualitas papan lamina dari batang kelapa sawit pemadatan pengaruh tunjangan fungsional pustakawan penetapan angka kredit motivasi kerja pustakawan perpustakaan universitas sumatera utara kehidupan sosial ekonomi masyarakat nelayan bagan desa percut kecamatan percut sei tuan kabupaten deli serdang (1980-2000) ekspresi identitas etnis melalui asosiasi etnis” ( organisasi “hikma” kelurahan bandar selamat , kecamatan medan tembung) analisis kualitas layanan video call menggunakan codec h.263 h.264 lebar pita jaringan tersedia (aplikasi laboratorium sistem komunikasi radio ft-usu) pengawasan pelunasan pajak penghasilan (pph) pasal 21 kantor pelayanan pajak (kpp) pratama medan polonia asuhan keperawatan tn. g prioritas masalah kebutuhan dasar rasa amandannyaman rsu dr. pirngadi medan asuhan keperawatan tn. m prioritas masalah kebutuhan dasar rasa aman nyaman (nyeri) rsud. dr pirngadi medan dampak pembangunan industri diversifikasi mata pencaharian, interaksi sosial nilai pendidikan masyarakat perdesaan ( studi masyarakat sekitar kawasan industri pabrik desa tanjung selamat kecamatan percut sei tuan kabupaten deli serdang ) perbandingan penurunan resiko kejadian mual muntah paska operasi pemberian midazolam 0,035 mg/kg/iv ondansetron 4 mg/iv pasien skor apfel 3-4 dilakukan anestesi umum asuhan keperawatan an.i prioritas masalah kebutuhan dasar oksigenasi rsud dr. pirngadi kota medan asuhan keperawatan an. a prioritas masalah kebutuhan dasar ganggan rasa nyaman nyeri rsud. dr. pirngadi medan asuhan keperawatan an. a prioritas masalah kebutuhan dasar nyeri rs. dr. pirngadi medan adsorpsi karotenoida dari minyak sawit mentah (cpo) menggunakan kalsium polistirena sulfonat berderajat sulfonasi 27% desorpsinya etanol asuhan keperawatan tn.s prioritas masalah kebutuhan dasar ganggan rasa nyaman; nyeri rsud. dr. pirngadi medan penetapan kadar metformin hcl metode spektrofotometri ultraviolet pengaruh kinerja keuangan keputusan investasi nilai perusahaan corporate governance sebagai variabel moderasi (studi empiris perusahaan dinilai corporate governance perception index tahun 2008-2012) faktor-faktor mempengaruhi financial leverage industri perkebunan bursa efek indonesia (bei) pengaruh independensi, budaya organisasi, good governance, tingkatan jabatan kinerja auditor pemerintah ( bpk perwakilan sumatera utara) analisis kausalitas bi rate jumlah uang beredar indonesia pengaruh profitabilitas ukuran perusahan pengungkapan corporate social responsibility ukuran dewan komisaris sebagai variabel mooderasi perusahaan industri barang konsumsi terdaftar bei dampak keberadaan kawasan ekonomi khusus sei mangkei meningkatkan kesejahteraan masyarakat kabupaten simalungun ( kecamatan bosar maligas kecamatan bandar) pengaruh waktu dry mechanical milling heat treatment mikrostruktur, densitas sifat magnet dari ndfeb formulasi sediaan krim mengandung ekstrak etanol daun jarak pagar (jatropha curcas l.) aktivitasnya staphylococcus aureus, staphylococcus epidermidis pseudomonas aeruginosa gambaran perilaku pedagang jajanan makanan minuman penggunaan bahan tambahan pangan ( btp) pusat jajanan pajak usu padang bulan medan tahun 2012 efek milling time sifat fisis mikrostruktur dari serbuk bafe12o19 al2o3 sebagai aditif evaluasi dampak program sanitasi berbasis masyarakat (sanimas) pemberdayaan masyarakat (studi kelurahan bagan deli kecamtan medan belawan kota medan) pengaruh komposisi al2o3 milling time sifat fisis, magnet mikrostruktur dari bafe12o19 asuhan keperawatan tn.m prioritas masalah kebutuhan dasar oksigenasi rumah sakit umum daerah dr. pirngadi medan asuhan keperawatan ny.s prioritas masalah kebutuhan dasar defisit perawatan diri mandi berdandan rumah sakit jiwa provinsi sumatera utara medan asuhan keperawatan prioritas masalah gangguaan aktifitas; intoleransi aktifitas rsud dr. pirngadi medan analisis pengeluaran kas inspektorat kabupaten deli serdang pembuatan lembaran katoda life0.9ni0.1po4/c variasi suhu pengeringan analisa atenuasi pipa plastik kawat logam sebagai terahertz waveguide menggunakan metode finite difference pengaruh komposisi lembaran anoda lto (li4ti5o12) performa sel baterai ion lithium occurrence of vitamin d deficiency among women in north sumatera, indonesia sintesis karakterisasi bahan ni1+xfe2-xo4 (x = 0 ; 0,25 ; 0,5 ; 0,75 1) sebagai bahan absorber gelombang elektromagnetik pembuatan lembaran katoda life0.7mn0.2ni0.1po4/c variasi suhu pengeringan pandangan suku batak karo tentang kebiasaan ibu pasca melahirkan desa sukandebi kecamatan tigalingga kabupaten dairi tahun 2015 tingkat keluhan berdasarkan menopause rating scale wanita menopause kelompok pengajian kelurahan martoba kota pematangsiantar tahun 2015 asuhan keperawatan tn. a prioritas masalah defisit perawatan diri rumah sakit jiwa daerah provsu medan rekonstruksi pengelompokan bahasa-bahasa batak gerakan sosial politik studi deskriptif “revolusi sosial” sumatera timur implementasi steganografi least significant bit (lsb) modifikasi vigenere cipher citra digital analisis kadar kandungan minyak cangkang, inti sawit bungkil intisawit metode ekstraksi sokletasi pt. smart tbk pengaruh stres kerja lingkungan kerja turnover intention karyawan pt. daihatsu identifikasi pewarna sintesis minuman serbuk rasa jeruk secara kromatografi kertas balai besar pengawas obat makanan perbandingan hasil produksi pakaian cv. mode fashion departement store medan metode pemulusan dua parameter dari holt pemulusan eksponensial ganda dari brown pengaruh sistem rekrutmen penempatan kerja kinerja karyawan kantor pt. pos indonesia (persero) kantor pos medan 20000 woman's problems and the struggles against man domination as reflected in the color purple pengaruh likuiditas capital adequacy ratio industri perbankan bursa efek indonesia kadar pemulihan faktor viii pembuatan kriopresipitat the ability of using conditional sentences by the students of sma cahaya medan penentuan kadar asam asetat larutan cuka makanan metode titrimetri balai besar pengawas obat makanan medan fungsi makna teks dendang lebah masyarakat melayu tamiang analisis pengaruh struktur modal, ukuran perusahaan, pertumbuhan perusahaan, kinerja perusahaan nilai perusahaan sektor industri dasar kimia bursa efek indonesia (bei) prevalensi crossbite anterior dental piranti digunakan perawatan klinik s-1 departemen ortodonti fkg usu analisis pengaruh kredit perbankan penyerapan tenaga kerja sektor industri besar provinsi sumatera utara penentuan kadar hidrokortison asetat krim hidrokortison 2,5% pt. kimia farma (persero) tbk. plant medan pengaruh konflik pekerjaan konflik keluarga kinerja karyawan pasangan karir ganda (dual career couple) perum damri medan analisis pengaruh portofolio optimal menggunakan model indeks tunggal pengambilan keputusan investasi ( saham lq-45 terdaftar bursa efek indonesia periode 2011-2014 pengaruh risiko pembiayaan profitabilitas bank syraiah indonesia pengaruh perbandingan jamur tiram tempe penambahan tapioka tepung labu kuning mutu sosis studi efek minyak wijen, minyak almond, minyak zaitun penetrasi indometasin melalui kulit kelinci secara in vitro dari basis gel alginat analisis yuridis putusan mahkamah agung nomor 409 k/pdt.sus-phi/2014 terkait pemutusan hubungan kerja pengurus serikat pekerja perusahaan manufaktur the rastaman’s concepts of equality and freedom as reflected in bob marley’s selected songs the description of indonesian-english code mixing used in social network on facebook uji toksisitas subkronik ekstrak etanol pecut kuda (stachytharpheta jamaicensis l.vahl) mencit enyelesaian kredit / pembiayaan macet jaminan gadai emas (studi pt. bank sumut syariah, tbk medan) pengaruh nilai tukar mata uang rupiah tingkat inflasi penerimaan pajak pertamabahan nilai impor kantor pelayanan pajak madya medan penggunaan ekstrak daun ketapang (terminalia catappa l.) sebagai pewarna rambut perancangan aplikasi indeks surat kabar beranotasi berbasis visual basic surat kabar perpustakaan pascasarjana universitas negeri padang evaluasi hybrid library perpustakaan universitas negeri padang pengaruh karakteristik auditor, tipe kepemilikan perusahaan, kompleksitas ukuran perusahaan penetapan fee audit perusahaan perbankan terdaftar bursa efek indonesia pengaruh minyak nilam (oleum pogostemon) ketahanan wangi minyak lavender (oleum lavandulae) sediaan gel pengharum ruangan memakai basis gel campuran agar agar xanthan gum pengaruh diferensiasi produk pinjaman promosi keputusan pembelianproduk pinjaman pt. bank sumut kantor cabang utama medan pengaruh tingkat pengetahuan pasien tentang penyakit diabetes melitus tipe 2 obat antidiabetes oral hasil terapi poliklinik endokrin rsud dr. zainoel abidin banda aceh the efforts of jonas to restore his community become a real life from fantasy life by lawry, l. the giver upaya meningkatkan kepatuhan wajib pajak membayar pajak penghasilan kantor pelayanan pajak pratama medan belawan analisis potensi arah pengembangan desa pesisir kabupaten batu bara asuhan keperawatan ny.a prioritas masalah kebutuhan dasar mobilisasi lingkungan vii harjosari ii kecamatan medan amplas uji validasi metode zero crossing spektrofotometri derivatif penetapan kadar kafein parasetamol sediaan tablet pengawasan internal pembiayaan murabahah pt. bank sumut unit usaha syariah cabang pembantu hm joni asuhan keperawatan tn.p prioritas masalah kebutuhan dasar nyaman (nyeri) kelurahan harjosari kecamatan medan amplas asuhan keperawatan ny.n prioritas masalah kebutuhan istirahat tidur kelurahan harjo sari ii kecamatan medan amplas asuhan keperawatan ny. n prioritas masalah gangguan kebutuhan tidur klien halusinasi rumah sakit jiwa prof. muhammad ildrem provinsi sumatera utara medan peran dinas pariwisata kebudayaan mempromosikan pariwisata kabupaten tapanuli tengah potensi sumberdaya nipah mangrove sebagai penunjang ekowisata desa muara maimbai kecamatan sei nagalawan kabupaten deli serdang potensi bisnis program family gathering kampung ladang outbound camp fungsi partikel made made ni kalimat bahasa jepang the description of tenses used by the journalists bloomberg and harsh inthe jakarta post sully’s investigation on phone syndicate in albom’s the first phone call from heaven the ability of the 2015/2016 3rd year students of smp negeri 3 binjaiin using english tenses the study of gerund used in the adventures of huckleberry finn by mark twain manajemen koleksi perpustakaan universitas muhammadiyah sumatera utara (umsu) penerapan standard operasional prosedur (sop) front office kualitas pelayanan kepuasan nasabah sumut syariah kantor cabang pembantu syariah (kcps) djamin ginting medan sistem informasi akuntansi kas pt. bank xxxx medan. peranan manfaat sistem informasi akuntansi pt. bank sumut kantor pusat medan sistem informasi akuntansi penerimaan pengeluaran kas pt. bank qnb kesawan, tbk cabang pematangsiantar sistem pengawasan internal aktiva tetap kantor kementerian agama kota medan sistem informasi akuntansi persediaan pt metro medan sistem pengawasan internal aktiva tetap kantor perwakilan bpkp provinsi sumatera utara sistem akuntansi aktiva tetap pt. perkebunan nusantara iii medan sistem akuntansi penjualan pembelian kpri insko dinas koperasi umkm provinsi sumatera utara efektifitas pengawasan wajib pajak restoran meningkatkan pendapatan asli daerah dinas pendapatan kota medan faktor-faktor mempengaruhi penyaluran kredit sumut sejahtera ii pt. bank sumut kcp marendal analisis pemberian kredit angsuran lainnya pt bank sumut kcp setia budi medan analisis kualitas penanganan kredit bermasalah pt bank sumut medan cabang iskandar muda pembuatan evaluasi secara in vitro emulsi virgin coconut oil (vco) menggunakan emulgator tween 80 gom arab analisis lama mencari kerja bagi tenaga kerja terdidik kota medan intervensi pt pp london sumatera pembuatan kebijakan desa implementasi kebijakan sertifiksi guru sekolah dasar (sd) kabupaten deli serdang (studi sd negeri nomor 106812 bandar klippa) analisis komponen kimia minyak atsiri kulit jeruk telur buaya (citrus medica l.) secara gc-ms uji antioksidan metode dpph pemanfaatan modal sosial sektor perdagangan (studi etnis tionghoa, batak, minangkabau kota medan) perbandingan metode fuzzy sugeno metode fuzzy mamdani penentuan stok beras perum bulog divisi regional sumut pengaruh diferensiasi kualitas audit, kesulitan keuangan perusahaan, opini audit, fee audit pergantian kantor akuntan publik perusahaan manufaktur terdaftar bursa efek indonesia penerapan persamaan navier-stokes pergerakan fluida tabung metode elemen hingga keterkaitan metafora lingkungan alam komunitas bahasa aceh desa trumon aceh selatan kajian ekolinguistik aplikasi metode fuzzy – tsukamoto penentuan jumlah pemasukan beras optimum perum bulog divisi regional sumatera utara analisis pengendalian tingkat produksi optimal crude palm oil (cpo) metode epq (economic production quantity) ( pt. bakrie sumatera plantation tbk) language disorder in schizophrenia patient a case study of five schizophrenia paranoid patients in simeulue district hospital analisis kinerja keuangan pt. indonesia asahan aluminium (persero) menggunakan metode z-score model altman, springate, zmijewski serta economic value added (eva) periode 2010-2014 an analysis of phonological interference in marc marquez’s interviews an analysis of the five language styles found in sam’s utterances in the “i am sam” movie pengaruh kepercayaan merek advertising (iklan) melalui instagram loyalitas pelanggan produk lapink a pragmatic analysis of language manipulation strategies and motives in ted bundy’s statements rebellion against educational institution in j. d salinger’s novel the catcher in the rye perbedaan persepsi mahasiswa akuntansi senior junior program s-1 akuntansi feb usu mahasiswa swasta stie harapan medan mengenai profesi akuntan pengaruh penerapan analisis rantai nilai (value chain analysis) laba usaha home industry al-barokah pengaruh akuntabilitas, integritas skeptisisme profesional kualitas hasil audit inspektorat provinsi sumatera utara analisis kinerja enhanced interior gateway routing protocol topologi mesh overview implementasi accrual-based budgeting sektor publik indonesia pengaruh kualitas pelayanan jasa fasilitas puskesmas kepuasan masyarakat ( puskesmas kota kisaran) analisis antena mikrostrip susun 2 elemen patch segiempat defected ground structure berbentuk segiempat efek ekstrak etanol daun bangun-bangun (plectranthus amboinicus (lour.) spreng) kadar nitro oxide tikus jantan diinduksi doksorubisin efek antihiperurisemia ekstrak etanol biji alpukat (persea americana mill.) mencit putih jantan identifikasi drug related problems (drps) pasien anak demam berdarah dengue instalasi rawat inap rindu b rsup haji adam malik medan periode oktober 2014 - desember 2014 mekanisme efektivitas pengenaan pemungutan pajak reklame dinas pendapatan daerah kota medan penetapan kadar vitamin c dari jus buah apel (malus domestica borkh.) berwarna merah hijau secara titrasi 2,6-diklorofenol indofenol beberapa interval waktu analisis kualitas citra brain variasi flip angle (fa) mengunakan squens spin echo magnetic resonance imaging (mri) penetapan kadar kalium, kalsium, natrium magnesium selada air (nasturtium officinale segar direbus secara spektrofotometri serapan atom an analysis of code choice found among case education staffs kajian musik teks ende tarombo sonak malela upacara perkawinan pomparan raja sonak malela medan profil pelayanan swamedikasi oleh petugas apotek kasus diare anak apotek wilayah kota medan analisis pengembangan objek wisata pemandian alam karang anyar, kecamatan gunung maligas, kabupaten simalingun, provinsi sumatera utara pengaruh gaya kepemimpinan kompensasi prestasi kerja pegawai upt. balai pengujian sertifikasi mutu barang medan perbaikan rancangan alat bantu sortasi tandan buah segar (tbs) kelapa sawit pt. perkebunan nusantara ii pks sawit seberang analisis nilai sosial ekonomi konservasi satwaliar ruang terbuka hijau kota medan perancangan aplikasi sms (short message service) enkripsi teks menggunakan algoritma xxtea berbasis android gambaran komunikasi interpersonal perawat pelaksana menurut persepsi perawat klien ruang rawat inap rsud dr. pirngadi medan hubungan aktivitas fisik kualitas tidur lansia desa parsuratan kecamatan balige pengalaman mahasiswa profesi ners fakultas keperawatan universitas sumatera utara menerapkan perilaku caring pasien rumah sakit pendidikan kota medan faktor-faktor mempengaruhi keberhasilan pijat oksitosin pengeluaran asi ibu nifas klinik bersalin sumiariani medan johor pelaksanaan atraumatic care pemasangan infus anak mengalami rawat inap rsud dr. pirngadi medan analisis yuridis pemberian hak guna usaha perusahaan asing bentuk joint venture setelah undang undang nomor 25 tahun 2007 tentang penanaman modal hubungan motivasi ibu menyusui pemberian asi eksklusif dusun xvi sidomulyo desa klumpang kebun kecamatan hamparan perak kabupaten deli serdang pengaruh inisiasimenyusui dini (imd) perkiraan volume darah kala iv klinik bersalin vauziah, am.keb praktek klinik bidan ira batang kuis pengaruh supervisi kepala ruangan kelengkapan dokumentasi asuhan keperawatan ruang rawat inap rumah sakit umum daerah teungku peukan kabupaten aceh barat daya peranan badan kepegawaian daerah pelaksanaan promosi jabatan pegawai negeri sipil ( studi badan kepegawaian, pendidikan pelatihan kabupaten aceh tengah) pengaruh perpustakaan sekolah proses belajar siswa sma negeri 6 padang analisis pengaruh auditor industry specialization, audit tenure, ukuran perusahaan, independensi auditor kualitas audit perusahaan manufaktur terdaftar bei pengaruh kinerja keuangan nilai perusahaan good corporate governance sebagai variabel moderasi studi empiris perusahaan perbankan terdaftar bei tahun 2011-2013 analisis pengaruh perbedaan laba komersial laba fiskal (book tax differences) perubahan laba arus kas operasi sebagai variabel moderasi perusahaan manufaktur terdaftar bursa efek indonesia analisis pengaruh keputusan pendanaan, kebijakan dividen, keputusan investasi profitabilitas nilai perusahaan manufaktur sektor industri barang konsumsi terdaftar bursa efek indonesia tahun 2011-2013 prosedure mempersiapkan makan pagi pastry section hotel santika premiere dyandra medan analisis pengaruh transfer dana perimbangan, pendapatan asli daerah, produk domestik regional bruto (pdrb) belanja daerah kabupaten/kota provinsi sumatera utara analisis peluang bisnis obyek wisata tangkahan pertanggungjawaban pidana dokter (studi putusan makamah agaung nomor 365 k/pid/2012) implementasi kebijakan undang-undang nomor 23 tahun 2006 tentang administrasi kependudukan partisipasi masyarakat mengurus akta kelahiran kabupaten tapanuli selatan pengaruh partisipasi penyusunan anggaran, kejelasan sasaran anggaran, akuntabilitas publik, pengendalian akuntansi kinerja manajerial inspektorat pemerintah provinsi sumatera utara pengaruh profitabilitas, risiko bisnis, pertumbuhan aset kebijakan dividen struktur modal perusahaan pertambanganyang terdaftar bursa efek indonesia tahun 2011-2013 pengaruh modal, pemilihan lokasi pengetahuan mendorong keberhasilan usaha usaha mobil data sepanjang jalan dr. mansyur medan pengaruh keputusan investasi, keputusan pendanaan, kebijakan dividen, profitabilitas nilai perusahaan manufaktur terdaftar bursa efek indonesia pengaruh brand equity keputusan pembelian oli pelumas motor pertamina enduro 4t pelanggan bengkel ahass 01158 johor services medan perencanaan pengawasan biaya operasional pt. perkebunan nusantaara iii (persero medan) analisis biaya operasional cv. batang pane baru proses penyusunan anggaran fakultas ekonomi bisnis universitas sumatera utara analisis laporan laba rugi pt. perkebunan nusantara (persero) iii medan analisis anggaran biaya produksi kelapa sawit sebagai alat pengawasan pt. perkebunan nusantara iii (persero) kebun ambalutu pengaruh lingkungan kerja, stres kerja, insentif prestasi kerja kepala ruanga rumah sakit umum dr. pirngadi medan perkembangan standar akuntansi pemerintahan pp nomor 24 tahun 2005 menjadi standar akuntansi pemerintahan pp nomor 71 tahun 2010 pengaruh tingkat pendidikan spesialisasi kerja produktivitas kerja pt. langkat nusantara kepong (lnk) pengaruh ukuran perusahaan profitabilitas struktur modal perusahaan manufaktur terdaftar bursa efek indonesia identifikasi faktor penyebab kemiskinan kecamatan medan perjuangan dari dimensi kultural kajian eksperimental perbandingan performansi mesin otto bahan bakar premium campuran bahan bakar biogas lpg uji suhu kualitas lemang alat pemasak lemang listrik tipe vertikal dampak fisik kenaikan muka air laut wilayah pesisir kota medan efektivitas pelaksanaan corporate social responsibility kepada perusahaan bumn studi komparasi kelimpahan fitoplankton laju produktivitas primer perairan haranggaol danau toba isolasi uji ekstrakba perairan tawar mengendalikan biofilm aeromonas salmonicida berbagai permukaan padat an analysis of islamic liberalism found in michael muhammad kinght’s novel the taqwacores pengaruh rasio keuangan kinerja perusahaan perusahaan manufaktur sektor aneka industri terdaftar bursa efek indonesia pengaruh kompensasi finansial kinerja karyawan pt bank x area medan imam bonjol pengaruh diferensiasi produk promosi brand image samsung galaxy mahasiswa universitas sumatera utara penjadwalan flowshop metode algoritma genetikdi pt. charoen pokphand indonesia food division sistem pemindai meteran air platform android musik upacara adat perkawinan batak toba kota medan. kajian fungsi, kontinuitas, perubahan kajian yuridis implikasi masyarakat ekonomi asean (mea) penanaman modal asing sektor usaha rumah sakit pengaruh laba akuntansi, arus kas operasi, kebijakan hutang ukuran perusahaan dividen kas perusahaan manufaktur jenis otomotif terdaftar bursa efek indonesia tahun 2011-2013 penyandian data teks algoritma elgamal algoritma kompresi data algoritma elias gamma code evaluasi usabilitas situs web perpustakaan menurut persepsi mahasiswa ilmu informasi perputakaan kearsipan universitas negeri padang peran perpustakaan kementerian hukum hak asasi manusia wilayah sumatera utara pemenuhan kebutuhan pengguna akan informasi analisis keterlibatan dosen pengembangan koleksi perpustakaan sekolah tinggi ilmu kesehatan (stikes) amanah padang an analysison seniorhighschool students’ abilityto use simple past tense acasestudyonthe tenthyear studentsofsman21 medan pemeriksaan pajak kantor pelayanan pajak pratama lubuk pakam pelaksanaan penagihan pajak penyitaan meningkatkan kepatuhanwajib pajak kantor pelayanan pajak pratama lubuk pakam peranan pajak hotel meningkatkan pendapatan asli daerah (pad) dinas pendapatan kota medan tingkat kepatuhan wajib pajak orang pribadi menerapkan sistem self assessment kantor pelayanan pajak (kpp)pratama medan petisah mekanisme pelaporan pajak pertambahan nilai kantor pelayanan pajak pratama medan barat tata cara pemeriksaan pajak kantor pelayanan pajak pratama medan petisah analisa kepatuhan pembayaran pelaporan surat pemberitahuan masa pajak penghasilan (pph) pasal 21 kantor pelayanan pajak pratama medan timur asuhan keperawatan ny. d perioritas masalah kebutuhan dasar mobilisasi kelurahan harjosari ii kecamatan medan amplas asuhan keperawatan ny.d prioritas masalah kebutuhan dasar hambatan mobilitas fisik kelurahan harjosari, kecamatan medan amplas asuhan keperawatan ny. n prioritas masalah kebutuhan dasar aman nyaman nyeri lingkungan v kelurahan harjo sari ii kecamatan medan amplas kota medan asuhan keperawatan an.s prioritas masalah kebutuhan dasar nutrisi kurang dari kebutuhan tubuh kelurahan harjosari ii kecamatan medan amplas asuhan keperawatan tn. j prioritas masalah kebutuhan dasar gangguan tidur rsud. dr.pirngadi medan, provinsi sumatera utara asuhan keperawatan tn.m prioritas masalah kebutuhan dasar oksigenasi rsud dr. pirngadi medan asuhan keperawatan tn. s prioritas masalah kebutuhan dasar yaitu nyeripada pasien dm tipe 2 rsud. dr. pirngadi medan the description of alay language found in twitter analisis kelayakan pemberian kredit multi guna pt. bank sumut kcp usu politik anggaran (studi analisis hubungan antara pemerintah provinsi sumatera utara dprd provinsi sumatera utara penetapan anggaran pendapatan belanja daerah (apbd) tahun 2014) implementasi program pengurangan pekerja anak kota “layak anak” medan kandungan vitamin bahan dasar mp-asi tepung campuran pisang awak tepung beras serta sumbangannya angka kecukupan gizi bayi pengaruh pengawasan produktivitas kerja (studi kantor pt. kereta api indonesia divisi regional sumatera utara) analisis faktor – faktor mempengaruhi price earning ratio (per) perusahaan perbankan go publik periode 2010-2012 pengukuran analisa produktivitas menggunakan metode objective matrix (omax) ptpn iv unit usaha sawit langkat kajian kuat tekan bebas tanah lempung distabilisasi gypsum abu ampas tebu efek obat kumur kandungan minyak esensial status kesehatan rongga mulut ditinjau dari indeks plak pasien ortodonti cekat hubungan kadar urea, ph laju aliran saliva penderita gagal ginjal kronik klinik rasyida medan jepang masa keshogunan tokugawa perancangan alat pengisi baterai smartphone berbayar tenaga surya sistem pendidikan jepang setelah perang dunia ke ii teknik pembuatan ukiyo-e optimasi biaya transportasi pengiriman produk tepung pt xyz pendekatan distribution resource planning prinsip aikido konsep keluarga jepang japanese roll cake budaya kerja perusahaan jepang perancangan dodos ergonomis sebagai alat panen kelapa sawit menggunakan kansei engineering quality function deployment pt perkebunan nusantara iii kebun rambutan fungsi kata keterangan yatto kalimat bahasa jepang analisis kualitas transmisi video decodable frame rate analisis utilisasi kapasitas produksi pt. asia raya foundry pendekatan theory of constraints (toc) upacara kelahiran jepang pendidikan anak tk jepang the description of the vitiligo victim from psychological and sociological aspects the love value of edward and bella love pictured in stephenie meyer novel “twilight" frankenstein’s ambition of created the horrible monster in mary shelley’s novel “frankenstein” amy’s successful screwy plan by flynn in gone girl novel code-mixing used by x-games indonesia hosts keanekaragaman fungi mikoriza arbuskula berbagai varietas tanaman kopi asuhan keperawatan an. a prioritas masalah kebutuhan dasar istirahat tidur rs. dr. pirngadi medan penetapan kadar arsen (as) air minum menggunakan icp (inductively couple plasma) penetapan kadar kadmium (cd) eyeshadow alat inductively couple plasma (icp) karakterisasi edible film dari campuran ekstraksi keratin limbah bulu ayam pati jagung sebagai kemasan layak makan potensi pemanfaatan hasil hutan bukan kayu jenis kemenyan ( hutan batang toru blok barat kecamatan adiankoting, kabupaten tapanuli utara) eksplorasi tumbuhan obat pemanfaatannya ( hutan batang toru blok barat, kecamatan adiankoting, kabupaten tapanuli utara) konflik agraria perspektif ham ( konflik antara masyarakat desa padang halaban, kecamatan aek kuo, kabupaten labuhan batu utara pt. smart) pengaruh ukuran paket user datagram protocol trafik video konsumsi energi perangkat bergerak pengaruh kesesuaian penempatan kerja pelaihan prestasi kerja karyawan pdam tirtanadi provinsi sumatera utara kantor cabang padang bulan medan potensi hutan mangrove sicanang sebagai kawasan ekowisata penentuan jumlah produksi optimal pendekatan dynamic programming ptpn iv unit usaha sawit langkat pengujian alat pengering hibrida pompa kalor surya mengeringkan biji kakao pengaruh kemampuan wirausaha pengembangan karir individu medan kajian performansi mesin diesel stasioner satu silinder sistem dua bahan bakar (dual fuel system) super efisiensi model data en- velopment analysis 2-tahap implementasi sms gateway pengelolaan perpustakaan ( sma sma negeri 1 medan) pengetahuan sikap ibu tentang kejadian diare balita puskesmas teladan medan tahun 2014 sistem pendukung keputusan penilaian mutu kepegawaian menggunakan metode pendekatan topsis hubungan komunikasi verbal non verbal oleh bidan tingkat kepuasan ibu nifas rsia sri ratu medan pelaksanaan prosedur penyitaan barang wajib pajak akibat dari utang pajak kantor pelayanan pajak (kpp) pratama medan petisah tatacara pendaftaran pengukuhan pengusaha kena pajak kantor pelayanan pajak pratama medan barat rancang bangun pompa kalor alat pengering hibrida pompa kalor surya asuhan keperawatan an.r prioritas masalah kebutuhan dasar nutrisi rsud dr. pirngadi medan asuhan keperawatan tn. s prioritas masalah kebutuhan dasar oksigenasi rsud. dr. pirngadi medan hubungan pola asuh ibu pemberian makanan status gizi anak balita rsud dr. pirngadi kota medan pengaruh motivasi kinerja karyawan bagian humas pt perkebunan nusantara iii (persero) medan sistem informasi akuntansi gaji upah pt. bank sumut kcp usu pelaksanaan tindakan pencegahan penyebaran infeksi proses pertolongan persalinan oleh bidan praktek swasta wilayah kerja puskesmas sei agul kecamatan medan barat analisis rasio likuiditas pt pln (persero) area medan gambaran ibu hamil resiko tinggi ibu hamil rsud dr.pirngadi medan tahun 2013-2015 sistem informasi akuntansi kas pt pln (persero) cabang medan efektivitas supervisory training supervisor pt x analisis produk domestik regional bruto (pdrb) jumlah tenaga kerja pendapatan perkapita kota padangsidimpuan pengaruh intensitas naungan pertumbuhan propagul rhizophora apiculata blume desa jaring halus, kecamatan secanggang, kabupaten langkat pengalaman ibu primipara melakukan perawatan bayi baru lahir klinik bersalin suryani kecamatan medan johor strategi pengembangan bisnis family doorsmeer jalan sisingamangaraja pematang siantar hubungan dukungan sosial kecemasan pasien kanker payudara rsup haji adam malik medan hubungan sosial budaya pemberian makanan pendamping asi bayi 0-6 bulan dusun ix desa bandar setia tahun 2015 pengaruh kepatuhan pengendalian intern, moralitas manajemen sistem kompensasi perilaku etis karyawan sistem penggajian ( karyawan pt. bank syariah mandiri kanwil medan) hubungan luar negeri indonesia-arab saudi konteks tenaga kerja indonesia pengaruh karakteristik komite audit, kompetensi komite audit aktivitas komite audit kualitas audit perusahaan property real estate terdaftar bei budaya organisasi kinerja karyawan (studi korelasional tentang hubungan budaya organisasi perusahaan kinerja karyawan pt indomarco prismatama cabang medan) pengaruh foreign direct investment debt to equity ratio market capitalization bank indonesia , malaysia , singapura, thailand, filipina, vietnam ias 28 sebagai variabel moderating pengaruh budaya kaizen efektivitas kerja karyawan toyota sales operation auto 2000 cabang medan amplas analisis pengaruh free cash flow, return on equity managerial ownership kebijakan hutang perusahaan property real estate terdaftar bursa efek indonesia pemodelan penyebaran infeksi hiv komunitas injecting drug users (idu) graf primitif jarang scrambling index 1 analisis faktor-faktor mempengaruhi stock split trading volume activity sebagai variabel pemoderasi dampak ditimbulkannya ndonesia malaysia pengaruh corporate governance manajemen laba perusahaan manufaktur terdaftar bei (2010-2012) persepsi mahasiswa jurusan akuntansi pemilihan karir sebagai akuntan publik ( fakultas ekonomi bisnis universitas sumatera utara fakultas ekonomi bisnis islam universitas islam negeri sumatera utara) deteksi kemiripan dokumen teks menggunakan algoritma manber viskosimeter digital menggunakan water flow sensor g 1/2 berbasis mikrokontroller 8535 the analysis of metaphor used in mitch albom’s in novel the five people you meet in heaven pengolahan arsip pegawai kantor badan pusat statistik provinsi sumatera utara pelestarian bahan pustaka langka melalui proses alih media digital perpustakaan khusus pusat penelitian kelapa sawit (ppks) kebijakan pengembangan koleksi perpustakaan sekolah tinggi keguruan ilmu pendidikan (stkip) tapanuli selatan peranan perpustakaan meningkatkan minat baca perpustakaan sekolah yayasan perguruan gajah mada medan pemeliharaan arsip dokumentasi dinas pendapatan kota medan kebutuhan peralatan penataan arsip dinas peternakan kesehatan hewan sumatera utara peranan korespondensi bagi sekretaris bagian sekretariat dekan fakultas ekonomi bisnis universitas sumatera utara sistem pengendalian internal gaji upah pegawai badan pengelola keuangan daerah (bpkd) kota medan peranan manfaat sistem informasi akuntansi sebagai alat bantu manajemen rumah sakit martha friska brayan perencanaan pengawasan beban operasional pt perkebunan nusantara iii (persero) medan asuhan keperawatan an. rdengan prioritas masalah kebutuhan dasar nyeri akut rsud dr. pirngadi medan prevalensi trauma gigi permanen anterior anak smp kecamatan medan baru medan johor efek waktu wet milling suhu annealing sifat fisis, mikrostruktur magnet dari flakes ndfeb optimasi milling time sifat fisis mikrostruktur bafe12o19 sio2 sebagai aditif persepsi mahasiswa open access meningkatnya plagiatisme perguruan tinggi ( mahasiswa pascasarjana ilmu hukum universitas sumatera utara) analisis tekstual musikal lagu inggou parlajang karya taralamsyah saragih motifs of woman emancipation in abidah el khalieqy’s novel perempuan berkalung sorban and hendrik ibsen’s play a doll’s house a comparative literature study metafora emosi statif bahasa batak toba perubahan score bleachedguide, nilai kecerahan kekerasan enamel gigi sebelum sesudah perlakuan bleaching karbamid peroksida 35% pengaruh komite audit, profitabilitas, reputasi auditor, struktur kepemilikan kualitas laba earnings management perusahaan listing bursa efek indonesia (bei) faktor-faktor mempengaruhi mahasiswa akuntansi fakultas ekonomi bisnis universitas sumatera utara pemilihan karir menjadi auditor instansi swasta pemerintah pengaruh motivasi pengetahuan tentang profesi akuntan publik minat mahasiswa akuntansi mengikuti pendidikan profesi akuntansi (studi empiris mahasiswa akuntansi angkatan 2011-2012 universitas sumatera utara) analisis faktor-faktor mempengaruhi pengingkatan kualitas mahasiswa akuntansi universitas sumatera utara menghadapi masyarakat ekonomi asean analisis swot sebagai dasar penentuan strategi bersaingpada pt perkebunan nusantara iii (persero) sistem akuntansi pemberian kredit sentra kredit konsumer pt bank rakyat indonesia (persero)tbk kcp gajah mada medan sistem akuntansi penerimaan pengeluaran kas pt.telkom kabupaten karo kecamatan kabanjahe pengadaan barang / jasa pemerintah bidang konstruksi ( kementrian pekerjaan umum perumahan rakyat satuan kerja wilayah i provinsi sumatera utara) analisis sistem pencatatan persediaan pt. pertani (persero) medan analisis pengelolaan kas daerah badan pengelola keuangan daerah (bpkd) kota medan analisis rasio likuiditas pt perkebunan nusantara (persero) iii medan analisis arus kas rumah sakit islam malahayati medan peranan sistem pengendalian manajemen meningkatkan kinerja pegawai pt. bina agro perdana medan analisis rasio likuiditas laporan keuangan pt. perusahaan gas negara (persero) tbk pengaruh jumlah kredit disalurkan laba pt. bank sumut cabang medan iskandar muda peranan fasilitas kerja meningkatkan produktivitas kerja karyawan pt. telkom divre i witel sumut barat perencanaan pengawasan beban operasional bagian transaksi energi listrik pt. pln (persero) area medan analisis manajemen piutang pt. mopoli raya analisis laporan keuangan pt ace hardware indonesia tbk terdaftar bursa efek indonesia uji efek penurunan kadar asam urat dari ekstrak etanol daun cocor bebek (bryophyllum pinnatum (lam.) oken) mencit jantan audit tenure, ukuran kap, ukuran perusahaan klien, spesialisasi audit kualitas audit perusahaan manufaktur terdaftar bei rancangan alat bantu kerja operator angkat buah kelapa sawit stasiun pemanenan ud. jerry dolok masihul perancangan pemantau kapasitas tong air menggunakan sensor ultrasonic sms gateway berbasis atmega 8535 secara hardware perencanaan pengawasan biaya operasional dinas kelautan perikanan sumatera utara sistem pengawasan internal kas pt. bank sumut cabang medan iskandar muda interaksi obat antipsikotik pengobatan pasien skizofrenia rawat jalan rsup h. adam malik medan stres kerja perawat ruang rawat inap ruang rawat intensif rsud dr. pirngadi medan analisis faktor–faktor mempengaruhi konsumen keputusan pembelian produk (studi toko abdi, medan ) study model sebaran pergerakan (trip distribution) menggunakan metode gravity analisis perbandingan efisiensi balok beton prategang penuh prategang parsial analisa perbandingan pengaruh perpendekan elastis beton, susut, rangkak relaksasi baja lendutan balok komposit beton prategang metode pelaksanaan pre-tensioning post-tensioning analisa kajian banjir sumur resapan lubang biopori kawasan perumahan griya insan mulia, kecamatan medan sunggal peningkatan kualitas pelayanan kesehatan menggunakan integrasi metode servqual model kano rumah sakit bunda thamrin prosedur penerbitan akta kematian berdasarkan undang-undang nomor 24 tahun 2013 tentang administrasi kependudukan (studi kota medan). jarak interinsisal pembukaan mulut maksimal suku batak kelompok umur 17-22 tahun uji efektivitas trichodermin fungisida heksakonazol menghambat pertumbuhan ganoderma boninense pat. tanaman kelapa sawit laboratorium uji efektivitas trichodermin fungisida triadimefon menghambat pertumbuhan jamur akar putih rigidoporus lignosus peran media sosial menigkatkan kapasitas pemasaran paket wisata pt. okdo harapan mulia tour and travel medan pengaruh inokulasi mikoriza arbuskula pertumbuhan tanaman slow growing (mahoni, glodokan, tanjung) pengaruh kualitas pelayanan kepuasan pelanggan pengguna jasa servis bengkel auto 2000 jalan sisingamangaraja no.8 medan pengaruh kualitas pelayanan kepuasan pelanggan pengguna jasa servis bengkel auto 2000 jalan sisingamangaraja no.8 medan gerakan sosial hippma ( himpunan pensiunan perkebunan maju bersama) memperjuangkan hak-hak pensiunan buruh ptpn ii (studi deskriptif desa tanjung sari, kecamatan batang kuis, kabupaten deli serdang) hubungan patron klien antara pemilik lahan buruh tani (studi desa sipangan bolon kecamatan girsang sipangan bolon kabupaten simalungun) pengaruh komposisi fe2o3 sifat fisis, mikrostruktur magnet dari barium heksaferrit analisis kalimat majemuk kausalitas bahasa mandarin novel the myth of huoyi and chang e (后羿射日和嫦娥) karya ye zhaoyan analisis kontrastif kalimat pasif bahasa mandarin bahasa inggris pengelolaan perpustakaan kecil tbm mas raden medan analisis pragmatik cerita novel “dear yurichika” karya akiko terenin persahabatan antaretnis novel menjadi djo karya dyah rinni pendekatan sosiologi sastra hubungan posisi lidah usia, jenis kelamin lama edentulus pasien edentulus penuh pengaruh sistem informasi akuntansi keefektifan pengendalian internal bank-bank umum terdaftar paada bursa efek indonesia pengaruh corporate social responsibility nilai perusahaan profitabilitas sebagai variabel moderating perusahaan pertambangan terdaftar bursa efek indonesia tahun 2012-2014 pengaruh pengetahuan kewirausahaan, faktor keluarga faktor kepribadian minat berwirausaha mahasiswa konsentrasi kewirausahaan s-1 manajemen fakultas ekonomi bisnis universitas sumatera utara pengaruh orientasi kewirausahaan keunggulan bersaing berkelanjutan umkm pengaruh sponsorship program tv x factor indonesia season 2 brand awareness oppo smartphone pengunjung plaza medan fair medan penggunaan desain eksperimen metode taguchi failure mode and effect analysis (fmea) menentukan komposisi paving block berbahan alteratif cangkang kelapa sawit analisis simulasi efektifitas alat penukar kalor tabung sepusat aliran berlawanan variasi temperaturairpanas mengalir tabung (tube) analisis simulasi keefektifan alat penukar kalor tabung sepusat variasi kapasitas aliran fluida panas, kapasitas aliran fluida dingin, suhu masukan fluida panas aliran sejajar uji beban kerja kinerja alat pengering kelapa parut (desiccated coconut) tingkat penggunaan azolla pinnata pakan pertumbuhan ikan nila (oreochromis niloticus). analisis pertumbuhan laju eksploitasi ikan tongkol (auxis thazard) didaratkan kud gabion pelabuhan perikanan samudera belawan sumatera utara akibat hukum ketidaksesuaian kualitas perjanjian jual beli produk inti sawit (kernel) antara cv. bintang efendi brother medan pt. agro jaya perdana medan aspek perlindungan pengungsi dilihat dari hukum nasional hukum internasional ( penanganan pengungsi rohingya kota medan) pertanggungjawaban penyelenggara sertifikasi elektronik penyelenggara sistem elektronik hal penjaminan keamanan kepatuhan ibu kunjungan imunisasi dasar puskesmas padang bulan tahun 2015 peran fungsi account representative (ar) penggalian potensi penerimaan pajak kantor pelayanan pajak (kpp) pratama medan timur tahun 2013 pengolahan bahan pustaka perpustakaan iain medan an analysis of conversational implicature in a bbc one television series sherlock – a study in pink prosedur pelaksanaan penagihan pajak meningkatkan kepatuhan wajib pajak membayar utang pajak kantor pelayanan pajak pratama medan timur tahun 2013 asuhan keperawatan tn. a prioritas masalah kebutuhan dasar personal hygiene rumah sakit jiwa daerah provinsi sumatera utara asuhan keperawatan an.t prioritas masalah kebutuhan dasar oksigenasi rsud.dr. pirngadi medan sistem penyimpanan arsip kantor perpustakaan, arsip dokumentasi kabupaten deli serdang asuhan keperawatan tn. j prioritas masalah kebutuhan rasa aman nyaman rumah sakit jiwa daerah provinsi sumatera utara medan asuhan keperawatan tn.s prioritas masalah kebutuhan dasar nutrisi rsud dr. pirngadi optimasi perencanaan produksi metode fuzzy goal programming asuhan keperawatan pasien efusi pleura prioritas masalah gangguan pemenuhan kebutuhan oksigenasi rsud dr. pirngadi medan prosedur pelaksanaan pengadaan barang jasa pemerintah berdasarkan perpres no. 70 tahun 2012 tinjau dari perspektif hukum administrasi negara pengaruh agen sosialisasi keluarga tindakan pencarian pengobatan desa simpang empat kecamatan karang baru kabupaten aceh tamiang tahun 2014 optimasi sistem persediaan produk akhir pendekatan lean manufacturing pt. pusaka prima mandiri pengukuran kinerja supplier pemilihan supplier tambahan pt. serdang jaya perdana, kecamatan tandem hilir pra rancangan pabrik pembuatan selulosa asetat dari kulit buah kakao kapasitas 1.500 ton/tahun pengaruh berat karet remah proses pengeringan nilai plasticyty retentions index karet sir 10 pt. perkebunan nuasantara iii gunung para perencanaan aktivitas distribusi menggunakan konsep supply chain management pt. pusaka prima mandiri penentuan jumlah naoh dibutuhkan unit gliserin destilasi pemutihan parameter bilangan penyabunan pengaruh ph jumlah penggunaan larutan naoh proses pemutihan pulp tahap ekstraksi oksidasi (eop) unit pemutihan fiber line pt.toba pulp lestari,tbk porsea. pengaruh kenaikan co2 kadar trimetilamina (tma) perubaahan kandungan tma setelah memasuki tma catchpot proses destilasi pemurnian metanol pt kaltim methanol industri bontang strategi pemasaran jamur tiram putih (pleurotus sp) kota medan pengaruh perbandingan jumlah carbon black kalsium karbonat sebagai bahan pengisi kekerasan (hardness) rubber coupling bahan baku sir 3 l pt. industri karet nusantara penentuan bilangan iodine dari mentega putih merk flagship produksi tbk.belawan analisis kelayakan usaha gula aren (studikasus desa mancang, kecamatan selesai, kabupaten langkat) formulasi orally disintegrating tablet (odt) domperidon secara cetak langsung menggunakan campuran primogel krospovidon sebagai pengembang analisis efektivitas distribusi beras miskin (raskin) kota medan gambaran kebiasaan makan penderita diabetes melitus type ii pasien rawat jalan puskesmas padang bulan selayang ii medan tahun 2014 pengaruh penambahan fe sifat fisis sifat magnetik dari barium heksaferit ( bafe12o19) strategi pengrajin lokal mempertahankan keberadaan kerawang gayo tradisional kecamatan bebesen kabupaten aceh tengah penyelesaian sengketa oleh komisi informasi atas informasi diberikan bpom terkait keselamatan konsumen mengkonsumsi suatu produk sintesis o-karboksimetil n-lauroil kitosan melalui eterifikasi kitosan asam monokloroasetat diikuti asilasi lauroil klorida perbedaan status oral higiene pengalaman karies gigi penderita bukan penderita asma usia 20-30 tahun rsup h.adam malik medan analisis kualitas air sungai pelawi desa pelawi kecamatan babalan kabupaten langkat sumatera utara sistem pencarian jalur tercepat ambulans menggunakan algoritma a* (a star) hubungan derajat preeklampsia kejadian bblr rumah sakit umum pirngadi medan tahun 2011 -2012 perancangan sistem pengenal digit angka meter air menggunakan jaringan syaraf tiruan kohonen kajian permeabilitas beberapa jenis tanah sei krio kecamatan sunggal ptpn ii kecamatan tanjung morawa kabupaten deli serdang melalui uji laboratorium lapangan efektivitas pengendalian salmonella sp cacing tanah (lumbricus rubellus) ayam broiler evaluasi karakteristik fisik, kimia sensori roti dari tepung komposit beras, ubi kayu, kentang kedelai penambahan xanthan gum analisis penawaran permintaan telur ayam ras sumatera utara mengukur faktor biokonsentrasi azolla microphylla menyerap logam berat timbal (pb) tinjauan yuridis perlindungan hukum konsumen oleh perusahaan mlm produksi air mineral an-organik kemasan (studi lapangan pt. central java daya wiguna) perlindungan hukum bagi konsumen mengalami penarikan paksa kendaraan bermotor oleh pihak ketiga (debt collector) karena kredit macet ditinjau menurut kontrak baku perjanjian pembiayaan konsumen pt. summit oto finance cabang medan visualisasi maket rumah menggunakan teknologi augmentasi brosur perumahan berbasis android perlindungan pers negara sedang berkonflik menurut hukum internasional gambaran pengetahuan, sikap, tindakan anak buah kapal bagian kamar mesin gangguan pendengaran akibat bising kapal tunda pt pelindo i cabang belawan hasil kolonoskopi pasien perdarahan saluran cerna bagian bawah rumah sakit umum pusat haji adam malik medan tahun 2012 pengenalan kata menggunakan self-organizing map sebagai input kamus berbasis android prediksi pendapatan perusahaan menggunakan metode adaptive neuro fuzzy inference system (anfis) prediksi nilai kredit pemilikan rumah menggunakan evolving fuzzy neural network (efunn) penyisipan pesan kedalam file wav menggunakan algoritma echo data hiding (edh) implementasi algoritma winnowing porter stemmer mendeteksi kemiripan dua dokumen berbasis web pengaruh isu politik berkembang saat pemilihan umum presiden wakil presiden tahun 2014 preferensi politik pemilih ( mahasiswa universitas sumatera utara universitas hkbp nomennsen) keanekaragaman jenis pendugaan cadangan karbon tersimpan hutan sekunder tambak desa pulau sembilan, kecamatan pangkalan susu, kabupaten langkat, sumatera utara the influence of brand image on consumer loyalty in the restaurant tip-top bentuk kearifan lokal terkait pemanfaatan hasil hutan sekitar tahura bukit barisan ( desa kuta rakyat, desa dolat rakyat, desa jaranguda, desa tanjung barus, kabupaten karo) dampak anak bekerja prestasi belajar smp jaya krama desa amal bakti kecamatan beringin kabupaten deli serdang tinjauan sosial ekonomi penenun ulos desa lumban siagian jae kecamatan siatas barita kabupaten tapanuli utara peran tidar gerindra meraih suara pemilih pemenangan gus irawan pasaribu pilgubsu 2013 kota medan faktor-faktor penyebab anak putus sekolah kelurahan kwala bekala kecamatan medan johor kota medan tinjauan yuridis pertanggungjawaban atas hilangnya objek jaminan fidusia ( pt. bank) muamalat indonesia, kantor cabang medan-sudirman) aplikasi terapi aktivitas kelompok sosialisasi klien isolasi sosial rumah sakit jiwa prof. muhammad ildrem medan makna sinamot penghargaan keluarga isteri sistem perkawinan suku batak toba ( masyarakat batak toba kristen gereja hkbp gereja kharismatik kecamatan sidikalang, kabupaten dairi) transformasi magnesium hidroksisitrat menjadi metilester hidrksisitrat menggunakan katalis 1,2-dimetil-1,1,2,2-tetrafenilsulfonatodisilana analisis tingkat kesehatan bank menggunakan metode risk-based bank ratting (rbbr) perbaikan rancangan produk menggunakan metode quality function deployment design for manufacturing and assembly simulasi pengaruh tipe gating system karakteristik aliran logam material aluminium a356 menggunakan metode computational fluid dynamics pengaruh orientasi bangunan kenyamanan termal rumah tinggal medan ( komplek perumahan evergreen) analisa pengaruh heat treatment sifat mekanik mikrostruktur material metal matrix composite aluminium – palm oil fly ash menggunakan metode cetrifugal casting implementasi jaringan syaraf metode bidirectional associative memory pengenalan pola wajah studi eksperimental pengaruh type gating system mechanical properties mikrostruktur pengecoran aluminium a356 – sic menggunakan metode stir casting evaluasi pengelolaan hutan rakyat desa matiti, kecamatan dolok sanggul, kabupaten humbang hasundutan hak mewarisi anak perempuan masyarakat angkola sipirok peran kebijakan bisnis meningkatkan kepuasan pelanggan kopi baba, kopi baba jl.dr.mansyur no.47 medan pengetahuan mahasiswa kepaniteraan klinik prosedur pemanfaatan radiografi fakultas kedokteran gigi mahasaraswati denpasar bali pengoptimalan persediaan metode simpleks analisa kajian beton pasca bakar tambahan admixture superplasticizer analisis pengaruh beban karakteristik efisiensi generator arus searah penguatan kompon kumulatif kompon diferensial (aplikasi laboratorium konversi energi listrik ft-usu) aspek hukum penggunaan pesawat militer sebagai pesawat sipil transportasi penduduk sipil ditinjau dari hukum internasional pengaruh kedalaman tanam, nitrogen aplikasi parakuat pertumbuhan eleusine indica l. gaertn resisten- sensitif-parakuat analisis yuridis pendelegasian pemberian izin investasi kepada pemerintah daerah menurut undang- undang nomor 25 tahun 2007 penanaman modal realisasi pengutipan retribusi perparkiran kota medan ditinjau dari perspektif hukum administrasi negara studi eksperimental pengaruh persentase palm oil fly ash ( pofa ) kekerasan mikrostruktur metal matrix composite ( mmc ) menggunakan metode centrifugal casting analisis kinerja jaringan switching banyan perancangan simulasi tata cara pemilihan umum menggunakan adobe flash cs6 animasi pembelajaran pengenalan huruf hijaiyah beserta tajwidnya menggunakan adobe flash cs6 pengaruh persepsi kreativitas inovasi minat beli konsumen grand keude kupie ulee kareng gayo medan the life of lesbian portrayed in sarah waters novel fingersmith pengaruh penggunaan metode akad wadiah mudharabah penghimpunan dana pihak ketiga pt bank bri syariah kc medan pengaruh promosi potongan harga keputusan pembelian kosmetik merek the body shop outlet sun plaza medan tingkat pengetahuan sikap pasien diabetes mellitus tentang diet diabetes mellitus rsup haji adam malik medan 2014 analisa pemakaian air heater peningkatan efisiensi boiler unit 3 pltu pt. pln (persero) sektor belawan faktor risiko mempengaruhi kejadian acne vulgaris siswa/i 3 sma kecamatan medan baru, medan analisis perbandingan abnormal return aktivitas volume perdagangan saham lq-45 sebelum setelah peristiwa politik ( peristiwa pilpres pengumuman pemenang pilres ri 2014) penentuan bobot jenis indeks bias terdapat minyak sereh analisis pengaruh suku bunga, inflasi, capital adequacy ratio, beban operasional pendapatan operasional, non performing financing profitabilitas bank umum syariah indonesia sistem pelayanan nasabah pt. axa financial indonesia cabang medan pengaruh pemberian sari tumbuhan sisal (agave sisalana) pembuatan dadih dari susu kerbau murrah pengaruh periklanan rasional emosional keputusan pembelian produk sunsilk mahasiswa fakultas ekonomi bisnis universitas sumatera utara pengaruh kepemimpinan, komunikasi, disiplin kerja kinerja pegawai badan kepegawaian daerah kota medan analisa faktor-faktor resiko mempengaruhi keterlambatan proyek gedung ( pelaksanaan proyek konstruksi gedung kota medan) prediksi penjualan perusahaan industri menggunakan back propagation perubahan sosial budaya petani sawit tingkat kepuasan ibu nifas pelayanan asuhan kebidanan klinik sahara padangsidimpuan tahun 2015 usulan perancangan fasilitas kerja mengurangi musculoskeletal disorder (msds) stasiun pendempulan cv.super plates analisis feminisme tokoh rie novel the scent of sake karya joyce lebra joyce lebra no shousetsu no “the scent of sake” no feminizumu no bunseki perencanaan kapasitas produksi capacity requirement planning (crp) pt. sinar utama nusantara analisis pusat-pusat pertumbuhan ekonomi kota medan pasar terminal mandiri siosar variasi berat labur perekat urea formaldehida kualitas papan lamina dari batang kelapa sawit pemadatan analisis faktor-faktor mempengaruhi harga teh hitam ptpn iv ( kantor pusat ptpn iv medan) perencanaan rangka atap baja ringan berdasarkan sni 79712013 perencanaan variasi rangka baja jembatan tanjung selamat medan perbandingan perilaku torsi tampang tebal cara analitis program ansys pembuatan hidrogel berbasis selulosa dari tongkol jagung (zea mays l) metode ikat silang pengaruh penerapan good corporate governance kinerja keuangan menggunakan manajemen laba sebagai variabel intervening
( studi perusahaan perbankan terdaftar bursa efek indonesia) mekanisme pengenaan pemungutan pajak parkir dinas pendapatan daerah kota medan dampak penggunaan drop box kepatuhan wajib pajak peranannya upaya peningkatan penerimaan pajak kantor pelayanan pajak pratama medan barat proses pelaksanaan penyitaan lakukan oleh juru sita pajak kantor pelayanan pajak pratama lubuk pakam tata cara pelaporan surat pemberitahuan (spt) tahunan orang pribadi kantor pelayanan pajak pratama medan barat pengaruh penyelesaian keberatan penerimaan pajak kantor pelayanan pajak pratama medan belawan pelaksanaan sosialisasi pelayanan pegawai pajak tingkat kepatuhan wajib pajak orang pribadi memenuhi kewajiban perpajakannya kantor pelayanan pajak (kpp) pratama medan timur mekanisme koping perempuan suku karo mengalami infertilitas kabanjahe kec. kabanjahe kab. karo mekanisme pemungutan bea perolehan hak atas tanah bangunan kaitannya pendaftaran hak atas tanah atau pendaftaran peralihan hak atas tanah oleh badan pertanahan nasional kota binjai asuhan keperawatan ny.s prioritas masalah kebutuhan dasar aman nyaman nyeri kelurahan harjosari ii medan amplas asuhan keperawatan klien masalah kebutuhan dasar gangguan nutrisi kasus diabetes mellitus lingkungan v kelurahan harjosari ii kecamatan medan amplas pengaruh pemberian tawas penjernihan air sungai belawan rancang bangun charger hanphone tenaga induksi pengadaan koleksi perpustakaan institut sains teknologi t.d. pardede (istp) medan rancang bangun charger hanphone tanpa kabel komunikasi positif guru motivasi belajar siswa (studi korelasional antara komunikasi positif guru motivasi belajar siswa smp negeri 29 medan) pengendalian kadar air teh hitam menggunakan statistical quality control pt perkebunan nusantara iv kebun bah butong penggunaan komputer sebagai alat pengolah data sistem informasi akuntansi fakultas ekonomi universitas sumatera utara medan sistem pembelajaran e-learning tingkat sma berbasis moodle hubungan lama penggunaan media sosial facebook penurunan tajam penglihatan mahasiswa/i fakultas kedokteran universitas sumatera utara angkatan 2010 analisa kecacatan perbaikan kualitas tangki air pt sabang subur objek wisata yokohama kajian pemanfaatan biji kopi (arabika) sebagai bahan baku pembuatan metil ester penggunaan gairaigo wago kango teknik-teknik dasar memanah bagi pemula peranan kohesivitas kelompok kecerdasan emosional organizational citizenship behavior pengaruh pengorganisasian pengembangan masyarakat serikat petani indonesia (spi) kondisi sosial ekonomi petani desa mekar jaya kecamatan wampu kabupaten langkat penerapan metode fuzzy tsukamoto menentukan jumlah produk tapioka ( pt.hutahaean, kab.toba samosir) interferensi fonologi bahasa indonesia ke bahasa arab manifestasi sistemik lupus eritematosusterhadapkehilangan tulang kortikalmandibula akibat pemakaian obat kortikosteroid komunitas cinta kupu medan berdasarkan radiografi panoramik “fungsi makna perayaan sembahyang arwah upacara penghormatan leluhur masyarakat tionghoa pematangsiantar” analisis faktor mempengaruhi pelaporan keuangan melalui internet (internet financial reporting) website perusahaan pra rancangan pabrik pembuatan asetaldol dari asetaldehida menggunakan metode alheritiere gobron kapasitas 30.000 ton/tahun analisis struktur, fungsi, makna tari tibet budaya masyarakat tionghoa kota medan pra rancangan pabrik pembuatan bio oil bahan baku tandan kosong kelapa sawit melalui proses pirolisis cepat kapasitas produksi 12.000 ton/tahun analisis potensi sumberdaya pengembangan ternak ruminansia kabupaten bireuen faktor-faktor mempengaruhi munculnya pekerja anak dusun amal bakti desa pasar v kebun kelapa kecamatan beringin kabupaten deli serdang pengaruh kejelasan sasaran anggaran partisipasi anggaran kinerja manajerial karakteristik sistem akuntansi manajemen sebagai variabel moderating (pada direktorat pelabuhan perikanan djpt kementerian kelautan perikanan ri) pengurangan waste meningkatkan kecepatan produksi kualitas produk menggunakan pendekatan lean six sigma bagian produksi perubahan kecembungan jaringan lunak wajah maloklusi skeletal klas ii klas iii sebelum sesudah perawatan pasien klinik ppdgs ortodonti rsgmp fkg usu analisa kuat penerangan ruang kelas lembaga pendidikan ra-mts al mushlihin kota binjai analisis daya dukung pondasi bored pile tunggal diameter 100 cm proyek pembangunan hotel grandhika, medan usulan penerapan metode six sigma kaizen sebagai upaya peningkatan kualitas produk pertumbuhan laju eksploitasi ikan selar (selaroides leptolepis) perairan selat malaka kecamatan beringin kabupaten serdang bedagai sumatera utara pengaruh konsentrasi bubuk bawang putih garam dapur (nacl) mutu tahu selama penyimpanan suhu kamar identifikasi gulma resisten herbisida paraquat lahanjagung kecamatan tigabinanga kabupaten karo determinan pemilihan metode kontrasepsi pasangan usia subur desa pangombusan kecamatan parmaksian kabupaten toba samosir tahun 2014 analisis struktural roman sam kok tiga negara karya luo guan zhong analisa kekuatan impak helm sepeda motor sni akibat pemberian beban impak jatuh bebas simulasi menggunakan software ansys workbench v 12.1 konservasi preservasi bahan pustaka perpustakaan yayasan pendidikan ikal medan perkembangan koleksi perpustakaan politeknik negeri medan prosedur penanganan surat menyurat bank indonesia medan peranan sekretaris kinerja perusahaan pt. perusahaan gas negara (persero) tbk, medan peranan kompetensi sekretaris dekan fakultas ekonomi bisnis universitas sumatera utara fungsi peranan sekretaris mengatur tugas pimpinan pt. bank sumut kantor pusat medan sistem akuntansi pembiayaan gadai emas pt. bank syariah mandiri kantor cabang gajah mada medan penetapan kadar kalium daun segar, jamu, infus daun segar seduhan jamu daun kumis kucing (orthosipon aristatus(blume) miq) secaraspektrofotometriserapan atom analisis cost effectiveness penggunaan antidiabetes berdasarkan paket ina-cbgs pasien diabetes mellitus tipe i rawat inap rumah sakit umum pusat haji adam malik medan analisis perbandingan geometric mean filter operator sobel, operator prewitt operator robert citra bitmap analisis biomassa cadangan karbon bambu belangke (gigantochola pruriens widjaja) hutan tanaman rakyat desa durian serugun, kecamatan sibolangit, kabupaten deli serdang respon peserta luar hubungan kerja pelayanan bpjs ketenagakerjaan kantor cabang medan komunikasi pemasaran produk big-cola coca-cola minat beli konsumen (studi komparatif komunikasi pemasaran produk big-cola coca-cola terahadap minat beli konsumen mahasiswa universitas sumatera utara ) faktor-faktor mempengaruhi penyalahgunaan narkoba remaja kelurahaan aekkanopan timur kecamatan kualuh hulu kabupaten labuhan batu utara analisis literasi informasi siswa homeschooling kak seto medan jews as the victims of fascism as reflected in anne frank’s novel “the diary of young girl” language choice of members of resimen mahasiswa of university of sumatera utara upacara ritual menanda tahun sisada rube masyarakat pakpak kajian makna fungsi tingkat pengetahuan mahasiswa kepaniteraan klinik pencegahan komplikasi lokal penggunaan anestesi lokal departemen bedah mulut fkg usu periode mei 2015 - juni 2015 analisis faktor-faktor mempengaruhi pengungkapan manajemen risiko perusahaan perbankan terdaftar bursa efek indonesia pengaruh partisipasi penganggaran kinerja manajerial dinas pertanian provinsi sumatera utara pengaruh struktur kepemilikan manajerial good corporate governance biaya keageanan perusahaan manufaktur bursa efek indonesia pengaruh substitusi pasir abu vulkanik gunung sinabung karakteristik batako menggunakan metode taguchi fault tree analysis hubungan dampak tingkat kebisingan minat belajar murid sekolah menegah atas negeri 1 medan dampak putusan maffezini interpretasi klausul most-favored nation hal persetujuan (consent) pengajuan penyelesaian sengketa investasi ke international centre for the settlement of investment disputes (icsid) peranan lembaga adat menyelesaikan perkara pidana (studi desa huraba kecamatan siabu kabupaten mandailing natal) formulasi gel dari ekstrak bunga kamboja (plumeria alba) uji efektivitas sebagai anti-aging keragaman makroalga rataan terumbu karang perairan pulau ungge kabupaten tapanuli tengah analisis pengaruh good corporate governance cost of bank loans perusahaan manufaktur terdaftra bei periode 2006-2010 analisis pengaruh ukuran ground plane kinerja antena mikrostrip patch segiempat frekuensi 2.45 ghz analisis pengaruh jatuh tegangan kinerja motor induksi tiga fasa rotor belitan (aplikasi laboratorium konversi energi listrik ft-usu) uji eksperimental turbin kaplan analisa perbandingan variasi jumlah sudu sudut guide vane 45 analisis kebutuhan sumber daya manusia kesehatan menghadapi erupsi gunung sinabung kabupaten karo tahun 2013/2014 simulasi aerodinamis tegangan propeler pesawat tipe airfoil naca m6 melalui analisa komputasi dinamika menggunakan material paduan (94% al-6% mg) analisa unjuk kerja mesin otto efi satu silinder berbahan bakar campuran premium metanol menggunakan supercharger listrik analisis gaya pembuatan badan pesawat tanpa awak dari bahan material komposit diperkuat polyester serat rock wool metode hand lay up analisis usaha pemanfaatan pakan hasil samping ubi kayu klon domba jantan lepas sapih implementasi weighted sum model (wsm) weighted product model (wpm) pemilihan service cloud computing pengaruh perbandingan bubur buah tomat sari ubi jalar oranye konsentrasi kalium sorbat mutu saos pepaya implementasi mikrokontroler atmega 8535 panel surya statis panel surya dinamis berdasarkan waktu menggunakan real time clock (rtc) ds1307 deteksi penyebaran bakteri aeromonas hydrophilla ikan lele dumbo (clarias gariepinus) kecamatan medan tuntungan uji antagonisme jamur endofit dari tanaman padi cercospora oryzae miyake curvularia lunata (wakk) boed. laboratorium perancangan sistem pakar mendiagnosis penyakit anemia menggunakan metode dempster-shafer berbasis android implikasi komponen arus kas rasio keuangan expected return saham perusahaan perbankan terdaftar bei tahun 2012-2013 pengaruh corporate social responsibility nilai perusahaan perusahaan manufaktur terdaftar bursa efek indonesia penerapan metode taguchi analysis metode failure mode and effect analysis (fmea) perbaikan kualitas crumb rubber sir 20 pt asahan crumb rubber analisis pengaruh pendapatan asli daerah (pad), dana perimbangan, sisa lebih pembiayaan anggaran pengalokasian belanja modal kabupaten/kota provinsi sumatera utara periode tahun 2009 - 2013 analisis optimasi profil rangka baja perencanaan bangunan industri hubungan kadar hemoglobin ibu perkembangan bayi 7-12 bulan mendapat asi eksklusif posyandu wilayah kerja puskesmas pancur batu kabupaten deli serdang tahun 2015 kajian performansi mesin diesel stasioner satu silinder menggunakan katalitik konverter sistem dua bahan bakar (dual fuel) solar biogas kandungan metana 60% oppression on women as portrayed in “celia, a slave” and “woman at point zero” a comparative literature analisis usaha pemanfaatan tepung ikan pora-pora (mystacoleucus padangensis)dalam ransum itik porsea umur 0-12 minggu perancangan aplikasi e-commerce penyewaan mobil cv. roswan kamin berbasis web structural decription of bindu n. lohani on the jakarta post newspaper aplikasi game theory menentukan strategi pemasaran optimum ( persaingan minimarket alfamart indomaret) isolasi senyawa flavonoida dari bunga mawar putih (rosa hybrida l.) karakteristik laju pengeringan mesin pengering pakan ternak sistem pompa kalor daya 1 pk analisis usahatani ubi kayu (manihot esculenta) desa marihat bandar, kecamatan bandar kabupaten simalungun eksplorasi tumbuhan obat cagar alam dolok tinggi raja kabupaten simalungun sumatera utara an analysis on my apple students’ ability to use demonstrative pronoun and demonstrative adjective pemanfaatan pengujian sensor water flow kontrol aliran air berbasis mikrokontroler atmega8535 sistem pemasaran paket wisata biro perjalanan wisata bpw pt. trimitra tour and travel sistem pelayanan informasi pt. angkasa pura ii bandar udara internasional kualanamu sistem pelayanan ground handling pt. jas kualanamu internasional airport analisis rugi-rugi lintasan gelombang radio dari luar ke gedung antara sistem gsm1800 3g analisis kinerja enhanced interior gateway routing protocol topologi mesh analisis pergeseran ¼ λ distributed feedback laser dioda (dfb ld) serat optik rancang bangun antena yagi-uda cohen-minkowski frekuensi 433mhz pengaruh jumlah inang chilo sacchariphagus boj. (lepidoptera pyralidae) nisbah kelamin cotesia flavipes cam (hymenoptera braconidae) keturunan dihasilkan laboratorium asas perlakuan sama pelayanan terpadu satu pintu (ptsp) bidang penanaman modal analis kualitas layanan jaringan atm multiprotocol label switching aspek hukum pelaksanaan perjanjian pemborongan bangunan (studi dinas tata ruang bangunan pemko medan) tinjauan kriminologi tindak pidana berhubungan pengguguran kandungan pengalaman keluarga merawat penderita tb paru rumah wilayah kota sibolga aktivitas antioksidan ekstrak etanol daun bangun-bangun (plectranthus amboinicus (lour.) spreng.) etnografi pengusaha sampah (studi tentang usaha pengangkutan sampah komplek perumahan medan sunggal) peranan komunikasi pemasaran promosi penjualan smartphone ( pt.oppo indonesia medan tahun 2014) strategi member mlm pencapaian jenjang karier (studi deskriptif upline mlm oriflame kota medan) ketahanan tanaman terung belanda (solanum betaceum cav) setelah diinduksi sinar uv colletotrichum sp. probabilitas diagnosa keperawatan diagnosa kolaborasi pasien skizofrenia rsj medan analisis pemanfaatan kantor perpustakaan arsip daerah kabupaten tapanuli utara pengaruh profitabilitas, tangibility, ukuran perusahaan, risiko, nondebt tax shield, pertumbuhan perusahaan struktur modal perusahaan manufaktur terdaftar bursa efek indonesia pengaruh pelaksanaan program kesejahteraan karyawan semangat kerja karyawan pt. pln (persero) udiklat tuntungan medan analisis faktor-faktor mempengaruhi keputusan pembelian sepeda motor honda pt aksara honda motor medan pengaruh mutu pelayanan kesehatan kepuasan pasien rawat inap rumah sakit umum daerah tanjung pura tahun 2015 pengaruh faktor peubah motivasi prestasi kerja karyawan pt bank aceh cabang kuta cane analisis beban kerja menggunakan metode nasa-tlx menentukan jumlah karyawan optimal bank bni cabang usu strategi pengembangan bisnis cute butik pasar petisah medan analisis produktivitas menggunakan metode objectivematrix pt karya murni perkasa representasi pemberitaan wanita pelaku kejahatan media massa (analisis karikatur konten berita malinda dee majalah tempo) peramalan penjualan kantong plastik pt. megah plastik menggunakan metode arima box jenkins implementasi program prona (proyek operasi nasional agraria) kabupaten tapanuli utara pengaruh pengaturan tahanan shunt seri putaran efisiensi motor arus searah kompon tinjauan sosial–kelompok masyarakat adat furai desa bawamatalu‘o kecamatan fanayama kabupaten nias selatan perbandingan teknis ekonomis penggunaan penerangan jalan umum solar cell penerangan jalan umum konvensional dampak rehabilitasi sosial rumah tidak layak huni (rs-rtlh) kualitas hidup keluarga miskin kelurahan bandar utama tebing tinggi kota kota tebing tinggi pengaruh program bimbingan keterampilan kemandirian penyandang disabilitas tubuh panti sosial bina daksa “bahagia” sumatera utara kecernaan lemak kasar tdn (total digestible nutrient) ransum mengandung pelepah daun kelapa sawit perlakuan fisik, kimia, biologis kombinasinya domba penerimaan pegawai negeri sipil honorer ditinjau dari hukum administrasi negara (studi pemko medan) perbedaan sudut mp-sn ketebalan dagu mandibula pasien dewasa dirawat klinik ppdgs ortodonsia fkg usu peran media massa membentuk rasionalitas pemilih partisipasi politik masyarakat pemilahan gubernur sumatera utara tahun 2013 ( kecamatan medan johor) pengaruh perendaman basis gigitiruan resin akrilik polimerisasi panas larutan pembersih peroksida alkali perubahan dimensi kekuatan transversal budaya organisasi pemerintahan gampong bireuen meunasah capa utara one tree hill resort hotel arsitektur vernakular hubungan pasien gagal ginjal kronis menjalani hemodialisis sensitivitas pengecapan klinik spesialis ginjal hipertensi rasyida medan tinjauan hukum tentang wanprestasi para pihak perjanjian penggadaian barang perum pegadaian prevalensi gangguan sendi temporomandibula lansia berdasarkan jenis kelamin, kebiasaan buruk, dukungan oklusal penyelesaian kredit macet pt. bpr duta paramarta kecamatan labuhan deli, kabupaten deli serdang dihubungkan undang – undang perbankan pengetahuan sikap orangtua tentang penanganan darurat trauma avulsi gigi permanen anak kecamatan medan amplas medan baru akademi kuliner medan (arsitektur kontekstual) pengaruh stress decreasing resin (sdr) sebagai intermediate layer ketahanan fraktur restorasi klas i (in vitro) perbedaan efek ekstrak jintan hitam candida albicans denture stomatitis candida albicans (atcc® 10231™) pengaruh board composition, management ownership bank size profitabilitaas bank perusahaan perbankan terdaftar bursa efek indonesia tahun 2011-2014 analisis perbandingan profitabilitas, likuiditas leverage sebelum setelah penerapan psak 50/55 perusahaan perbankan terdaftar bursa efek indonesia analisi pengaruh free cash flow kepemilikan saham kebijakan hutang perusahaan manufaktur bei tahun 2011 - 2013 pengaruh laba akuntansi, profitabilitas, economic value added harga saham perusahaan property real estate terdaftar bursa efek indonesia (bei) tahun 2011 - 2013 pengaruh piutang murabahah, mudharabah, musyarakah, non performing financing (npf) return on asset (roa) bank umum syariah indonesia faktor-faktor mempengaruhi penggunaan instrumen derivatif sebagai pengambilan keputusan hedging (studi perusahaan manufaktur terdaftar bursa efek indonesia tahun 2011-2013) penerapan sistem informasi akuntansi penggajian karyawan yayasan sekolah dasar nurul huda medan sistem pengendalian internal gaji upah pegawai dinas pendapatan (dispenda) daerah kota padangsidimpuan penetapan kadar nitrit nitrat air kota medan secara spektrofotometri sinar tampak pengaruh desain, harga kualitas pelayanan kepuasan pelanggan pintu press minimalize mitra global medan penetapan kadar kalsium besi umbi ubi kayu (manihot esculenta crants) secara spektrofotometri serapan atom pengaruh minyak kelapa murni peningkatan stamina mencit (mus musculus) profil penggunaan obat pasien rawat jalan jaminan kesehatan nasional (jkn) rsup h. adam malik periode oktober-desember 2014 pengaruh nilai aset tetap akan dipelihara, belanja modal pendapatan asli daerah anggaran belanja pemeliharaan penyusunan apbd kabupaten/kota provinsi sumtera utara tahun 2102-2014 analisis faktor-faktor mempengaruhi pelaporan keuangan melalui internet (internet financial reporting) perusahaan manufaktur terdaftar dibursa efek indonesia (bei) pemrograman alat pengering kopi otomatis berbasis mikrokontroler atmega 8 sistem informasi kepegawaian kantor camat medan selayang menggunakan microsoft visual basic 6.0 peran tanggung jawab bagian tata graha menjaga kualitas kebersihan area umum grand swiss-belhotel medan the reason for dr. hanibal to kill the 9 people in thomas harris’s novel “the silience of the lambs” the description of plot found in jennifer l. armentrout’s novel obsidian the description of conjunction found in the novel the man in the iron mask the values of jealousy found in f.scott fitzgerald novel the great gatsby peranan strategi pemasaran rumah makan garuda medan penerapan sistem informasi akuntansi aset tetap kantor wilayah direktorat jenderal kekayaan negara sumatera utara. hubungan antara job characteristic work family conflict karyawan sektor perbankan penggunaan beberapa jenis penahan air mendukung pertumbuhan bibit jabon putih (anthocephalus cadamba)pada lahan kritis pendugaan cadangan karbon atas permukaan (above ground biomass) ruang terbuka hijau kota medan variasi ukuran partikel komposisi perekat urea formaldehida - styrofoam kualitas papan partikel dari limbah batang kelapa sawit karakterisasi penyakit daun pembibitan enam klon hibrid turunan eucalyptus grandis x eucalyptus pellita pt. toba pulp lestari tbk. kabupaten toba samosir, sumatera utara faktor-faktor berhubungan partisipasi masyarakat program bank sampah kelurahan binjai kecamatan medan denai kota medan tahun 2013 pengaruh penerapan manajemen keselamatan kesehatan kerja perilaku keselamatan karyawan pt pdsi rantau aceh tamiang tahun 2014 pengaruh karakteristik penduduk kadar kadmium beras kadar kadmium urine penduduk kabupaten musi rawas tahun 2014 pengaruh pelatihan penggunaan alat pelindung diri pengetahuan tindakan penggunaan alat pelindung diri karyawan kilang papan pt hidup baru kota binjai tahun 2014 formulasi uji efek anti-aging dari krim mengandung ekstrak kulit buah delima (punica granatum l) pengaruh konservatisme akuntansi kualitas laba akrual good corporate governance (gcg) sebagai variabel pemoderasi perusahaan manufaktur terdaftar bursa efek indonesia (bei) tahun 2009-2013 peran pelayanan mempengaruhi minat beli konsumen distro akar bumi setia budi medan strategi persaingan bisnis jasa konstruksi kapal ( tentang penerapan strategi bisnis perusahaan konstruksi kapal cv. marine construction belawan) strategi komunikasi politik partai gerindra kampanye pemilu legislatif 2014 interpretasi penonton pluralisme film (analisis resepsi interpretasi penonton pluralisme film evaluasi pelaksanaan program rehabilitasi sosial rumah tidak layak huni jorong kandang melabung nagari lawang mandahiling kecamatan salimpaung kabupaten tanah datar pemanfaatan koleksi perpustakaan sekolah tinggi ilmu pertanian yayasan syekh hamzah fansyuri pengaruh pertumbuhan perusahaan, profitabilitas, firm size, struktur aset kepemilikan manajerial kebijakan struktur modal perspektif pecking order theory perusahaan jasa terdaftar bursa efek indonesia periode 2011-2013 pengaruh penggunaan bahan perekat jumlah candida albicans basis gigitiruan resin akrilik polimerisasi panas pengaruh likuiditas, profitabilitas, pertumbuhan penjualan modal kerja struktur modal perusahaan property real estate terdaftar bursa efek indonesia pengaruh economic value added (eva), market value added (mva), board independent kinerja keuangan perusahaan manufaktur terdaftar bei pengaruh kualitas pelayanan jasa tingkat kepuasan pengguna jasa pengiriman paket pos pt. pos indonesia (persero) kantor pos besar medan pengaruh earning per share, price earning ratio, book value per share, price to book value harga saham perusahaan sub sektor hotel pariwisata terdaftar bei tahun 2009 - 2011 pengaruh kecerdasan emosional, iklim organisasi, kepuasan kerja perilaku etis karyawan perusahaan daerah air minum (pdam) tirta malem kabanjahe kabupaten karo analisis faktor-faktor keberhasilan menjalankan usaha kecil keluarga ( rumah makan ayam penyet jakarta jl dr. mansyur no.45 medan) analisis faktor-faktor mempengaruhi keputusan nasabah memilih asuransi syariah kota medan pengaruh penerapan strategi pemasaran rasional, emosional, spiritual kepuasan loyalitas nasabah pt. bank mandiri syariah cabang medan ahmad yani pengaruh persaingan perbankan suku bunga indonesia pengaruh promosi jabatan lingkungan kerja turnover intention karyawan pt. medan daihatsu analisis dampak kebijakan pembatasan uang muka minimum kredit (down to payment) permintaan mobil kota medan pengaruh sertifikasi, motivasi berprestasi, komitmen kinerja guru smp negeri 3 tanjung morawa pengaruh pengembangan karir desain pekerjaan prestasi kerja pegawai dinas kesehatan provinsi sumatera utara medan analisis potensi ekspor cpo (crude palm oil) sumatera utara pengaruh pelatihan pengembangan karyawan efektivitas kerja karyawan pt duta agung group medan analisisn efektivitas kebijakan moneter pertumbuhan ekonomi indonesia pengaruh brand image, price lifestyle keputusan pembelian iphone mahasiswa kedokteran methodist medan pengaruh variasi perbandingan eceng gondok tempurung kelapa serta variasi kadar perekat tapioka karakteristik briket formulasi krim anti-aging dari konsentrat sari buah stroberi (fragaria x ananassa duchesne ex weston) formulasi uji efek anti-aging dari krim mengandung minyak alpukat (avocado oil) perencanaan perawatan mesin menggunakan metode reliability centered maintenance (rcm) pt. sumatera timberindo industry penetapan kadar etil diklofenak secara spektrofotometri ultraviolet sistem informasi akuntansi atas aset tetap cv mas putih production sistem pengendalian internal aktiva tetap dinas kependudukan catatan sipil kota medan analisis pengendalian intern pemungutan retribusi jasa usaha terminal dinas perhubungan kota medan proses pengadaan barang/jasa pt. pln (persero) wilayah sumatera utara pengaruh pertumbuhan deposito profitabilitas banksumut dikcp marendal sistem informasi akuntansi persediaan pt pertamina (persero) mor i medan tata cara problematika kliring bank indonesia aktivitas ekonomi ibu rumah tangga pemenuhan hak anak desa belang malum kecamatan sidikalang kabupaten dairi strategi urbanis mempertahankan hidup kelurahan cinta damai kecamatan medan helvetia kota medan konstruksi sosial keberadaan keyboard bongkar kampung rotan, kecamatan perbaungan, kabupaten serdang bedagai alih profesi buruh pabrik menjadi tukang becak sebagai upaya meningkatkan penghasilan (studi penarik becak desa sigara gara kecamatan patumbak) pembuatan serbuk libob (lithium bis(oxalato) borate ) sebagai elektrolit baterai lithium variasi temperature pemanasan fungsi izakaya kehidupan masyarakat jepang fenomenajukunen rikon ( perceraian usia tua) masyarakat jepang dewasa ini semantic shifts found in the translated version of rick riordan’s percy jackson & the olympiansthe titan’s curse penderitaan wanita kumpulan cerpen catatan hati seorang istri karya asma nadia analisis psikologi sastra makna verba kakeru novel jepang analisis pengaruh ramalan golongan darah masyarakat jepang kajian organologis gondang boru buatan bapak ridwan aman nasution kekasaran permukaan resin komposit nanohibrid setelah penyikatan pasta gigi mengandung jenis bahan abrasif berbeda pengaruh belanja modal pendapatan asli daerah peningkatan pendapatan per kapita pemerintahan kabupaten/kota provinsi jawa barat tahun 2010-2013 pengaruh motivasi kedisiplinan berorganisasi komitmen anggota kinerja resimen mahasiswa universitas sumatera utara perjanjian pengadaan barang jasa peningkatan jalan kereta api perlanaan – gunung bayu antara satuan kerja pengembangan perkeretaapian sumatera utara pt. wahana adidaya pertiwi pelaksanaan pemberian remisi kepada narapidana militer (studi lembaga pemasyarakatan militer (masmil) kota medan) hak waris anak masyarakat tionghoa pindah ke agama islam kelurahan kuta padang kecamatan johan pahlawan kota meulaboh kabupaten aceh barat faktor-faktor mempengaruhi minat mahasiswa fakultas ekonomi kota medan bekerja bank syariah perancangan alat pengait ergonomis menggunakan metode quality function deplotment pt. rapi arjasa perencanaan pendistribusian produk menggunakan metode distribution resource planning (drp) pt. agri first indonesia analisis karakteristik ornamen masjid raya al -mashun medan kajian performansi mesin diesel stasioner satu silinder menggunakan katalitik konverter sistem dual fuel penetapan penundaan kewajiban pembayaran utang tetap oleh pengadilan niaga terkait adanya kreditor separatis menuurut undang-undang nomor 37 tahun 2004 (studi putusan nomor 134k/pdt. sus-/pkpu/2014) perlindungan hukum bagi kurator tuntutan hukum kreditur pengurusan pemberesan harta pailit pulut kuning; studi etnofood tentang kuliner masyarakat melayu deli kecamatan hamparan perak baliho perilaku politik masyarakat analisis sosiologis tokoh pelaku pembunuhan komik detektif kindaichi karya fumiya sato yozaburo kanari kedudukan hukum hak tanggungan objeknya berstatus hak milik ketiga (studi bank rakyat indonesia persero tbk cabang panyabungan) makna simbolik pemberian ulos upacara perkawinan adat batak toba kajian antropolinguistik peranan orang tua novel ibuk karya iwan setyawan kajian psikologi sastra gambaran kesederhanaan novel ayahku (bukan) pembohong karya tere liye suatu tinjauan psikologi sastra perubahan warna resin akrilik polimerisasi panas setelah perendaman larutan tablet effervescent pembersih gigitiruan analisis perbandingan kinerja keuangan asuransi syariah konvensional terdaftar bursa efek indonesia pengaruh nilai penerbitan rating obligasi syariah return perusahaan penerbit indonesia pengaruh distress risk,firm size, book to market ratio terhadapreturn saham perusahaan manufaktur terdaftar bursa efek indonesia periode tahun 2010 – 2014 kajian total productive maintenance pembangkit listrik tenaga gas uap blok i st 1.0 sicanang belawan metode overall equipment effectiveness studi tentang pengukuran parameter trafo distribusi menggunakan emt (electrical measurement & data transmit) uji jenis dekomposer pembuatan kompos dari limbah pelepah kelapa sawit mutu kompos dihasilkan perancangan pembuatan mixer kapasitas 6,9 liter putaran 280 rpm rancang bangun mesin pemeras santan sistem screw press perancangan konstruksi insulation materialpada elemen pemanas mesin mixer kapasitas 6,9 liter putaran 280 rpm studi kenyamanan pengguna ruang terbuka hijau publik rumah susun sukaramai medan pemanfaatan tongkol jagung limbah teh sebagai bahan briket arang efektivitas penyuluhan metode ceramah media laflet perilaku penderita diabetes mellitus klinik rsud dr. djasamen saragih pematangsiantar tahun 2014 kajian mutu fisikokimia sensori es lilin dari campuran sari buah nenas wortel penambahan gelatin pengaruh perbandingan sari labu siam sari jambu biji merah konsentrasi karagenan mutu jelly drink analisis kelayakan finansial usaha penggilingan padi kecil ( kecamatan tanjung morawa, kabupaten deli serdang, provinsi sumatera utara) faktor-faktor mempengaruhi konsumen pembelian minyak goreng curah kemasan pasar tradisional ( pasar medan super market kec. medan kota) faktor-faktor memengaruhi kejadian anemia eks penderita kusta upt rumah sakit kusta hutasalem kecamatan laguboti kabupaten toba samosir perbanyakan phragmatoecia castaneae (lepidoptera cossidae) pakan buatan sah tidaknya penetapan status tersangka oleh komisi pemberantasan korupsi (kpk) diajukan sebagai alasan pra peradilan ditinjau dari hukum acara pidana indonesia (studi putusan nomor 04/pid.prap/2015/pn.jkt.sel – pra peradilan budi gunawan) kedudukan jaminan fidusia suatu perjanjian kredit kaitannya peran notaris pembuatan akta pemberian jaminan fidusia. (studi notaris medan) tinjauan yuridis pengelolaan pewakafan tanah masyarakat tionghoa kota medan pengaruh sosial budaya pola makan kejadian hipertensi masyarakat suku alas wilayah kerja puskesmas perawatan kutambaru kabupaten aceh tenggara asuhan keperawatan aplikasi mileu therapy klien masalah self perception ruang sipiso-piso rumah sakit jiwa prof. m. ildrem medan pengaruh komisaris independen, komite audit, kepemilikan institusional manajemen laba perusahaan otomotif terdaftar bursa efek indonesia pengaruh ukuran perusahaan, profitabilitas,dan nilai perusahaan corporate social responsibility dengangood corporate governance sebagai variabel pemoderasi perusahaan perbankan terdaftar bursa efek indonesia analisis pengaruh struktur aset, modal kerja, pertumbuhan aktiva, risiko, likuiditas, ukuran perusahaan, profitabilitas struktur modal perusahaan perbankan terdaftar bursa efek indonesia faktor-faktor mempengaruhi risiko hiv/aids kelompok waria klinik infeksi menular seksual (ims) bestari kota medan tahun 2014 studi pemanfaatan gelombang pasang surut sebagai energi pembangkit listrik alternatif prediksi alur perkerasan lentur jalan raya metode bina marga nomor 02/m/bm/2013 menggunakan program kenpave evaluasi kinerja operasi pemeliharaan sistem irigasi medan krio kecamatan sunggal kabupaten deli serdang tinjauan pelanggaran ham prinsip kedaulatan impunity dilihat hukum internasional negara ukraina kajian potensi produksi padi daerah irigasi sungai ular kecamatan pegajahan kabupaten serdang bedagai aspek hukum pemberian kredit jaminan hak milik pihak ketiga (studi bank sumut cabang sei sikambing medan) rancang bangun alat penyuling minyak atsiri (tipe uap langsung) analisis koefisien rembesan saluran irigasi tanah andepts skala laboratorium pengembangan produk bakso kedelai (soyballs) penambahan gluten serta pati dari ubi kayu, ubi jalar, jagung kentang analisis faktor-faktor mempengaruhi preferensi konsumen kedai kopi kota medan pertumbuhan laju eksploitasi udang kelong (penaeus merguiensis) perairan kabupaten langkat, sumatera utara. tindak pidana pembunuhan biasa bentuk pokok berdasarkan kitab undang-undang hukum pidana (kuhp) hukum pidana islam hapusnya pertanggungjawaban pelaku usaha jasa kerugian dialami oleh konsumen ( putusan ma no 769/k/pdt.sus/2011) perlindungan hukum perusahaan asuransi perusahaan reasuransi dicabut izin usahanya hubungaan hukum kustodian emiten pasar modal treatment of blount disease using illizarov ; simple and effective technique a case series tanggung jawab hukum perdata media cetak menyelesaikan sengketa akibat memuat berita salah (riset pt. harian waspada medan) peranan amnion liofilisasi steril sebagai scaffold tatalaksana fraktur defek tulang sebuah studi eksperimental tikus putih sprague dawley (rattus novergicus) pelaksanaan perjanjian pemborongan pekerjaan antara pt.pln (persero) cv.carmel hal penyeimbangan beban trafo (studi pt.pln (persero) area payakumbuh) aspek hukum pembebanan jaminan fidusia antara perusahaan pembiayaan nasabah (studi pt. dipo star finance cabang medan) penatalaksanaan fraktur femur malunion implant failure (femoral nail) perlindungan hukum bagi nasabah perjanjian kredit objeknya jaminan perorangan (studi pt. bank mandiri syariah, kantor cabang pembantu kesawaan) implementasi prinsip transparansi oleh perusahaan jasa penilai terkait penawaran saham perdana karakteristik penderita demam berdarah dengue dirawat inap bagian penyakit rsup h. adam malik tahun 2012 uji toksisitas akut ekstrak etanol bunga pepaya jantan (carica papaya l.) mencit jantan aplikasi visualisasi suara jantung manusia platform android peran istri bekerja sektor formal pengambilan keputusan keluarga karakterisasi uji efek ekstrak etanol teripang jenis pearsonothuria graeffei (semper) penurunan kadar glukosa darah mencit diinduksi aloksan analisis penggunaan teknik post processing volume rendering (vr) ct angiografi arteri abdominalis msct analisa pembobotan sagital short time inversion recovery (stir) parameter axial multi block pemeriksaan lumbal analisis kualitas citra radiografi menggunakan variasi rasio grid konstruksi grid analisi dosis radiasi aplikasi ruangan icu evaluasi pengelolaan arsip dinamis kantor asuransi bumiputera cabang tanjung balai pengaruh pertumbuhan penjualan, likuiditas, profitabilitas, working capital struktur modal perusahaan otomotif komponen terdaftar bursa efek indonesia (bei) tahun 2010-2013 pengaruh struktur kepemilikan, return on asset, leverage kebijakan dividen asuhan keperawatan ny. a prioritas masalah kebutuhan dasarmobilisasi kelurahan harjosari ii lingkungan xiii kecamatan medan amplas asuhan keperawatan tn.ah prioritas masalah gangguan mobilitas kelurahan harjosari ii kecamatan medan amplas asuhan keperawtan pasien prioritas masalah kebutuhan dasar nutrisi lingkungan vii kelurahan harjosari ii kecamatan medan amplas asuhan keperawatan ny. s prioritas masalah kebutuhan dasar nutrisi bajak iv barat kel. harjosari ii kec. medan amplas asuhan keperawatan tn. r prioritas masalah kebutuhan dasar nutrisi kurang dari kebutuhan tubuh lingkungan v kelurahan harjosari ii kecamatan medan amplas asuhan keperawatan tn. d prioritas masalah kebutuhan dasar istirahat tidur jalan bajak iv kelurahan harjosari ii kecamatan medan amplas dimsum sebagai menu unggulan jade restaurant jw marriott hotel medan tata cara melayani tamu kedaton restoran hotel novotel yogyakarta proses ground handling citilink indonesia oleh pt. gapura angkasa bandara hang nadim batam tinjauan penerapan anggaran beban operasional pt kharisma pemasaran bersama nusantara cabang medan perancangan pembuatan alat pengukur momen puntir motor bakar penetapan kadar campuran deksametason deksklorfeniramin maleat metode spektrofotometri derivatif pemikiran politik thomas hobbes konsep presidensial indonesia berdasarkan uud 1945 sebelum amandemen analisis buku nyanyi sunyi seorang bisu karya pramoedya ananta toer tentang pelanggaran ham politik identitas etnis indonesia suatu studi politik identitas etnis tionghoa kota medan strategi petani padi mengatasi masalah pertanian desa bandar dolok kec. pagar merbau kab. deli serdang studi deskriptif kualitatif mengenai akulturasi pekerja tiongkok pltu tanjung pasir kecamatan pangkalan susu implementasi program nasional pemberdayaan masyarakat (pnpm) mandiri perkotaan desa dolok hataran kecamatan siantar kabupaten simalungun strategi iklantelkomsel 4g lte minat beli pelanggan. (studi korelasional tentang strategi iklan telkomsel 4g lte minat beli pelanggan kalangan mahasiswa fisip usu ) hubungan patron klien antara petani sawit lahan gambut buruh tani desa rokan baru kecamatan pekaitan kabupaten rokan hilir gerakan sosial hippma ( himpunan pensiunan perkebunan maju bersama) memperjuangkan hak-hak pensiunan buruh ptpn ii (studi deskriptif desa tanjung sari, kecamatan batang kuis, kabupaten deli serdang) hubungan patron klien antara pemilik lahan buruh tani (studi desa sipangan bolon kecamatan girsang sipangan bolon kabupaten simalungun) pengendalian persediaan bahan baku metode economic order quantity (eoq) ( pt. pabrik es siantar) perancangan sistem akuisisi data pengukuran kecepatan angin, suhu, kelembapan udara jarak jauh. analisis ketersediaan koleksi buku perpustakaan universitas sumatera utara berdasarkan daftar bacaan silabus program studi akuntansi perancangan penelusuran literatur menggunakan metode belajar aktif bagi mahasiswa kedokteran universitas hkbp nommensen a comparative translation technique analysis of two indonesian subtitles “life of pi” movie pengaruh manajemen laba, ukuran perusahan, leverage terhdap earning per share reputasi auditor sebagai variabel moderasi perusahaan perbankan terdaftar bei 2012-2014 pengaruh sistem rekrutmen imbalan kualitas kerja karyawan outsourcing pt. bank mandiri ( persero ) kantor cabang kantor cabang pembantu medan pengaruh substitusi pasir abu vulkanik gunung sinabung karakteristik batako menggunakan metode taguchi fault tree analysis pengaruh faktor sosial ekonomi produktivitas tenaga kerja industri kecil tahu ( kecamatan medan deli) kesadaran hukum masyarakat mempengaruhi upaya peningkatan pendaftaran tanah kota gunung sitoli evaluasi penggunaan obat antihipertensi pasien hipertensi empat puskesmas kota medan analisis jejaring sosial gereja methodis indonesia gmi resort sei bahar kabupaten muaro jambi, jambi grammatical errors found in student of english department’s essay studi potensi sungai padang pembangkit listrik tenaga mini hidro kecamatan sipispis kabupaten serdang bedagai provinsi sumatera utara tugas akhir studi eksperimental pengaruh type gating system mechanical properties mikrostruktur pengecoran aluminium a356 – sic menggunakan metode stir casting perlindungan hukum penggunaan foto selfie oleh pihak lain jejaring sosial undang-undang nomor 28 tahun 2014 efek sitotoksik ekstrak etanol daun afrika (vernonia amygdalina del.) sel hela sel vero peran tuan guru babussalam pilpres 2014 kabupaten langkat pemanfaatan arang aktif sekam padi (oriza sativa) sebagai adsorben peningkatan kualitas minyak goreng bekas tindak tutur bahasa melayu tanjung balai pengukuran human capital karyawan menggunakan metode return on investment pt. karya murni perkasa pengetahuan ibu hamil tentang faktor risiko diabetes kehamilan rumah bersalin hadijah medan tahun 2015 gambaran kecemasan suami menghadapi istri bersalin normal primigravida rumah sakit bersalin sundari medan tahun 2015 hubungan motivasi belajar prestasi belajar mahasiswa kebidanan semester iii stikes medistra lubuk pakam faktor- faktor resiko terjadinya kanker serviks rsup adam malik medan 2014 gambaran pengetahuan ibu paritas tentang preeklamsia rsud dr. pirngadi medan tahun 2015 hubungan dukungan keluarga kepatuhan ibu kunjungan kehamilan klinik bersalin niar kecamatan patumbak kabupaten deli serdang tahun 2015 faktor-faktor mempengaruhi ibu memilih kb suntik 3 bulan dmpa klinik hj. rukni medan johor tahun 2015 tingkat pengetahuan remaja putri tentang pemeriksaan patudara sendiri (sadari) siswi kelas ii sma negeri 9 medan analisis komponen senyawa kimia uji aktivitas antibakteri minyak atsiri daun zodia (euodia hortensis j.r & g. forst) penentuan nilai noise berdasarkan slice thickness citra ct scan pengaruh komisaris independen, profitabilitas, tingkat hutang, intensitas aset tetap intensitas persediaan effective tax rate perusahaan manufaktur terdaftar bursa efek indonesia asuhan keperawatan pada pasien prioritas masalah pemenuhan kebutuhan personal hygiene rumah sakit jiwa prof. muhammad ildrem pemerintah sumatera utara asuhan keperawatan an. d prioritas masalah kebutuhan dasar oksigenisasi lingkungan ix kelurahan harjosari ii kecamatan medan amplas identifikasi boraks formalin mie kuning beredar pasaran secara kualitatif rtc (real time clock) ds1307 sebagai pengatur waktu sistem traffic light adaptif fungsi peran sekretaris mempelancar tugas pimpinan pt.pln (persero) pembangkitan sumatera bagian utara peranan sekretaris mengelola, menyusun menyimpan arsip bagian program dinas perhubungan provinsi sumatera utara sistem akuntansi persediaan pdam tirtanadi cabang sunggal sistem akuntansi penggajian pegawai pt. perkebunan nusantara iii (persero) medan aplikasi spline truncated regresi nonparametrik pengaruh kemampuan kerja motivasi kerja kinerja pegawai bagian akademik fakultas ekonomi bisnis universitas sumatera utara gambaran tingkat demensia aktivitas sehari-hari lansia desa batukarang kec payung kab karo komunikasi persuasif hakim pengadilan agama memediasi masalah perceraian ( komunikasi persuasif hakim pengadilan agama memediasi masalah perceraian) hubungan pengelolaan kearsipan pengambilan keputusan kantor dinas pendidikan kebudayaan kabupaten tapanuli utara kinerja badan pemberdayaan perempuan keluarga berencana implementasi pengarusutamaan gender kota medan kualitas pelayanan rawat inap oleh badan penyelenggara jaminan sosial (bpjs) kesehatan rumah sakit umum pusat h. adam malik medan gangguan identitas disosiatif tokoh utama novel khokkiri karya lia indra andriana analisis psikosastra pengaruh perendaman cetakan alginat larutan sodium hipoklorit 0,5% glutaraldehid 2% jumlah koloni bakteri analisis pengaruh efesiensi operasi, resiko kredit, resiko pasar, modal kinerja bank asing indonesia (2008 – 2013) analisis pengaruh efesiensi operasi, resiko kredit, resiko pasar, modal kinerja bank asing indonesia (2008 – 2013) pengaruh ukuran perusahaan, karakteristik audit jenis opini audit biaya audit perusahaan manufaktur terdaftar bursa efek indonesia periode 2011-2014 pengaruh economic value added (eva), market value added (mva), profitabilitas, kebijakan dividen harga saham perusahaan property real estate bursa efek indonesia 2012-2014 tinjauan yuridis mengenai status kewarganegaraan etnis rohingya myanmar berdasarkan convention relating to the status of stateless persons 1954 kajian hukum pidana pertambangan emas tanpa izin kecamatan hutabargot kabupaten mandailing natal peran indonesia pengelolaan konservasi sumber daya ikan beruaya jauh setelah ratifikasi konvensi western and central pasific fisheries commission (wcpfc) perbandingan hukum asuransi jiwa konvensional syariah islam (studi pt. prudential life assurance medan) tanggungjawab kreditur (bank) mengembalikan piutang jaminan fidusia (studi bank perkreditan rakyat mitra dana madani medan) analisis rasio keuangan pt. perkebunan iii medan senam nifas pelaksanaan asuhan keperawatan ibu nifas ruang tanjung ii rsud dr. pirngadi medan pengaruh kualitas pelayanan kepuasan konsumen loyalitas pelanggan (studi pt. lion mentari airlines bandara kualanamu internasional, medan) reinkarnasi mitos legenda china eksistensi pachinko kehidupan masyarakat jepang pengaruh kelompok referensi, gaya hidup keputusan penggunaan jasa warung internet kawasan jl. dr. mansyur padang bulan, medan ( mahasiswa universitas sumatera utara) analisis tingkat kesejahteraan petani kopi kabupaten dairi respons pertumbuhan produksi tanaman kedelai varietas detam 1 pemberian vermikompos pupuk p peranan polisi menanggulangan tindak pidana pencurian kelapa sawit (studi polsek sosa kabupaten padang lawas) pesan moral novel habibie & ainun karya bacharuddin jusuf habibie tinjauan sosiologi sastra analisis faktor- faktor mempengaruhi dividend payout ratio perusahaan manufaktur terdaftar bursa efek indonesia respons pertumbuhan produksi tanaman selada(lactuca satival.)terhadap pemberian pupuk cair organik urin kambing beberapa jarak tanam penanganan minuman campuran meningkatkan kunjungaan tamu lobby lounge jw marriott hotel medan gerakan sosial pemberhentian penebangan hutan ( tentang gerakan sosial pemberhentian penebangan hutan tele desa hariara pintu, kecamatan harian, kabupaten samosir) pengaruh sosial ekonomi keluarga korban kekerasan seksual anak dampingan yayasan pusaka indonesia skrining fitokimia uji aktivitas antibakteri ekstrak etanol daun nipah (nypa fruticans wurmb) staphylococcus aureus escherichia coli optimalisasi penjadwalan proyek menggunakan fuzzy critical path method (fuzzy cpm) berdasarkan metric distance rank bilangan fuzzy pengaruh ekstrak etanol kulit buah nanas (ananas comosus (l.) merr.) glukosa darah kadar superoksida dismutase (sod) mencit hiperglikemia secara in vivo scrambling index dari graf primitif terdiri atas dua lingkaran metode branch and bound pengoptimalan jumlah truk pengangkut sampah ( dinas kebersihan pertamanan kota padang) metode lexicographic masalah transportasi perancangan pengaturan time delay lampu lalu lintas menggunakan adaptif kontrol berbasis mikrokontroler atmega8535 tata cara penagihan hutang pajak surat paksa kepada wajib pajak kantor pelayanan pajak pratama medan belawan imobilisasi sel saccharomyces cerevisiae menggunakan alginat- kitosan uji stabilitasnya produksi etanol dari molase secara fermentasi batch identifikasi senyawa obat piroksikam sediaanpadatobattradisionaldengan metode kromatografi lapis tipis (klt) spektrofotometri uv isolasi senyawa flavonoida dari kulit buah rambutan (nephellium lappaceum l.) hak restitusi sebagai bentuk perlindungang korban tindak pidana perdagangan orang ( nomor 1554/pid.b/2012/pn.mdn) sistem pengendali line follower pengangkat barang studi pemanfaatan kalsium oksida (cao) dari serbuk cangkang keong mas (pomacea canaliculata l.) sebagai adsorben ion kadmium (cd2+) pembuatan alat ukur telemetri curah hujan tipe tipping bucket menggunakan sensor reed switch mikrokontroler atmega8535 berbasis android tinjauan tentang kinerja pramuwisata pt. mutiara holidays tour and travel medan keberadaan fungsi alat musik tradisional gu zheng bagi masyarakat tionghoa kota medan the description of punjabi people marriage filosofi olahraga kendo analisis permintaan masyarakat produk perbankan syariah ( bank muamalat kecamatan medan marelan) the bling ring frustration written in nancy novel analisis fungsi makna nomina shourai mirai kalimat bahasa jepang pengaruh kepemimpinan iklim komunikasi organisasi kinerja karyawan pt. waruna nusa sentana peranan sistem informasi akuntansi gaji upah pegawai kantor wilayah direktorat jenderal kekayaan negara sumatera utara sistem pengawasaninternal gaji upah dinas pemberdayaan masyarakat pemerintahan desa kabupaten labuhanbatu utara hubungan pengetahuan sikap bidan tentang inisiasi menyusui dini diwilayah kerja puskesmas pancur batu kabupaten deli serdang tahun 2015 an analysis of code mixing found in ahmad fuadi’s novel “rantau 1 muara" hubungan kadar hemoglobin ibu pertumbuhan bayi 7-12 bulan posyandu wilayah kerja puskesmas pancur batu kabupaten deli serdang tahun 2015 a contrastive analysis between english and muko-muko language question words geografi dialek bahasa batak toba kabupaten humbang hasundutan efektivitas berkumur ekstrak daun neem penurunan jumlah bakteri mahasiswa fakultas kedokteran gigi usu medan penggunaan teknik paralleling penilaian resorpsi akar pasien pemakai piranti ortodonti cekat pengetahuan mahasiswa kepaniteraan klinik tentang anatomi normal rongga mulut rahang atas tinjau dari radiografi panoramik salah satu fakultas kedokteran gigi denpasar bali sistem pengendalian internal kas rumah sakit umum haji medan pengaruh komponen fisik rumah susun, sanitasi lingkungan perilaku kejadian penyakit skabies rumah susun sederhana sewa kota medan tahun 2015 studi komparatif sistem pengembangan sapi bali luar kawasan peternakan terpadu kecamatan linge kabupaten aceh tengah pengaruh pengalaman pasien rujukan puskesmas kebun lada kota binjai pembuatan evaluasi sediaan gastroretentif metronidazol dari film alginat-kitosan ditambahkan hpmc sistem pengawasan internal kas cv. satu nusa uji aktivitas antikanker ekstrak etanol buah andaliman (zanthoxylum acanthopodium dc.) sel kanker serviks sentiment analysis teks bahasa indonesia menggunakan support vector machine (svm) k-nearest neighbor (k-nn) analisis kandungan kromium, mangan zink buah kelor (moringa oleifera lam.) secara spektrofotometri serapan atom sistem pakar diagnosa kanker payudara menggunakan metode certainty factor berbasis android analisa kandungan merkuri (hg) sediaan krim malam ada klinik kecantikan dijual bebas kota medan tahun 2015 pengaruh budaya organisasi efektvitas kerja guru smp negeri 3 batang angkola, hurase faktor-faktor mempengaruhi resiko kredit perbankan indonesia ( sepuluh peringkat bank terbaik versi bank indonesia 2012) analisis perancangan sistem informasi arsip pt. qton indonesia menggunakan visual basic analisis faktor-faktor mempengaruhi profitabilitas bank konvensional terdaftar bursa efek indonesia pengaruh kinerja keuangan nilai perusahaan good corporate governance sebagai variable permoderasi perusahaan property real estate terdaftar bursa efek indonesia periode 2010-2013 analisis rasio keuangan pertumbuhan laba industri textile go public bei (periode 2008-2012) analisis pengaruh kepemilikan institusional, kepemilikan manajerial, dewan komisaris independen, leverage, komite audit perusahaan perbankan terdaftar bei faktor-faktor mempengaruhi kemampuan menghasilkan laba perusahaan tekstil garment terdaftar bei tahun 2009-2011 , studi empiris bei perbandingan kinerja keuangan bank syariah bank konvensional berdasarkan laporan keuangan perbankan 2011-2014 menggunakan metode camel pengukuran loyalitas pelanggan produk-produk top brand indonesia metode net promoter score pengaruh karakteristik komite audit, capital adequacy ratio, ukuran perusahaan, leverage, reputasi auditor manajemen laba perusahaan perbankan terdaftar bei tahun 2010 – 2013 analisis strategi pemasaran menentukan keputusan pembelian produk jasa hotel hotel inna dharma deli medan analisis pengaruh pemasaran dari mulut ke mulut (word of mouth marketing) persepsi kualitas (perceived quality) keputusan pembelian produk oriflame mahasiswa s-1 reguler fakultas ekonomi bisnis universitas sumatera utara analisis kinerja sektor usahatani padi sawah melalui pendekatan agribisnis aplikasi model data envelopment analysis (dea) provinsi sumatera utara pengaruh kinerja keuangan nilai perusahaan good corporate governance sebagai variabel moderasi perusahaan industri barang konsumsi terdaftar bursa efek indonesia 2011-2013 analisis pertumbuhan ekonomi indeks pembangunan manusia (ipm) provinsi-provinsi indonesia (metode kointegrasi) pengaruh audit tenure, independensi auditor, rasio hutang, pertumbuhan penjualan manajemen laba discretionary accruals perusahaan property real estate terdaftar bursa efek indonesia analisis kausalitas antara indeks pembangunan manusia (ipm) kemiskinan provinsi-provinsi indonesia pengaruh ukuran perusahaan, komisaris independen, komite audit, kualitas audit, leverage profitabilitas praktik manajemen laba perusahaan manufaktur terdaftar bei tahun 2010-2013 analisis persepsi pengusaha iklim usaha kota medan analisis kerambah jaring apung danau toba keadaan tingkat pendapatan masyarakat analisis penerapan penuh peraturan pemerintah nomor 71 tahun 2010 tentang standar akuntansi pemerintah (sap) berbasis akrual (kasus pemerintah kota medan) penetapan kadar besi, seng, tembaga mangan kangkung desa semangat gunung alat inductively coupled plasma (icp) uji klinis pendahuluan pengaruh pemberian kapsul kombinasi ekstrak herba sambiloto (andrographis paniculata (burm.f.) nees) daun salam (syzygium polyanthum (wight) walp.) kadar alt ast pasien dislipidemia uji efek antihiperurisemia ekstrak etanol daun pegagan (centella asiatica (l.) urb.) mencit jantan penggunaan pati talas (colocasia esculenta (l.) schott) sebagai disintegran pembuatan beberapa jenis tablet secara cetak langsung granulasi basah pengaruh suhu hidrolisis pembuatan dekstrin dari pati kentang (solanum tuberosum l.) secara enzimatis prevalensi maloklusi anak autis slb, yayasan terapi, anak normal sekolah umum kota medan uji aktivitas antibakteri ekstrak n-heksana, etil asetat etanol teripang(holothuria scabra jaeger) staphylococcus aureus pseudomonas aeruginosa analisis kualitas pohon beberapa jalur hijau kota pematangsiantar tingkat kesukaan masyarakat teh daun gaharu (a malaccensis lamk.) dibandingkan teh lain beredar dipasaran analisis swot menentukan strategi pemasaran d’satz event organizer pengaruh kualitas pelayanan kepuasan pelanggan cv. satu nusa efektifitas penggunaan humor iklan (studi deskriptif kuantitaif efektifitas penggunaan humor iklan djarum 76 minat menonton iklan mahasiswa departemen ilmu komunikasi fisip usu) analisis rasio keuangan pt. pos indonesia (persero) medan 20000 analisis rasio keuangan pt kimia farma (persero) tbk isolasi identifikasi senyawa steroid/triterpenoid dari sponge suberites diversicolor becking & lim uji efek antihiperglikemia ekstrak etanol daun nipah (nypa fruticans wurmb.) mencit diinduksi aloksan tingkat kepuasan pasien rawat jalan peserta bpjs kesehatan pelayanan kefarmasian rumah sakit umum pusat h. adam malik medan sistem pelayanan wajib pajak seksi pelayanan kantor pelayanan pajak pratama medan timur analisis kandungan mineral kalsium magnesium musim hujan bulan desember musim kemarau bulan maret beberapa air minum pdam tirtanadi kota medan uji aktivitas antioksidan minyak serat mesokarp buah kalapa sawit (elaeis guineensis jacq) rancang bangun alat ukur tingkat kerusakan oli mesin berdasarkan konstanta dielektrik berbasis pc kajian teoritis gejala indeks bias negatif material fenomena enjo-kosai jepang dewasa ini a morphemic analysis of loanwords from english vocabularies in kompas selected columns pengaruh peranan audit internal pencegahan pendeteksian kecurangan pt bank sumut kantor cabang medan pengaruh kompetensi sumber daya manusia budaya kerja mewujudkan good governance inspektorat kabupaten labuhanbatu utara pengaruh slogan “good food, good life”, harga, kualitas produk pt. nestle indonesia minat beli konsumen medan ( kecamatan medan helvetia) pengaruh slogan “good food, good life”, harga, kualitas produk pt. nestle indonesia minat beli konsumen medan ( kecamatan medan helvetia) peranan total quality management sebagai alat mempertahankan pangsa pasar ekspor meubel pt japaris pratama studi aplikasi metode dynamic programming perencanaan jumlah produksi persediaan optimum pt. serdang jaya perdana pengembangan model pita ukur rumus pendugaan bobot badan berdasarkan lingkar ternak kambing analisis faktor-faktor mempengaruhi permintaan penawaraan telur ayam ras kota medan provinsi ( pasar petisah, kecamatan medan petisah) analisis harga jual bibit melalui penetapan harga pokok produksi bibit kol (brassica oleracea cv. capitata) ( pt. horti jaya lestari kebun smik kabupaten karo) hubungan dukungan suami ibu hamil kunjungan antenatal care rumah bersalin hadijah medan tahun 2015 pengaruh seleksi penempatan produktivitas kerja karyawan central asia tbk kantor cabang utama medan pengaruh motivasi kinerja karyawan bagian fungsional kantor pelayanan pajak (kpp) pratama lubuk pakam sistem akuntansi penerimaan pengeluaran kas badan perencanaan pembangunan daerah provinsi sumatera utara analisa performansi ac split penambahan alat penukar kalor tipe selongsong pipa isap pipa tekan prosedur tata cara pengajuan restitusi pembayaran pajak pertambahan nilai (ppn) kantor pelayanan pajak (kpp) pratama medan timur studi eksperimental kinerja ac split satu pk memanfaatkan air kondensasi buangan evaporator sebagai pendingin kondensor uji aktivitas antibakteri ekstrak etanol daun binara ekstrak etanol daun ulam-ulam bakteri staphylococcus aureus escherichia coli analisa waktu simpan air kinerja ac split 1 pk alat penukar kalor tipe serpentine kajian peresepan antibiotik pasien pediatrik rawat jalan rsud deli serdang lubuk pakam periode september 2014 – desember 2014 sejarah kesehatan kuli kontrak perkebunan senembah maatschappij 1882-1942 phonological process of two year old child in acquiring indonesian phoneme pengaruh earnings per share (eps),return on equity (roe),dan sizeterhadap cash dividend perusahaan perbankan terdaftar bursa efek indonesia perspektif agency theory evaluasi mekanistik desain perkerasan lentur bina marga nomor 02/m/bm/2013 pembebanan modulus lapisan pelukisan karakter tokoh utama novel cinta brontosaurus karya raditya dika pengaruh ukuran partikel komposisi semen-partikel kualitas papan semen dari cangkang kemiri (aleurites moluccana wild) persepsi petani kemitraan gapoktan tani maju pd rama putra pengaruh pengeluaran pemerintah, investasi angkatan kerja pertumbuhan ekonomi kabupaten dairi potensi pemanfaatan aren (arenga pinnata) desa kutambaru, kecamatan munthe, kabupaten karo pengaruh ukuran pelupuh (zephyr) buku bambu (node) kualitas laminasi bambu betung (dendrocalamus asper) uji toksisitas subkronik ekstrak etanol daun kedongdong pagar (lannea coromandelica (houtt.) merr)pada organ hati mencit jantan identifikasi dampak pendapatan masyarakat penggunaan hutan mangrove berbasis silvofishery kecamatan hamparan perak, kabupaten deli serdang faktor-faktor penggunaan narkoba penghuni lembaga pemasyarakatan lembaga pemasyarakatan kelas iia rantauprapat tahun 2013 hubungan pengetahuan perilaku hidup bersih sehat(phbs) kejadian diare balita desa marindal kecamatan patumbak kabupaten deli serdang determinan pernikahan dini suku jawa desa pematang johar kecamatan labuhan deli tahun 2013 penentuan jumlah produksi optimal minuman teh menggunakan metode fuzzy sugeno metode fuzzy tsukamoto ( pt.sinar sosro tanjung morawa) hubungan karakteristik pengetahuan sikap ibu rumah tangga pedagang penggunaan kantong plastik pasar tradisional firdaus kecamatan medan tembung tahun 2014 analisis pengaruh luas wilayah, kepadatan penduduk, tingkat pengangguran tingkat pendidikan jumlah penduduk miskin provinsi sumatera utara tahun 2013 analisis pelaksanaan program pos pembinaan terpadu penyakit tidak menular (posbindu ptm) deteksi dini pencegahan komplikasi diabetes melitus puskesmas glugur darat tahun 2014 kajian teori performance mesin daihatsu terios d99b berteknologi vvt-i sistem bahan bakar d type efi mesin non vvt-i pengaruh faktor ekspose kontras resolusi ct scan determinan pemanfaatan pelayanan kesehatan oleh peserta jamkesmas puskesmas medan helvetia tahun 2013 analisis ketebalan filter, daya serta jarak digunakan antara safelight film radiografi meminimalisir fog karakteristik pola asuh keluarga memiliki balita berat badan bgm wilayah kerja puskesmas cengkeh turi kecamatan binjai utara, binjai tahun 2014 implementasi ketentuan pasal 155 undang-undang nomor 40 tahun 2007 tentang perseroan terbatas pengurusan perusahaan analisis faktor-faktor mempengaruhi pengungkapan informasi sosial (social information disclosure) laporan tahunan perusahaan perbankan terdaftar bursa efek indonesia (bei) pola makan status gizi keluarga etnis tionghoa kelurahan asam kumbang kecamatan medan selayang tahun 2014 pengaruh akuntabilitas keuangan daerah, value for money, kejujuran, transparansi pengawasan pengelolaan keuangan daerah (studi kajian pemerintah kabupaten labuhan batu) analisis faktor–faktor berhubungan ketersediaan beras kabupaten mandailing natal karakteristik pengetahuan konsumen tentang prinsip reduce reuse serta partisipasi menggunakan tas belanja sebagai pengganti kantong plastik carrefour medan fair tahun 2014 tata cara pemotongan pajak penghasilan pasal 23 pengkreditannya kantor pelayanan pajak pratama medan belawan analisis implementasi program eliminasi filariasis kabupaten bengkalis tahun 2013 pelaksanaan kegiatan ekstensifikasi rangka meningkatkan jumlah wajib pajak kantor pelayanan pajak pratama medan barat gambaran perilaku penghuni tentang personal hygiene sanitasi dasar, komponen fisik fasilitas sanitasi dasar, serta keluhan kesehatan kulit penghuni asrama putri usu tahun 2014 penerapan hukum undang-undang nomor 35 tahun 2009 tentang narkotika (analisis beberapa putusan hakim pengadilan negeri medan) asuhan keperawatan tn.h prioritas masalah personal hygiene rsu jiwa prof. dr. muhammad ildrem provinsi sumatera utara asuhan keperawatan an. n prioritas masalah kebutuhan dasar nutrisi kurang dari kebutuhan tubuh lingkungan v kelurahan harjo sari ii medan amplas analisis bahaya identifikasi titik kritis industri rumah tangga pembuatan tahu cina tahu sumedang kelurahan sari rejo kecamatan medan polonia perilaku konsumsi sayur buah mahasiswi kesehatan mahasiswi non kesehatan asrama putri usu tahun 2014 asuhan keperawatan tn. r prioritas masalah ketidakseimbangan nutrisi kurang dari kebutuhan tubuh lingkungan v kelurahan harjosari ii kecamatan medan amplas asuhan keperawatan klien masalah pemenuhan kebutuhan dasar oksigenasi melalui program dots kelurahan harjosari ii kecamatan medan amplas hubungan karakteristik ibu kasus balita gizi buruk keluarga petani karet wilayah binaan wahana visi indonesia area development program kabupaten nias tahun 2013 asuhan keperawatan tn. r prioritas masalah kebutuhan dasar gangguan tidur klien diabetes melitus kelurahan harjosari lingkungan vii kecamatan medan amplas medan analisis faktor-faktor mempengaruhi kepuasan pelanggan warung nasi kedai kita asuhan keperawatan tn. r prioritas masalahkebutuhan dasar keamanan keselamatan klien perilaku kekerasandi rsu jiwa prof. dr. moh. ildrem provsu medan analisis faktor modal, pengalaman, pendidikan, minat bakat entrepreneur memulai usaha kecil menengah (studi korelasional kuantitatif pajus karona jl.jamin ginting padang bulan) asuhan keperawatan tn.h prioritas masalah kebutuhan dasar istirahat tidur jl. bajak iv kelurahan harjosari ii kecamatan medan amplas analisis faktor-faktor perilaku konsumen mempengaruhi keputusan pembelian produk baju bekas impor ( toko baju new look) asuhan keperawatan ny. h prioritas masalah kebutuhan dasar mobilisasi kelurahan harjosari ii kecamatan medan amplas pengaruh persepsi pasien tentang mutu pelayanan rumah sakit keputusan berobat kembali rumah sakit dr. abdul malik tni au medan tahun 2013 analisis kebijakan bisnis upaya meningkatkan volume penjualan usaha mikro kecil menengah ud.rezeki baru asuhan keperawatan tn. h prioritas masalah personal hygiene rsj prof.dr.moh.ildrem provsu medan asuhan keperawatan tn.a gangguan kebutuhan mobilisasi kecamatan medan amplas desa harjosari ii strategi bisnis perkembangan usaha toko kelontong medan ( sekitaran jl a.r.hakim gg. pendidikan) asuhan keperawatan klien kebutuhan dasar personal hygiene kelurahan harjosari ii medan amplas 2015 asuhan keperawatan tn. s prioritas masalah kebutuhan dasar mobilisasi lingkungan v kelurahan harjosari ii kecamatan medan amplas pengaruh pelayanan, disiplin kerja lokasi keputusan konsumen memilih bimbingan belajar ganesha operation jl. hayam wuruk no. 7 abc medan asuhan keperawatan ny.d prioritas masalah kebutuhan dasar mobilisasi lingkungan v kelurahan harjosari ii kecamatan medan amplas sistem monitoring level tekanan gas tabung lpg tampilan lcd sms gate way berbasis atmega8535 sistem pengamanan sepeda motor sensor vibrator menggunakan sms gate way berbasis atmega8535 tinjauan paket wisata pt. narasindo tour & travel medan tugas tanggung jawab pramukamar meningkatkan pelayanan grand swiss-belhotel international medan prosedur lost and found perusahaan penerbangan malaysia airlines kuala namu international airport upaya pt. mutiara holidays medan mempromosikan objek wisata sumatera utara melalui penjualan paket wisata tata cara pramusaji melayani banquet event hotel novotel yogyakarta pelaksanaan taking order rendezvous bar and lounge grand swiss-bell hotel medan kereta api bawah tanah tokyo metro sebagai sarana transportasi wisata kota tokyo peran humas pt. perkebunan nusantara iii (persero) meningkatkan citra perusahaan pengawasan internal penggajian pegawai kantor wilayah direktorat jenderal kekayaan negara sumatera utara penerapan sistem informasi akuntansi gaji upah sentra kredit konsumer pt bank rakyat indonesia (persero) tbk kcp gajah mada medan proses penerapan k3(keselamatan kesehatan kerja) pt.perusahaan gas negar(persero)tbk, medan rancang bangun alat penukar kalor tabung sepusat pengaruh pelaksanaan rekrutmen program pelatihan kinerja karyawan pt sinarniaga sejahtera deli serdang tanggung jawab pengelola mal pelanggaran hak cipta dilakukan oleh penyewa menurut undang –undang nomor 28 tahun 2014 tentang hak cipta pengaruh beban operasional pendapatan operasional, non performing loan, capital adequacy ratio, loan to deposit ratio, net interest margin bank size return on asset bank bumn go public bursa efek indonesia laporan praktik kerja profesi apoteker farmasi industri penerapan hukum pidana tindak pidana pencucian uang hasil tindak pidana narkotika ( studi putusan no. 847/pid.b/2013/pn.mdn) laporan praktek kerja profesi farmasi industri sintesis basa schiff dari hasil kondensasi sinamaldehida etilendiamin fenilhidrazin serta pemanfaatannya sebagai inhibitor korosi logam seng laporan praktik kerja profesi farmasi rumah sakit perancangan sistem informasi inter club indonesia kordinator daerah sumatera utara berbasis web perbandingan hasil deteksi tepi laplacian of gaussian laplacian of gaussian kombinasi high boost filtering analisis pengembangan objek wisata pemandian alam taman rekreasi gotong royong indah desa hulu, kecamatan pancurbatu, kabupaten deliserdang, provinsi sumatera utara pengaruh campuran jenis bambu kualitas oriented strand board dampak erupsi gunung sinabung sifat kimia tanah kabupaten karo analisis swot menentukan strategi pemasaran produk olahan susu pt. putra indo mandiri sejahtera an error analysis in using direct and indirect speech made twelfth year students of hospitality accomodation program, smk raksana 2 medan pengaruh kualitas pelayanan kepuasan konsumen pengguna jasa transportasi ( studi po sumatera transport (sutra) jurusan medan-kabanjahe, simpang kuala no.7 medan) analisis pengaruh service excellent oleh frontliner loyalitas nasabah pt. bank negara indonesia cabang usu medan pola pembentukan akronim bahasa mandarin koran guoji ribao strategi pengembangan usaha komunikasi pemasaran home industri toko kue balige, toba bakery & cakes balige pengaruh emotional spiritual quotient (esq), locus of control (loc), time budget pressure, moralitas auditor komitmen profesional kualitas audit ( inspektorat kabupaten dairi) strategi komunikasi keputusan kunjungan konsumen village futsal jalan kampung susuk medan strategi pemasaran meningkatkan volume penjualan ( pt. kimia farma (persero) trading & distribution, tbk cabang tanjung morawa) perlindungan hak cipta hasil karya lagu atau musik menurut uu no 28 tahun 2014 tentang hak cipta (studi beberapa band kota medan) peranan relawan demokrasi partisipasi pemilih pemilu legislatif 2014 kabupaten deli serdang analisis prospek pembangunan sektor pertanian kabupaten karo implementasi peraturan daerah nomor 7 tahun 2011 tentang pajak hiburan ditinjau dari hukum administrasi negara (studi kota medan) kekuasaan keuchik sistem pemerintahan gampong (kekuasaan elit lokal gampong tumpok teungoh kecamatan banda sakti kota lhokseumawe) substitusi agregat halus beton limbah produksi pabrik pengecoran logam posisi geopolitik selatmalaka bagi kepentingan nasional indonesia. (studi analisis ekonomi politik indonesia masa pemerintahan susilo bambang yudhoyono) hak kewajiban kapal pesawat udara asing melakukan lintas alur laut kepulauan indonesia perilaku hidup sehat masyarakat nelayan tanjung balai (studi etnografi mengenai kesehatan masyarakat nelayan kelurahan keramat kubah, kec. sei tualang raso, tanjung balai) perkawinan semerga (studi etnografi mengenai merga silima masyarakat karo desa sugau, kec. pancur batu, kab. deli serdang) analisis kondisi fasilitas sanitasi keluhan kesehatan korban letusan gunung sinabung posko pengungsian kabupaten karo tahun 2015 konstruksi identitas diri remaja pengguna media instagram kota medan persepsi mahasiswa tentang komunikasi nonverbal dosen departemen ilmu komunikasi fisip usu dinamika komunikasi antarbudaya kalangan mahasiswa fisip usu menjaga harmonisasi strategi divisi public relations manajemen krisis (studi deskriptif kualitatif strategi manajemen krisis divisi public relations pt pln (persero) wilayah sumatera utara) media online pemenuhan kebutuhan informasi (studi korelasional media online pemenuhan kebutuhan informasi mahasiswa fakultas ilmu sosial ilmu politik universitas sumatera utara) partisipasi masyarakat pengembangan pariwista motif penggunaan kepuasan menggunakan path (studi korelasional tentang pengaruh motif penggunaan kepuasan menggunakan jejaring sosial path kalangan masyarakat pasar vi kelurahan padang bulan medan) peningkatan partisipasi masyarakat pembangunan infrastruktur jalan (studi kantor dinas pekerjaan umum kota tanjung balai) implementasi peraturan daerah provinsi sumatera utara nomor 6 tahun 2004 tentang penghapusan perdagangan perempuan anak kota medan uji efektivitas pertumbuhan jamur dari sampo mengandung zink pirition beredar kota medan dampak peralihan tempat pembuangan akhir (tpa) namo bintang kesejahteraan sosial rumah tangga pemulung desa baru, kecamatan pancur batu, kabupatem deli serdang pengaruh kelembaban arus bocor isolator piring jenis porselen terpolusi abu vulkanik perjanjian jual beli semen andalas pt lafarge cement indonesia gambaran self disclosure remaja etnis india tamil komunikasi intrapersonal pengguna cadar konsep diri (studi deskriptif kualitatif komunikasi intrapersonal pengguna cadar konsep diri mahasiswi stai as-sunnah tanjung morawa) pengaruh remunerasi kinerja anggota polri (studi spripim kepolisian negara republik indonesia daerah sumatera utara) peranan motivasi meningkatkan prestasi kerja guru madrasah aliyah negeri (man) sidikalang program pemberdayaan perempuan kursus wanita karo gereja batak karo protestan (kwk-gbkp) perempuan pengungsi sinabung kecamatan payung kabupaten karo margaisme pemilihan legislatif kabupaten humbang hasundutan eksistensi perempuan komunitas motor kota medan( perkumpulan ladies matic bikers) sistem pengenalan wajah menggunakan webcam pintu otomatis menggunakan metode eigenface hubungan anemia defisiensi besi gangguan konsentrasi gambaran perilaku pencarian penanganan jerawat remaja sma kecamatan medan denai prosedur pemberian nomor seri faktur pajak kepada pengusaha kena pajak (pkp) kantor pelayanan pajak pratama medan kota proses penghitungan pengaruh penerimaan pajak bumi bangunan sektor perkotaan perdesaan dinas pendapatan kota medan pengendalian internal gaji upah pt bank sumut cabang asia mega mas kota medan pengendalian internal gaji upah dinas pertamanan kota medan pengelolaan asuhan keperawatan keluarga remaja prioritas masalah merokok kelurahan tanjung sari kecamatan medan selayang perencanaan pengawasan beban operasional pt. pln (persero) wilayah sumatera utara area medan asuhan keperawatan nn. d denganprioritas masalah kebutuhan dasar oksigenasidi rsup.haji adam malik medan sistem informasi akuntansi penerimaan pengeluaran kas pt. perkebunan nusantara iv medan asuhan keperawatan ny.e masalah defisit perawatan diri rumah sakit jiwa daerah provinsi sumatera utara sistem pengendalian internal kas pt. sago nauli sistem pengendalian internal gaji upah dinas perhubungan kota medan asuhan keperawatan an.m prioritas masalah kebutuhan dasar oksigenasi rs. dr. pirngadi medan peranan komputer sebagai alat bantu pengolahan data akuntansi pt. perkebunan nusantara iv medan pengendalian feeding menggunakan statistical quality control pt inalum sistem informasi akuntansi penggajian pegawai kantor camat kota pinang kabupaten labuhanbatu selatan peramalan banyaknya energi salurkan pt.pln (persero) cabang medan tahun 2014 fungsi anggaran pendapatan belanja negarapada satuan non vertikal tertentu pelaksanaan jaringan sumber air provinsi sumatera utara pembuatan sistem informasi smp yayasan pendidikan persada indah php mysql sistem pengendalian intern kas pt. railink sistem pengendalian internal kas lotte mart center point mall perancangan sistem informasi berbasis web menggunakan php mysql smp negeri 1 tebing-tinggi mekanisme pelaksanaan penagihan pemungutan pajak reklame kantor dinas pendapatan daerah kota medan sistem pengendalian intern kas pt. bank syariah mandiri penghitungan pendapatan kontribusi kios kebersihan bulanan pasar pusat pasar medan lantai i oleh perusahaan daerah pasar kota medan peranan fasilitas kerja meningkatkan produktivitas kerja staf pegawai pt. jamsostek (persero) medan kontribusi kredit angsuran lainnya pertumbuhan kredit pt. bank sumut kantor cabang pembantu pasar halat medan skrining fitokimia uji efektivitas sediaan gel ekstrak etanol daun kelapa sawit (elaeis guineensis jacq.) penyembuhan luka sayat efektifitas pengawasan pajak hotel sebagai penerimaan pajak daerah dinas pendapatan daerah kota medan analisis medication error resep pasien kanker payudara mendapatkan tindakan kemoterapi rsup h. adam malik medan pengujian aktivitas antibakteri gel anti jerawat dari beberapa merek dagang bakteri propionibacterium acne pengaruh iklim organisasi stres kerja karyawan pt pupuk iskandar muda lhokseumawe analisis tingkat kepatuhan wajib pajak dilihat dari penerimaan tunggakan pajak oleh seksi penagihan kantor pelayanan pajak (kpp) pratama lubuk pakam tahun 2011-2014 analisis manajemen kas badan kepegawaian daerah (bkd) provinsi sumatera utara analisis sumber penggunaan modal kerja pt perkebunan nusantara iii (persero) medan perbandingan anggaran realisasi dana dekonsentrasi biro pemerintahan umum setdaprovsu pengaruh potensi pegawai kepuasan masyarakat implementasi program pelayanan kesehatan bpjs kota medan pelaksanaan surat teguran peningkatan penerimaan pajak negara kantor pelayanan pajak (kpp) pratama medan timur pengaruh pelaksanaan peraturan pemerintah nomor 46 tahun 2013 tentang pajak penghasilan dari usaha diterima atau diperoleh wajb pajak memiliki predaran bruto tertentu penerimaan pajak kantor pelayanan pajak pratama lubuk pakam perancangan termometer digital menggunakan wtv020 berbasis atmega 32 strategi kinerja pramuwisata pt. narasindo tour and travel medan meningkatkan kualitas pemanduan bangunan istana kaisar tokyo the ceremony of manonggot – nonggoti practised by simalungun society sistem pengendalian internal penggajian pegawai pt kawasan industri medan (persero) sistem pengendalian internal penerimaan pengeluaran kas pt kawasan industri medan (persero) sistem informasi akuntansi atas aset tetap kanwil direktorat jenderal kekayaan negara sumatera utara sistem pengendalian internal aset tetap perum bulog divre sumut peranan sistem informasi akuntansi sebagai alat pengambilan keputusan pt. pln (persero) wilayah sumatera utara area medan pengawasan intern kas badan pelayanan perijinan terpadu kota medan fungsi anggaran sebagai alat perencanaan pengendalian kantor regional vi badan kepegawaian negara medan sistem pengawasan internal gaji upah pt. perkebunan nusantara ii (persero) medan manfaat sistem informasi akuntansi sebagai alat bantu manajemen pengambilan keputusan sentra kredit konsumer pt. bank rakyat indonesia (persero) tbk medan penerapan sistem akuntansi penjualan pt. tauko medan sistem pengendalian intern aset tetap pt. taspen (persero) cabang utama medan model pendugaan cadangan karbon kelapa sawit (elaeis guineensis jacq.) umur 5 tahun perkebunan kelapa sawit pt. putri hijau, kabupaten langkat. inventarisasi tumbuhan obat hutan lindung kec. ulu pungkut, kab. mandailing natal ( desa alahankae, hutanagodang, simpang banyak) sistem informasi akuntansi pembiayaan pt. bank syariah bukopin cabang medan pendugaan cadangan karbon tegakan kelapa sawit (elaeis guineensis jacq.) umur 15 tahun perkebunan kelapa sawit putri hijau, besitang sumatera utara inventarisasi pemanfaatan rotan oleh masyarakat sekitar hutan( hutan batang toru blok barat kecamatan adiankoting, kabupaten tapanuli utara) pemetaan tingkat bahaya erosi das padang pemetaan tingkat bahaya erosi das ular inventarisasi pemanfaatan aren (arenga pinnanta merr) ( hutan batang toru blok barat, kecamatan adiankoting, kabupaten tapanuli utara) prosedur pendataan pajak restoran kantor dinas pendapatan daerah kota binjai peranan jurusita pajak pelaksanaan tindakan penagihan pajak kantor pelayanan pajak praatama medan belawan pengaruh konsentrasi optimum tawas turbiditas (kekeruhan) air baku metode jar test instalasi pengolahan air (ipa) pdam tirtanadi sunggal perancangan line follower komparasi tanpa pengkondisi sinyal sensor lm35 berbasis mikrokontroler atmega32 aplikasi sensor pir sensor ultrasonik sebagai pengendali sistem kran air otomatis berbasis atmega 8535 sistem pengamanan kebocoran selang tabung gas lpg sms gate way berbasis atmega8535 perancangan alat pengukur jarak menggunakan software basic complier-avr berbasis mikrokontroller atmega8 pemanfaatan sumber informasi elektronik perpustakaan universitas pembangunan panca budi peranan motivasi, disiplin kerja, fasilitas kerja kinerja karyawan negara indonesia (persero) peranan komunikasi motivasi pimpinan kinerja karyawan bidang pengembangan pendapatan dearah peranan komunikasi meningkatkan kualitas pelayanan dinas pendapatan provinsi sumatera utara peranan komunikasi meningkatkan kualitas pelayanan dinas pendapatan provinsi sumatera utara peranan sekretaris koordinasi kerja kepala balai riset standardisasi industri medan (baristand) peranan sekretaris koordinasi kerja kepala balai riset standardisasi industri medan (baristand) peran tata usaha meningkatkan kualitas pelayanan balai riset standardisasi industri medan (baristand) peranan sekretaris penanganan surat masuk surat keluar bagian tata usaha dinas sosial tenaga kerja kota medan peranan komunikasi aktivitas kerja pegawai bagian badan perencanaan pembangunan daerah walikota medan penerapan standarisasi pelayanan nasabah pt bank sumut syariah cabang medan asuhan keperawatan ny. l prioritas masalah kebutuhan dasar mobilisasi kelurahan harjosari ii kecamatan medan amplas sistem pembuatan minuman kopi secara manual menggunakan mesin cassiavera bar the city hall club medan hubungan kerja antara kantor depan bagian tata graha pelayanan tamu selama menginap hotel santika premiere dyandra medan pengaruh pemesanan kamar melalui media internet tingkat huni kamar grand serela hotel & convention medan standar penerimaan penyimpanan sayuran spoon dining kitchen restaurant hotel grand aston city hall medan pengelolaan arsip kantor camat medan baru sistem pengendalian internal kas perum bulog divre sumut analisis biaya operasional aroma bakery cake medan penerapan metode theory of constraint mengoptimalkan stasiun kerja bottleneck pt asahan crumb rubber penerapan metode theory of constraint mengoptimalkan stasiun kerja bottleneck pt asahan crumb rubber penetapan kadar campuran parasetamol fenilpropanolamin hidroklorida sediaan kaplet menggunakan metode spektrofotometri derivatif blog tingkat keterbukaan diri (studi korelasional tentang penggunaan media sosial intensitas interaksi remaja orangtua kecamatan medan selayang) kualitas pelayanan publik pengurusan bea balik nama kendaraan bermotor kantor sistem administrasi manunggal satu atap (samsat) unit pelaksana teknis daerah sidikalang kabupaten dairi pengaruh likuidtas, leverage, profitabilitas, growth, rasio keuangan penelitian altman financial distress perusahaan manufaktur terdaftar bei periode 2011-2013 pengaruh perbandingan sari belimbing wuluh sari amangga kweni konsentrasi gum arab amutu sorbet nira tebu analisis alih fungsi lahan sawah prediksi produksi konsumsi beras kabupaten deli serdang analisis korelasi ekspor impor beberapa komoditi sektor pertanian perekonomian sumatera utara program discharge planning pelaksanaan asuhan keperawatan ibu pasca operasi sectio caesarea ruang tanjung ii rsud dr. pirngadi kota medan komunikasi persuasif prestasi belajar (studi korelasional tentang komunikasi persuasif pengajar prestasi belajar anak didik slb-e negeri pembina medan) marah halimcup 1972 -1995 hubungan dukungan keluarga tingakat kecemasan ibu menghadapi persalinan klinik niar medan tahun 2015 upaya peningkatan penerimaan pajak penghasilan pasal 21 atas penghasilan diterima pegawai tetap kantor pelayanan pajak pratama medan barat mekanisme pemungutan pajak air permukaan dinas pendapatan provinsi sumatera utara pengaruh perubahan penghasilan tidak kena pajak (ptkp) penerimaan pajak penghasilan (pph) pasal 21 kantor pelayanan pajak (kpp) pratama lubuk pakam pelaksanaan ekstensifikasi meningkatkan jumlah wajib pajak kantor pelayanan pajak pratama lubuk pakam mekanisme perhitungan pajak bumi bangunan sektor perdesaan perkotaan (p2) dinas daerah pendapatan kabupaten langkat asuhan keperawatan ny. l prioritas masalah kebutuhan dasar rasa nyaman nyeri harjosari ii lingkungan 7 kecamatan medan amplas asuhan keperawatan ny. r prioritas masalah kebutuhan dasar gangguan nutrisi kurang dari kebutuhan tubuh rumah sakit jiwa pemerintahan provinsi sumatera utara medan asuhan keperawatan pasien prioritas masalah pemenuhan kebutuhan perawatan diri rsj prof. dr. muhammad ildrem prov. sumatera utara asuhan keperawatan an.a prioritas masalah kebutuhan dasarnutrisi lingkungan ix kelurahan harjosari ii kecamatan medan amplas asuhan keperawatan tn.h prioritas masalah kebutuhan dasar harga diri rumah sakit jiwa prof. dr. muhammad ildrem provinsi sumatera utara medan asuhan keperawatan ny. s prioritas masalah gangguan rasa nyaman nyeri akut kelurahan harjosari ii medan amplas asuhan keperawatan tn. a prioritas masalah kebutuhan dasar mobilisasi lingkungan ix kel. harjosari ii kec. medan amplas asuhan keperawatan an.f prioritas masalah kebutuhan dasar nutrisi kurang dari kebutuhan tubuh lingkungan ix kelurahan harjosari ii medan amplas asuhan keperawatan tn. a prioritas masalah kebutuhan dasar personal higyene defisit perawatan diri kelurahan harjosari ii kecamatan medan amplas asuhan keperawatan ny. m prioritas masalah kebutuhan dasar gangguan pola tidur kelurahan harjosari ii medan amplas peranan sistem pengelolaan keuangan pemerintah daerah penerapan sistem akuntansi keuangan pemerintah daerah meningkatkan kualitas laporan keuangan pemerintah daerah kabupaten padang lawas, kabupaten padang lawas utara, kabupaten tapanuli selatan, kota padangsidimpuan pengaruh struktur modal good corporate governance kinerja keuangan ukuran perusahaan sebagai variabel moderating perusahaan otomotif terdaftar bursa efek indonesia tahun 2010 - 2013 analisis pengaruh tanggung jawab sosial kinerja keuangan perusahaan bank umum syariah indonesia tahun 2009-2014 pengaruh penilaian prestasi kerja promosi jabatan pengambilan keputusan berdasarkan sistem informasi manajemen struktur organisasi direktorat jenderal pajak kantor wilayah sumatera utara i pengaruh bmt pradesa mitra mandiri peningkatan ekonomi masyarakat kota binjai pembuatan tali serat berbahan serat alami kulit batang melinjo (gnetum gnemon) kajian mutu fisikokimia sensori es lilin markisa konsentrasi sari bengkuang jenis penstabil berbeda kajian mutu fisikokimia sensori produk es lilin dari campuran sari bit merah nenas penambahan gelatin analisis komparasi penggunaan produktivitas tenaga kerja usahatani padi organik padi non organik studikualitasperairansebagaipengembanganbudidayaikan sungai keureutokecamatanlhoksukon, kabupaten aceh utara, provinsinanggroe aceh darussalam penerapan ketentuan pidana kekerasan fisik istri dintinjau dari aspek perlindungan korban (studi 4 (empat) putusan pengadilan negeri) tinjauan yuridis mengenai keberadaan organ pengawas mencegah terjadinya penyalahgunaan fungsi tujuan yayasan pengalihan pengelolaan bank rangka penyehatan bank oleh otoritas jasa keuangan status hak mewarisi anak dari hasil perkawinan laki-laki batak perempuan minangkabau nagari koto tangah, kecamatan tanjung emas, kabupaten tanah datar, sumatera barat analisis saluran pemasaran penjualan biji kopi (studi industri kopi kecamatan pamatang sidamanik, kabupaten simalungun, sumatera utara) pengaruh kompensasi kinerja karyawan pt. pln (persero) area padang sidimpuan, sumatera utara konflik batin tokoh utama wanita novel fengru fei tun karya mo yan etek kebudayaan mandailing desa marisi, kecamatan angkola timur, kabupaten tapanuli selatan tingkat pengetahuan mahasiswa kepaniteraan klinik fakultas kedokteran gigi universitas sumatera utara dampak merokok jaringan lunak mulut. pengaruh tingkat kesehatan bank kinerja keuangan perbankan terdaftar bursa efek indonesia periode 2011-2014 analisis biomekanika fisiologi pemanen kelapa sawit menggunakan dodos pt. perkebunan nusantara iii (kebun rambutan) analisa respon mekanik paving block concrete foam diperkuat serat tandan kosong kelapa sawit (tkks) akibat beban flexure penyelidikan perilaku mekanik material concrete foam diperkuat serat tkks kuat statik tekan tarik variasi ukuran butir pasir penyelesaian program bilangan bulat campuran dua kriteria menggunakan metode branch and cut an analysis of non-literal meaning used in reader digest magazines advertisement penggunaan jamur pelarut fospat pupuk fospat meningkatkan ketersediaan serapan p tanaman kentang andisol terdampak erupsi perbedaan ukuran kamar pulpa molar satu rahang bawah pasien diabetes melitus non-diabetes melitus ditinjau dari radiografi periapikal analisis hukum kontrak pengadaan barang jasa badan usaha milik negara (bumn) pt.pemuda simalungun abadi perlindungan hukum jurnalis korban tindak pidana penganiayaan analisis perancangan sistem informasi penjualan pt. speedline auto showroom pengaruh corporate social responsibility disclosure nilai perusahaan kebijakan struktur modal sebagai variabel pemoderasi perusahaan properti terdaftar bursa efek indonesia akibat hukum perjanjian kredit jaminan hak tanggungan objeknya hak guna bangunan pt. bank rakyat indonesia (persero) kantor cabang pembantu asia unit cemara medan tanggung jawab perusahaan pemenang tender pekerjaan menurut perpres no. 4 tahun 2015 tentang pengadaan barang/jasa pemerintah pengaruh pendidikan pelatihan kinerja karyawan pt pln (persero) pembangkitan sumatera bagian utara strategi pemenangan ir. mangindar simbolon ir. mangadap sinaga pemilihan kepala daerah kabupaten samosir tahun 2010-2015 makna kata عذاب/‘ażāb /dalamalquran ditinjau dari segi makna gramatikal pengaruh promosi jabatan lingkungan kerja kinerja pegawai kantor pusat pt pelabuhan indonesia i (persero) medan kajian potensi ekowisata mangrove desa sialang buah kecamatan teluk mengkudu kabupaten serdang bedagai tinjauan yuridis peranan lembaga mediasi sebagai alternatif penyelesaian sengketa asuransi indonesia studi badan mediasi asuransi indonesia (bmai) analisis pengaruh kinerja keuangan perubahan harga saham perusahaan perbankan go public terdaftar bursa efek indonesia tahun 2011-2013 analisis daya saing ekonomi kabupaten asahan analisis efisiensi produksi usaha keripik ubi sebagai makanan khas langsa kota langsa, provinsi aceh analisis alokasi kanal dinamik komunikasi seluler algoritma neural network analisis alokasi kanal dinamik komunikasi seluler algoritma tabu search gambaran pola makan tingkat keparahan stroke iskemik departemen neurologi rsup h. adam malik medan faktor-faktor mempengaruhi gejala pruritus pasien hemodialisis reguler kualitas hidup pasien akne vulgaris mahasiswi angkatan 2011 fakultas kedokteran sumatera utara efek aromaterapi lavender secara evaporasi penurunan tekanan darah denyut jantung mahasiswa fakultas kedokteran universitas sumatera utara pola kepekaan antibiotik bakteri extended spectrum beta laktamases-producing escherichia coli dari spesimen urin rsup h. adam malik periode juli 2013-juni 2014 gambaran penggunaan antimikroba musim hujan musim kemarau kota medan tahun 2013 asuhan keperawatan tn. s prioritas masalah gangguan kebutuhan dasar imobilisasi kec.medan amplas. desa harjosari ii hubungan dukungan suami pelaksanaan inisiasi menyusui dini klinik sally medantahun 2015 perbandingan tingkat pengetahuan tentang penanganan awal kegawatdaruratan medis antara mahasiswa fk usu sudah melewati blok emergency medicine pernah mengikuti seminar workshop basic life support hubungan status gizi gangguan menstruasi remaja putri akademi kebidananan cipto medan tahun 2015 pengetahuan sikap ibu hamil tentang kunjungan k1-k4 desa kelambir wilayah kerja puskesmas hamparan perak profil penderita tumor jinak ganas tulang rumah sakit umum pusat haji adam malik medan tahun 2011-2013 gambaran kadar haemoglobin anak penyakit jantung bawaaan rsup h. adam malik medan tahun 2012 – 2013 profil penderita kanker serviks rsud dr. pirngadi kota medan gambaran gangguan menstruasi penderita kista ovarium rsup h. adam malik tahun 2012-2013 pengaruh perawatan rooming-in produksi asi ibu postpartum rsu fajar medan polonia tahun 2015 faktor – faktor mempengaruhi pola pengasuhan balita wilayah kerja puskesmas padang bulan medan tahun 2015 gambaran kasus kasus rujukan persalinan rsu dr pringadi medan periode januari – desember 2014 pengetahuan sikap ibu nifas penggunaan kontrasepsi klinik kasih ibu kecamatan delitua kabupaten deli serdang tahun 2015 faktor-faktor mempengaruhi induksi persalinan oksitosin rsud.pirngadi tahun 2014 perbandingan efektivitas penggunaan video powerpoint kepuasan mata kuliah asuhan kebidanan i d-iii kebidanan stikes haji medan tahun 2015 tingkat pengetahuan kesehatan reproduksi berdasarkan usia menarche siswi sekolah menengah pertama swasta gkpi padang bulan medan gambaran depresi perimenopause karyawati pt pelabuhan indonesia 1 (persero) medan tahun 2015 pengaruh teknik relaksasi nafas intesitas nyeri ibu post operasi sectio caesaria (sc) rsup h. adam malik medan tahun 2015 hubungan antenatal care berat badan lahir bayi klinik bersalin linda silalahi kecamatan pancur batu tahun 2015 pengaruh konsumsi susu kedelai produksi asi klinik wipa tahun 2015 tingkat kecemasan ibu paska histerektomi rsud dr. pirngadi medan tahun 2015 karakteristik peserta kontrasepsi sterilisasi klinik mantap medan periode2014 hubungan komunikasi terapeutik bidan kepuasan ibu hamil mendapatkan pelayanan antenatal care rumah bersalin elly kelambir lima pasar iv tanjung gusta medan hubungan pekerjaan ibu dukungan suamidengankeberhasilanpemberian asi eksklusifpada bayi usia 0-6 bulandi dusun iidesa bandar setia 2015 tingkat kepuasan ibu bersalin pertolongan persalinan oleh bidan apn klinik wipa sei sikambing medan tahun 2015 hubungan status sosial ekonomi keluarga kebiasaan makan status gizi anak taman kanak-kanak yayasan yapina al-ikhsan kecamatan darul aman kabupaten aceh timur tahun 2013 asuhan keperawatan tn.a masalah kebutuhan dasar aman nyaman lingkungan v keluarahan harjosari ii kecamatan medan amplas analisis perubahan tegangan deteksi keadaan air free-dipping method menggunakan sensor kitosan faktor – faktor mempengaruhi pendapatan nelayan pesisir pantai kecamatan singkil utara kabupaten aceh singkil analisis faktor-faktor mempengaruhi pengungkapan manajemen risiko perusahaan non keuangan terdaftar bursa efek indonesia tinjauan yuridis penerapan bantuan hukum cuma-cuma bagi pencari keadilan tidak mampu perkara perdata (studi pos bantuan hukum yayasan lbh-pk “persada” peradilan umum) respon cylindrocladium sp. fungisida berbahan aktif mancozeb secara in vitro buta warna computer vision syndrome kalkulasi kekuatan lensa intra okuler katarak diabetes melitus retinoskopi herlyn-werner-wunderlich syndrome with preterm pregnancy the presentation of a rare case pelaksanaan manajemen aktif kala iii oleh bidan kecamatan sidikalang kabupaten dairi tahun 2015 analisis kesiapasiagaan tenaga gizi menghadapi gizi darurat bencana kabupaten aceh besar tahun 2013 hubungan strategi belajar gaya belajar hasil evaluasi belajar mahasiswi d-iii kebidanan poltekkes kemenkes ri medan tahun 2015 do we need to treat any of uterine abnormality in fertility seeking patient? perbedaan tingkat pengetahuan ibu hamil bahaya kehamilan sebelum sesudah penyuluhan desa klambir wilayah kerja puskesmas hamparan perak kabupaten deli serdang tahun 2015 pengaruh pelaksanaan hypnobirthing persepsi kepuasan ibu persalinan kala i klinik sumiariani kecamatan medan johor tahun 2015 hubungan dukungan suami dengn tingkat kecemasan ibu nifas perawatan bayi baru lahir rumah sakit umum sundari medan tahun 2015 hubungan tingkat kecemasan mekanisme koping ibu menjelang tindakan kuretase rsud dr. pirngadi medan tahun 2015 pengetahuanibu hamil tentangpenyakit tuberkulosis kehamilan klinik desmawati pancur batu kabupaten deli serdang tahun2015 karakterisasi simplisia, skrining fitokimia uji aktivitas antioksidan ekstrak etanol kulit buah duku (lansium domesticum correa) metode dpph perancangan pembuatan sistem pengamanan sepeda motor berbasis mikrokontroller atmega 8 via ponsel evaluasi kepatuhan wajib pajak penerimaan pajak sebelum sesudah uji coba penataan tugas fungsi account representative kantor pelayanan pajak pratama medan timur pengaruh kepemilikan keluarga kepemilikan institusional pergantian auditor corporate governance index sebagai variabel moderating analisis pengaruh faktor internal faktor eksternal bank pola penyaluran kredit padabank-bank asing indonesia pengaruh auditor spesialis industri ukuran kap auditor tenure independensi auditor manajemen laba perusahaan manufaktur terdaftar bursa efek indonesia periode 2010-2013 pengaruh fungsi perencanaan, fungsi pelaksanaan, serta fungsi pengendalian pengawasan kinerja keuangan menggunakan konsep economic value added (eva) seketariat daerah kota pematang siantar pengaruh sikap konsumen tentang program corporate social responsibility (csr) loyalitas konsumen pasta gigi pepsodent mahasiswa fakultas ekonomi bisnis universitas sumatera utara prosedur pendataan pajak hotel dinas pendapatan daerah kota medan sistem informasi akuntansi aktiva tetap balai besar meteorologi klimatologi geofisika wilayah-i medan sistem pengawasan intern aktiva tetap pt. asuransi ramayana tbk asuhan keperawatan asuhan keperawatan ny. a prioritas masalah kebutuhan dasar oksigenasi jln. bajak ii h kel. harjosari ii kec. medan amplas kota medan penyusunan pengawasan anggaran pt. pertamina (persero) mor-i medan sistem pengendalian internal atas aset tetap pt.pln (persero) wilayah sumatera utara analisis penerimaan kas rumah sakit umum daerah dr. h. kumpulan pane kota tebing tinggi analisis penerimaan denda pajak kendaraan bermotor (pkb) melalui layanan samsat gerai tembung pendapatan denda pkb kantor upt samsat medan utara putri hijau medan pengawasan internal aset tetap sentra kredit konsumer pt. bank rakyat indonesia (persero) tbk medan pengaruh pemberian ekstrak kencur (kaempferia galanga l) profil farmakokinetika natrium diklofenak sistem akuntansi persediaan bahan baku pt. perkebunan nusantara iii (persero) medan uji aktivitas ekstrak rimpang lengkuas merah (alpinia galanga l. willd) jamur pityrosporum ovale sediaan sampo anti ketombe analisis perancangan aplikasi pemilihan pegawai terbaik menggunakan metode ahp promethee ( rsu prof dr boloni medan) model rekrutmen calon karyawan algoritma iterative dichotomizer three (id3) ( pt.tiffa mitra sejahtera) perilaku petani penggunaan pestisida alat pelindung diri (apd) serta keluhan kesehatan petani desa sukajulu kecamatan barus jahe kabupaten karo tahun 2014 pengaruh kualitas pelayanan kepuasan pasien rawat inap rumah sakit columbia asia medan tahun 2013 gambaran pengetahuan wanita pekerja seks (wps) tentang penyakit hiv/aids dilokalisasi bukit maraja desa marihat bukit kecamatan gunung malela kabupaten simalungun tahun 2014 analisis kepuasan masyarakat kualitas pelayanan surat tanda nomor kendaraan bermotor upt sistem administrasi manunggal satu atap (samsat) tapanuli tengah psikologis komunikasi remaja broken home konsep diri keterbukaan diri (studi deskriptif kualitatif psikologis komunikasi remaja dari keluarga broken home konsep diri keterbukaan diri kecamatan tanjung beringin kabupaten serdang bedagai) sistem pemotongan perhitungan pajak penghasilan (pph) pasal 21 atas pegawai negeri sipil ( kantor pelayanan pajak pratama lubuk pakam) pengaruh profitability investment opportunity set cash dividend perusahaan manufaktur bursa efek indonesia tahun 2013 pra rancangan pabrik pembuatan kalsium klorida dari cangkang kerang hcl kapasitas 5.000 ton/tahun pengaruh pelatihan disiplin kerja kinerja karyawan bni cabang kota padangsidimpuan pengembangan potensi air terjun ponot kabupaten asahan (studi deskriptif daya tarik wisata air terjun ponot desa tangga, kecamatan aek songsongan, kabupaten asahan) strategi komunikasi guru menghadapi temper tantrum anak autis (studi deskriptif kualitatif anak autis sekolah yakari kota medan) peranan tugas profesi reporter serial drama korea pinocchio pengaruh penerapan prinsip-prinsip human relations kinerja karyawan ( studi pt. hadi baru diski) pengaruh struktur organisasi efektivitas pelayanan kesehatan (studi puskesmas kotanopan kabupaten mandailing natal) aplikasi termoelektrik generator sebagai sumber energi listrik lensa fresnel sebagai kolektor panas matahari rancang bangun pemanas induksi berdaya rendah menggunakan solenoid coil berbasis mikrokontroler atmega 8535 fenomena pet boom pengaruhnya bisnis binatang peliharaan jepang dewasa ini fenomena koreika shakai jepang analisis tekstual musikal nangan mendedah pakpak desa kuta meriah, kabupaten pakpak bharat, provinsi sumatera utara pergerakan budi utomo sumatera timur 1908-1935 campur kode dialog sinetron ganteng-ganteng serigala perbedaan penyembuhan angular cheilitis pemberian nistatin mikonazol topikal pasien rumah sakit gigi mulut universitas sumatera utara analisis faktor-faktor mempengaruhi auditor changes perusahaan perbankan terdaftar bursa efek indonesia tahun 2008-2014 pengaruh pajak daerah, retribusi daerah, dana alokasi umum, dana alokasi khusus belanja daerah pulau sumatera (periode 2011- 2013) karakteristik penderita tuberkulosis paru dirawat inap rumah sakit umum daerah dr. hadrianus sinaga pangururan kabupaten samosir tahun 2014 manajemen risiko kepatuhan administrasi perpajakan pt pertamina (persero) mor i medan higiene sanitasi dasar serta pengetahuan, sikap tindakan penjual kepadatan lalat kantin sekolah kecamatan sidamanik tahun 2015 kajian organologis garantung simalungun buatan bapak rossul damanik desa sari matondang 1 kecamatan sidamanik, kabupaten simalungun analisis novel اَحْلَامُ النِّسَاءِ الْحَرِيمِ /ahlamu an-nisa΄i al-harīmi/ ‘impian perempuan-perempuan harem’ karya fatima mernissi (kajian sosiologi sastra) analisis penerjemahan kata قال /qāla/ hadits arba’in analisis efektivitas efisiensi penggunaan anggaran biaya operasional pt. perkebunan nusantara iii (persero) medan penyusunan pengawasan anggaran pt. perkebunan nusantara iii (persero) medan mekanisme pelaksanaan pemungutan pajak hiburan dinas pendapatan daerah (dispenda) kotamedan analisis tinjauan anggaran pembinaan pemuda olahraga sumatera utara optimasi teknis operasional persampahan kota gampong jawa langsa faktor-faktor mempengaruhi peningkatan retribusi pendapatan pt.prima medical nusantara (rumah sakit pabatu ptpn iv) efek jamur tiram putih (pleurotus ostreatus) sel beta pankreas tikus wistar jantan model diabetes mellitus tipe 2 diberi pakan tinggi lemak streptozotocin dosis rendah sistem manajemen pengelolaan data bagian keuangan fakultas ekonomi bisnis universitas sumatera utara novel negeri lima menara ranah tiga warna karya a. fuadi kajian psikologi sastra analisis prosedur pemberian kredit pt. bank mandiri (persero), tbk cabang simpang pos medan persepsi mahasiswa fakultas farmasi universitas sumatera utara paradigma asuhan kefarmasian (pharmaceutical care) tahun 2014 skrining fitokimia uji aktivitas antioksidan sari daging buah semangka (citrullus lanatus (thunb.) matsum. & nakai) metode dpph (1,1diphenyl-2-picrylhydrazil) faktor-faktor mempengaruhi berat badan lahir klinik haryantari medan uji toksisitas akut ekstrak etanol herba selada air (nasturtium officinale r. br.) organ hati mencit hubungan kecerdasan emosional prestasi belajar mahasiswa akbid sehat medan tahun 2014 faktor-faktor mempengaruhi siswa laki laki kejadian merokok madrasah aliyah negeri 2 tanjung pura langkat tahun 2014 variasi kadar perekat phenol formaldehida kualitas papan partikel dari limbah batang kelapa sawit mahoni hubungan konsumsi junk food obesitas siswa sma dharma pancasila kelurahan selayang medan tahun 2014 hubungan tingkat pengetahuan ibu tentang kontrasepsi suntik dmpa kepatuhan jadwal penyuntikan ulang puskesmas sukaramai tahun 2014 pengaruh word of mouth communication keputusan pembelian pasar tradisional pajak usu jamin ginting medan faktor-faktor dukungan suami pemberian asi eksklusif ibu hamil trimester iii rumah bersalin vina kecamatan medan baru 2014 dampak pelaksanaan kaderisasi serikat petani indonesia (spi) basis simpang kopas kehidupan sosial ekonomi masyarakat tani desa huta padang kecamatan bandar pasir mandoge kabupaten asahan pengalaman ibu primipara dampingi suami saat menghadapi proses persalinan kemampuan bakteri kitinolitik asal rizosfer tanaman karet mengendalikanjamur akar putih bibit karet hubungan obesitas identitas diri remaja sma n13 medan tahun 2014 analisis kontrastif kalimat imperatif bahasa mandarin koran xun bao bahasa indonesia koran analisa pengaruh komunikasi teraupetik intensitas nyeri persalinan kala i fase laten klinik delima medan tahun 2014 analisis cerita novel “ oshin “ karya hashida sugako dilihat dari pendekatan pragmatik hubungan obesitas harga diri remaja sma dharma pancasila kelurahan selayang medan tahun 2014 faktor- faktor mempengaruhi bidan praktek mandiri (bpm) menerapkan 58 langkah asuhan persalinan normal (apn) wilayah kerja puskesmas kecamatan siantar marihat tahun 2014 analisis sosiologis tokoh utama komik “great teacher onizuka” karya toru fujisawa pelaksanaan manajemen laktasi oleh bidan ibu hamil klinik sally medan tahun 2014 fenomena makam orang jepang medan ( makam orang jepang delitua hubungan obesitas peran diri yayasan nurul hasanah padang bulan tahun 2014 pelaksanaan program uks perilaku hidup bersih sehat murid sd negeri 060895 kecamatan medan baru tahun 2014 hubungan obesitas infertilitas ibu pasangan usia subur desa wonosari tanjung morawa tahun 2014 motivasi mahasiswa mengikuti program pendidikan d-iv bidan pendidik fakultas keperawatan universitas sumatera utara tahun 2014 faktor- faktor mempengaruhi kejadian dismenore primer remaja putri sma dharma pancasila medan tahun 2014 pelaksanaan tindakan pencegahan infeksi proses pertolongan persalinan oleh bidan praktik mandiri wilayah kerja puskesmas kabanjahe tahun 2014 pengetahuan orang tua pola asuh anak usia pra sekolah (3-5 thn) ra. asy-syakirin fenomena fangirl boy band jepang dewasa ini hubungan paritas kejadian perdarahan pasca salin primer rsu. haji medan periode tahun 2011-2013 analisis pragmatik novel moshidora karya natsumi iwasaki hubungan pengetahuan konsumsi suplemen asam folat ibu hamil rumah bersalin madina kecamatan percut sei tuan kabupaten deli serdang tahun 2014 rancang bangun alat pengempa minyak tipe ulir (oil press) kekuatan cinta novel habibie ainun karya bacharuddin jusuf habibie analisis sosiologi sastra perbandingan makrozoobenthos lokasi keramba jaring apung lokasi tidak memiliki keramba jaring apung pengaruh kualitas pelayanan (service quality) kepuasan dampaknya loyalitas merk (brand loyality) produk oriflame kota medan hubungan perilaku suami tentang dukungan emosional persalinan normal tingkat kecemasan ibu primipara klinik bersalin nining kecamatan lubuk pakam kabupaten deli serdang tahun 2014 perbandinganperilaku torsipada tampangtipisterbuka cara analitis program ansys hubungan paritas kejadian kanker payudara rsup h. adam malik medan tahun 2012 analisa gelombang angkutan sedimen sejajar pantai pantai cermin faktor-faktor mempengaruhi perilaku seksual siswi sma negeri 17 medan gambaran citra tubuh pasien pasca operasi fraktur ekstremitas bawah ruang fisioterapi poly bedah rumah sakit tingkat ii putri hijau, medan evaluasi kinerja operasi pemeliharaan sistem irigasi serbangan kecamatan rawang panca arga kabupaten asahan pengaruh faktor provider karakteristik konsumen kepuasan peserta jaminan kesehatan nasional (jkn) ruang rawat inap rumah sakit islam malahayati medan tahun 2014 penegakan hukum oknum polri sebagai pelaku tindak pidana narkotika (studi putusan pengadilan negeri medan nomor 479/pid.b/2011/pn.mdn) hubungan karakteristik individu, sanitasi lingkungan rumah perilaku kejadian tb paru wilayah kerja puskesmas padangmatinggi kota padangsidimpuan tahun 2014 akibat hukum kelalaian debitur memenuhi perjanjian perdamaian pkpu ( study putusan no.01/pdt.khusus/pembatalan/2014/pn.niaga.mdn jo.03/pkpu/2013/pn.niaga.mdn ) hubungan pola makan aktivitas fisik pola menstruasi mahasiswi jurusan olahraga universitas negeri medan tahun 2014 pengaruh gaya kepemimpinan kinerja \birokrasi (studi kantor bupati karo, kabupaten tanah karo) isolasi analisis komponen kimia minyak atsiri bunga kemangi (ocimum basilicum l) serta uji aktivitas antioksidan antibakteri implementasi peraturan menteri negeri nomor 1 tahun 2013 tentang pemberdayaan masyarakat melalui gerakan pemberdayaan kesejahteraan keluarga ditinjau dari prespektif hukum administrasi negara (studi kabupaten kutai timur) pengaruh faktor pribadi faktor sosial pengambilan keputusan pembelian mie sedaap mahasiswa fakultas ekonomi bisnis universitas sumatera utara analisis mineral kalsium, kalium, magnesium air sumur kecamatan batang kuis secara spektrofotometri serapan atom pra rancangan pabrik pembuatan gas metana dari kotoran ayam kapasitas 6.733 ton/tahun praperlakuan fisik biologi biomassa eceng gondok produksi enzim selulase oleh aspergillus niger trichoderma reesei mekanisme pelaporan pajak pertambahan nilai kantor pelayanan pajak (kpp) pratama medan belawan tata cara pemeriksaan pajak kantor pelayanan pajak pratama medan polonia prosedur pemungutan pajak hotel meningkatkan pendapatan asli daerah (pad) dinas pendapatan kota medan formulasi gel hair tonic ekstrak kulit buah apel (malus pumila mill.) uji aktivitas pertumbuhan rambut marmut pelaksanaan surat teguran peningkatan penerimaan pajak negara kantor pelayanan pajak (kpp) pratama medan timur asuhan keperawatan ny.n prioritas masalah kebutuhan dasar mobilitas kasus stroke ruangan neorologi rumah sakit umum daerah dr.pirngadi medan asuhan keperawatan tn.b prioritas masalah kebutuhan dasar personal hygene rsu dr. pirngadi medan pengujian mutu bentuk sediaan natrium diklofenak beredar apotek kota medan asuhan keperawatan prioritas masalah gangguan eliminasi (konstipasi) rsud dr. pirngadi medan asuhan keperawatan ny. m prioritas masalah kebutuhan dasar oksigenasi rsud. dr. pirngadi medan pengaruh penetapan ibukota kecamatan perkembangan desa bandar pasir mandoge kabupaten asahan tahun 1964-1968 asuhan keperawatan tn. i prioritas masalah kebutuhan dasar gangguan rasa aman nyaman ; nyeri kasus difuse pertonitis rsud. dr. pirngadi medan an analysis of the psychological impact of sexual abuse in danielle steel’s malice asuhan keperawatan ny. m prioritas masalah kebutuhan dasar kenyamanan nyeri rsud. dr. pirngadi medan peristiwa tutur upacara mangongkal holi masyarakat batak toba desa parsoburan kecamatan habinsaran kajian sosiolinguistik asuhan keperawatan ny. y gangguan imobilisasi rsud. dr. pirngadi medan asuhan keperawatan tn. j prioritas masalah kebutuhan dasar nutrisi rsud dr. pirngadi medan pengaruh orangtua anak novel midah simanis bergigi emas karya pramoedya ananta toer tinjauan strukturalisme asuhan keperawatan ny. s prioritas masalah kebutuhan dasar mobilisasi rsud. dr. pirngadi medan asuhan keperawatan ny. x prioritas masalah kebutuhan dasar keamanan rsud dr. pirngadi medan analisis faktor-faktor memotivasi pengusaha memutuskan berbisnis asuhan keperawatan tn. h prioritas masalah kebutuhan dasar nyeri rsud. dr. pirngadi medan asuhan keperawatan ny. y prioritas masalah kebutuhan dasar nutrisi rsud. dr. pirngadi medan faktor-faktor mempengaruhi anak putus sekolah menggunakan analisis faktor konfirmatori kabupaten padang lawas utara asuhan keperawatan tn.s prioritas masalah kebutuhan dasar oksigenasi rsud dr. pirngadi medan asuhan keperawatan an.t prioritas masalah kebutuhan dasar oksigenasi rsud dr. pirngadi kota medan asuhan keperawatan ny. c prioritas masalah nutrisi kurang dari kebutuhan tubuh rs. dr. pirngadi medan analisa kajian eksperimental balok beton bertulang nonhomogen lentur murni perbandingan persentase kadar asam lemak bebas minyak sawit mentah produk dihasilkan setelah melalui proses pemurnian pemisahan pelaksanaan operasional laundry and dry cleaning housekeeping deparment grand swiss belhotel medan pelaksanaan operasional room service hotel novotel yogyakarta the description of santiago’s dream in “the alchemist” novel by paulo coelho peranan fungsi public relation memberikan pelayanan masyarakat pt. garuda indonesia (persero) tbk. medan peranan etika komunikasi bagi seorang sekretaris sub. bagian perencanaan keuangan kantor wilayah kementerian agama provinsi sumatera utara peranan gaya kepemimpinan budaya organisasi kinerja karyawan pt hexindo adiperkasa tbk medan kepuasan pelanggan atas kualitas pelayanan sistem kearsipan pt. perusahaan gas negara (persero), tbk upaya meningkatkan kedisiplinan kerja pegawai dikantor kementerian agama kabupaten deli serdang. perkembangan teknologi informasi kinerja karyawan pt perkebunan nusantara iv (persero) medan sistem kearsipan surat masuk bidang ekonomi badan perencanaan pembangunan daerah kantor walikota medan peranan customer service tingkat kepuasan nasabah pt bank sumut syariah cabang jamin ginting medan pengawasan internal gaji upah pegawai dinas tenaga kerja transmigrasi kabupaten langkat penerapan sistem informasi akuntansi perum bulog divre sumut sistem pengawasan intern gaji upah perum bulog divre sumut sistem pengendalian internal gaji upah kementerian agraria tata ruang/ badan pertanahan nasional kota medan peranan komputer sebagai alat pengolah data dinas tenaga kerja transmigrasi kabupaten langkat sistem pengendalian internal kartu atm sms banking pt. bank xxxx (persero) tbk medan sistem informasi akuntansi badan perencanaan pembangunan daerah provinsi sumatera utara sistem pengawasan internal piutang pelanggan pt. bank sumut kcp pangkalan brandan pengendalian internal aset tetap dinas perhubungan kota medan sistem pengendalian internal penerimaan pengeluaran kas balai wilayah sungai sumatera ii direktorat jenderal sumber daya air kementerian pekerjaan umum perumahan rakyat pengawasan intern aktiva tetap rumah sakit tentara tk iv 01.07.02 binjai sistem pengendalian internal atas penggajian karyawan pt. toba pulp lestari, tbk sistem pengawasan internal kas dinas kelautan perikanan provinsi sumatera utara sistem pengawasan internal penjualan pt. sarana agronusantara (san) penentuan kadar amoniak nitrat air sungai penentuan kadar ammonia (nh3) air baku air reservoir wtp mini kelambir v pdam tirtanadi secara spektrofotometri perencanaan pengawasan biaya operasional ajb bumiputera 1912 kantor wilayah medan analisis residu pestisida triazofos biji kopi kering menggunakan kromatografi gas fpd sistem pengawasan internal penggajian pegawai pt. sarana agro nusantara (san) pengaruhfraksi tandan buah segar kelapa sawit kadar minyak dihasilkan ptp.nusantaraiiiseisilau-asahan fungsi anggaran kas sebagai alat perencanaan pengawasan ajb bumiputera 1912 kantor wilayah medan analisa kadar mangan (mn) air baku reservoir secara spektrofotometri perusahaan daerah air minum (pdam) instalasi pengolahan air sunggal medan menganalisa mekanisme perhitungan klaim habis kontrak produk eka waktu ideal asuransi jiwa bersama (ajb) bumiputera 1912 kantor wilayah medan pengaruh penambahan asam formiat ph bahan baku lateks segar telah diberikan amoniak pembuatan rss hubungan sikap kerja musculoskeletal disorders penjahit pusat industri kecil menteng medan 2015 pengaruh perubahan bi rate laba pt. bank mandiri (persero) tbk. uji disolusi tablet klorpromazin hcl analisis krom valensi 6 (cr+6) air bersih spektrofotometer proyeksi jumlah pasien rawat inap rumah sakit umum kota tebing tinggi tahun 2014 metode rata-rata bergerak ganda peramalan jumlah konsumsi kalori provinsi nanggroe aceh darussalam analisis faktor-faktor mempengaruhi terjadinya kecelakaan lalu lintas kotamadya medan animasi alfabet bahasa inggris menggunakan adobe flash cs6 perancangan sistem informasi pembelian penjualan persediaan pt sari makmur tunggal mandiri medan menggunakan visual basic 6.0 sistem informasi d3 teknik informatika fakultas mipa usu berbasis web menggunakan php mysql pengaruh waktu destilasi kadar minyak atsiri penentuan kadar air lada hitam penanganan bumbu dapur asean section peningkatan kualitas produksi kitchen aryaduta hotel medan gitaigo bahasa jepang berhubungan perasaan sekilas tentang keramik jepang objek wisata osaka (osaka ni aru kankouchi) the analysis of conflicts in oscar wilde’s play“the importance of being earnest” the effect of the cunning website wish list in buddy‟s life in the novel “wish list” by john locke the analysis of theme used in paulo coelho’ novel the winner stands alone the power of the mortal cup in cassandra clare’s novel “the mortal isntrument (city of bones)” pengelolaan arsip kanwil kementerian agama provinsi sumatera utara kompetensi pengelola perpustakaan sma mitra inalum batubara pelaksanaan manajemen perkantoran bagian teknologi informasi/transformasi bisnis manajemen risiko pt. perkebunan nusantara iii (persero) medan pengaruh gaya kepemimpinan iklim organisasi kinerja pegawai badan pertanahan kota medan fungsi – fungsi manajemen disiplin kerja karyawan kantor tata usaha fakultas ekonomi bisnis universitas sumatera utara peranan budaya organisasi meningkatkan kualitas pelayanan bagian pendidikan akademik fakultas ekonomi bisnis universitas sumatera utara sistem pengendalian internal terhadapaset tetap rumah sakit umum siti hajar medan sistem pengendalian internal gaji dinas pengelolaan sumber daya air provinsi sumatera utara sistem pengendalian internal kas dinas pengeloaan sumber daya air provinsi sumatera utara anggaran biaya produksi sebagai alat menilai kinerja manajemen pt perkebunan nusantara iii (persero) medan sistem pengawasan internal gaji upah pegawai badan ketahanan pangan medan peranan sistem informasi akuntansi manajemen pengambilan keputusan program kemitraan bina lingkungan (pkbl) ptpn iv medan pengawasan internal kredit mitra binaan pt perkebunan nusantara iv (persero) medan aspek hukum pelarangan ekspor mineral mentah terkait prinsip-prinsip general agreement on tariffs and trade (gatt) perubahan pengurus anggaran dasar perseroan berkenaan pengelolaan perusahaan menurut undang-undang nomor 40 tahun 2007 persepsi penyintas banjir pergeseran solidaritas sosial (studi deskriptif masyarakat sekitar sungai deli, kelurahan sukaraja, kecamatan medan maimun). analisis pengaruh citra merek citra perusahaan keputusan pembelian kartu im3 mahasiswa fakultas ekonomi bisnis universitas sumatera utara pemeriksaan formalin mie kuning secara kualitatif analisa besar daya dukung pondasi bore pile menggunakan metode loading test ( proyek pembangunan manhattan mall condominium) penerapan model pembelajaran kooperatif tipe think pair and share (tps) meningkatkan hasil belajar peserta didik pembelajaran ips sd penelitian tindakan kelas kelas iii sd negeri 1 cadassari kecamatan tegalwaru kabupaten purwakarta pokok bahasan membedakan lingkungan alam buatan gambaran pengetahuan remaja tentang pornografi siswa kelas viii smpn 5 lembang. engd thesis, universitas pendidikan indonesia. penggunaan model cooperative learning tipe jigsaw konsep kenampakan alam pembelajaran ips meningkatkan hasil belajar peserta didik penelitian tindakan kelas siswa kelas iv sdn pucung 6 kecamatan kotabaru kabupaten karawang tahun pelajaran 2012/2013 perkembangan kesenian bajidoran kabupaten karawang tahun 1980-1990 suatu tinjauan historis pelestarian nilai-nilai sosial budaya pembelajaran hidrokarbon gem-inkuiri meningkatkan penguasaan konsep keterampilan intelektual siswa sma analisis kewajaran terjemahan wacana formal, netral, informal, literer penerapan pendekatan keterampilan proses meningkatkan hasil belajar siswa pembelajaran ilmu pengetahuan alam sekolah dasar penelitian tindakan kelas materi makhluk hidup (tumbuhan) siswa kelas iii sdn kutanagara ii kecamatan ciampel kabupaten karawang tahun pelajaran 2012/2013 efektifitas media gambar hasil belajar ipa pokok bahasan sistem pernapasan manusia penelitian eksperimen siswa kelas v sdn se-gugus iii desa galanggang kecamatan batujajar kabupaten bandung barat penerapan metode discovery meningkatkan hasil belajar siswa pokok bahasan cahaya penelitian tindakan kelas dilakukan kelas v sdn jatisari i kecamatan jatisari kabupaten karawang penerapan pendekatan contextual teaching and learning meningkatkan hasil belajar siswa pembelajaran ipa sekolah dasar penelitian tindakan kelas materi tentang konsep alat pencernaan manusia siswa kelas v sdn salamjaya tahun pelajaran 2012/2013 pengaruh etos kerja kompetensi guru survey guru mata pelajaran ekonomi sma swasta wilayah kabupaten garut efektivitas bimbingan kelompok melalui teknik bercerita mengembangkan karakter siswa lesson study and the improvements of teachers’ pedagogic competence in teaching english to young learners upaya peningkatan hasil pembelajaran ilmu pengetahuan sosial sekolah dasar melalui metode kerja kelompok penelitian tindakan kelas siswa kelas v sd negeri hegarmanah 03 kecamatan cikarang timur kabupaten bekasi 2012/2013 penerapan model cooperative tipe numbered heads together meningkatkan hasil belajar siswa pembelajaran ilmu pengetahuan sosial sekolah dasar penelitian tindakan kelas peserta didik kelas iv sdn adiarsa barat ii kecamatan karawang barat kabupaten karawang 2012/2013, materi pokok peta lingkungan setempat penerapan metode inkuiri meningkatkan hasil belajar siswa pembelajaran ipa sd penelitian tindakan kelas dilakukan siswa kelas v sd negeri cikampek barat iii kecamatan cikampek kabupaten karawang 2012/2013 implementasi media kartu kata pembelajaran kosakata peningkatan hasil belajar menulis siswa kelas iv sd negeri silebu 1 kecamatan kragilan kabupaten serang penerapan model pakem meningkatkan hasil belajar ipa siswa membiasakan hidup sehat penelitian tindakan kelas siswa kelas i sdn muara i kecamatan cilamaya wetan kabupaten karawang tahun pelajaran 2012/2013 meningkatkan hasil belajar peserta didik pembelajaran operasi hitungperkalian melalui metode discovery pengaruh penambahan ion logam bionutrien caf1 rsr1 pertumbuhan hasil panen tanaman padi gogo (oryza sativa l.) upaya peningkatan hasil belajar siswa melalui model pembelajaran quantum teaching pembelajaran ipa sekolah dasar penelitian tindakan kelas siswa kelas iva sdn sarimulya iii kecamatan kotabaru kabupaten karawang 2012-2013 ibu, ibu ibu ekspresiku seni grafis teknik cukil karet cetak saring penerapan model pembelajaran cooperative learning tipe stad meningkatkan minat belajar peserta didik pembelajaran ilmu pengetahuan sosial sekolah dasar penelitian tindakan kelas siswa kelas ii sdn 20 nagrikaler kecamatan purwakarta kabupaten purwakarta tahun pelajaran 2012/2013 peningkatan keterampilan membaca cepat menggunakan teknik skimming pembelajaran bahasa indonesia sekolah dasar penelitian tindakan kelas dilakukan kelas v sdn 3 nagri kidul kecamatan purwakarta kabupaten purwakarta 2012/2013 pengaruh kebakaran kuat tekan high strength concrete efektivitas metode reward proses pembelajaran bahasa jerman meningkatkan penguasaan kosakata siswa penerapan model collaborative inquiry meningkatkan kemampuan memecahkan masalah prestasi belajar siswa smp pembelajaran fisika pengaruh tingkat kesegaran jasmani postur ektremitas bawah cidera stres fraktur prajurit siswa wanita selama menjalani program latihan dasar militer 16 minggu pusdik kowad penelusuran minat pribadi, rekreasi, sosial dewasa kembar mengenai minat dua pasang dewasa kembar pengaruh aktivitas ritmik kemampuan motorik kasar anak taman kanak-kanak penelitian kuasi eksperimen kelompok a tk artha kencana serang banten. tahun pelajaran 2012-2013 meningkatkan hasil belajar siswa mata pelajaran ipa tentang sifat benda melalui penerapan metode eksperimen analisis tindak tutur iklan audio visual berbahasa perancis situs penggunaan multimedia interaktif modal pembelajaran savi perbandingan penguasaan teknik dasar permainan sepakbola anak usia 11-13 tahun efektivitas teknik think-pair-share meningkatkan kemampuan membaca pemahaman siswa an investigation of teacher’s strategies in teaching listening hubungan antara tipe kepribadian posttraumatic growth orang hiv/aids (odha) studi korelasi odha tergabung program pendampingan rumah cemara bandung upaya pengembangan gerak dasar menendang melalui penerapan pembelajaran aktivitas soccer like games penelitian tindakan kelas siswa kelas v sdn 1 lembang kab. bandung barat studi deskriptif kinerja masing-masing bagian lembaga penjaminan mutu pendidikan provinsi jawa bara pengaruh penerapan metode pembelajaran peta konsep meningkatkan pemahaman konsep ekonomi (studi eksperimen mata pelajaran ekonomi kelas x rintisan sekolah bertaraf internasional pasundan 2 bandung) partisipasi ketua pos kb desa kegiatan program keluarga berencana nasional suatu studi deskriptif tentang partisipasi ketua pos kb desa melaksanakan tugasnya faktor-faktor mempengaruhinya kabupaten dt ii tasikmalaya ciamis meningkatkan kemampuan mengenal konsep bilangan anak usia dini metode bermain peran studi penelitian tindakan kelaspadaanakkelompok b tk al-hikmahdi kecamatancipeucangbantentahunpelajaran 2012-2013 pengembangan media alternatif and augmentatif communication (aac) mengembangkan keterampilan komunikasi anak hambatan komunikasi efektivitas penggunaan panduan pedoman kerja pengelolaan program penyetaraan guru sltp setara d- kantor inspeksi departemen pendidikan nasional kabupaten bandung studi tentang efektivitas manajemen kegiatan mengajar sekolah dasar negeri kotamadya bandung meningkatkan gerak dasar lari gawang pembelajaran atletik melalui media kardus kelas v sdn linggar i kecamatan rancaekek kabupaten bandung studi deskriptif teknik assessment pembelajaran menyimak bahasa inggris kelas ii sdn galunggung kecamatan tawang kota tasikmalaya karakteristik hamba allāh al-qur`ān implikasinya pengembangan pendidikan islam studi tafsīr q.s. al-furqān ayat 63-70 penguatan kepemerintahan daerah baik melalui pengembangan budaya demokrasi studi tentang good governance kinerja aparatur peran civil society konteks pendidikan kewarganegaraan pemda provinsi maluku pemda kota ambon upaya kiyai membina akhlaq santri melalui kegiatan pengajian pendidikan islam pondok pesantren kempek cirebon tentang kegiatan belajar mahasiswa universitas terbuka melalui belajar kelompok penanaman nilai budaya sunda anak usia dini tk negeri pembina cianjur penelitian studi deskriptif analitik anak kelompok a kelompok b tahun pelajaran 2012/2013 peningkatan kemampuan pemahaman matematis representasi matematis siswa smp melalui pembelajaran kontekstual berbasis soft skills efektivitas pengelolaan sistem informasi personil sd oleh dinas p k kota madya dati ii pekanbaru meningkatkan kemampuan komunikasi berpikir kritis matematis siswa melalui pembelajaran berbasis masalah strategi teams-assisted individualization pengaruh bionutrien bdi penambahan ion logam pertumbuhan perkembangan tanaman padi (oryza sativa l.) keanekaragaman kelimpahan collembola kebun brokoli (brassica oleracea l.var. italicaplenck) kecamatan cisarua-cimahi latar belarang berkembangnya fungsi lembaga pendidikan pondok pesantren yamisa soreang kabupaten bandung proses membentuk kemandirian para santri kecenderungan cara berfikir anak cerdas istimewa pemecahan masalah geometri seorang anak 9 tahun diduga berbakat matematik kecenderungan berfikir sebagai pembelajar visual -spasial visual-spatial learner perencanaan pembuatan sistem pentanahan laboratarium tegangan tinggi pembelajaran berbasis masalah berbatuan software geogebra meningkatkan kemampuan pemecahan masalah matematis siswa smp strategi pengembangan permainan flying fox kebun binatang bandung peningkatan pengunjung strategi guru pendidikan agama islam mengatasi kenakalan remaja smk pgri 2 cimahi studi analisis konsep pendidikan umum surat al-fatihah pengembangan model penilaian otentik pembelajaran membaca pemahaman sekolah dasar internalisasi nilai peduli lingkungan melalui pembelajaran berbasis kearifan lokal studi sdn antasan besar 7 banjarmasin program bimbingan karir meningkatkan kemampuan perencanaan karir peserta didikprogram bimbingan karir meningkatkan kemampuan perencanaan karir peserta didik penelitian kuasi eksperimen peserta didik kelas viii smp negeri 15 bandung tahun pelajaran 2012/ 2013 efektivitas pembelajaran jasmani melalui metode kooperatif metode eksplorasi meningkatkan kecerdasan kinestetik interpersonal anak taman kanak-kanak studi eksperimen kuasi anak kelas b tk bhayangkari 43 kecamatan jatinangor kabupaten sumedang 2012/2013 the representation of americanization myths in the internet memes on the 9gag comedy website biaya pengelolaan sekolah produktivitas kerja guru individualisasi pendidikan refleksi kritis eksistensialisme søren aabye kierkegaard tentang eksistensi manusia sistem pendidikan indonesia analisis kebutuhan, pengadaan pengembangan kepala sekolah dasar negeri propinsi daerah istimewa aceh analisis kemampuan berkomunikasi siswa sma melalui poster hasil praktikum subkonsep pencemaran tanah faktor-faktor mempengaruhi motivasi belajar siswa program keahlian teknik gambar bangunan smk n 2 tasikmalaya studi tentang kreativitas kepala sekolah mengembangkan kegiatannya sebagai administrator sekolah dasar wilayah kotamadya daerah tingkat ii pekanbaru propinsi riau perilaku siswa wni keturunan cina pribumi melaksanakan program 5 k studi deskriptif analitik tentang siswa-siswa sma swasta kotamadya palembang penelusuran minat pribadi, rekreasi, sosial dewasa kembar mengenai minat dua pasang dewasa kembar hubungan hasil belajar mata kuliah kewirausahaan minat kerja mandiri mahasiswa program studi pendidikan teknik bangunan jpts fptk upi upaya guru pendidikan jasmani pelaksanaan pembelajaran pendidikan jasmani keterbatasan sarana prasarana ma ma’arif tanjungsari, ma muhamadiyah tanjungsari smk ypib farmasi tanjugsari perbedaan peningkatan hasil belajar menggunakan variasi media operasi penjumlahan pengurangan bilangan bulat penelitian kuasi eksperimen siswa kelas iv sekolah dasar negeri ciluluk 1-2 kecamatan cikancung kabupaten bandung kajian preparasi kondisi optimum ekstraksi bionutrien berbasis tanaman so-23 analisis perbaikan menu unpopular restoran dapur sunda kota jakarta penggunaan multimedia presentasi tipe stand alone meningkatkan hasil belajar siswa smk merdeka soreang,jptm fptk upi bandung pengaruh komunikasi interpersonal pimpinan karyawan komitmen organisasi karyawan pt.pln (persero) distribusi jawa barat banten area pelayanan jaringan bandung pelaksanaan belajar tuntas sekolah teknologi menengah tentang ketuntasan belajar mata pelajaran praktek kejuruan bangunan tiga stm kotamadya bandung peningkatan teknik vokal anak melalui metode imitasi paduan suara theresia voice sd st. theresia, marsudirini 77, salatiga efektifitas metode role-playing meningkatkan hasil belajar sikap siswa pembelajaran psikotropik zat adiktif sekolah menengah pertama penerapan pendekatan konstruktivisme meningkatkan hasil belajar siswa mata pelajaran ipa tentang materi wujud benda sifatnya penerapan pendekatan konstruktivisme meningkatkan hasil belajar siswa mata pelajaran ipa tentang materi wujud benda sifatnya penelitian tindakan kelas kelas iv sekolah dasar negeri binabudi kecamatan cipanas kabupaten cianjur tahun pelajaran 2012/2013 pengaruh bionutrien caf2 rsr2 penambahan ion logam pertumbuhan hasil panen tanaman padi gogo (oryza sativa l.) pembangunan sistem jual beli online menggunakan pendekatan social commerce meningkatkan pembelajaran gerak dasar chest pass bola basket melalui modifikasi permainan bola tangan (penelitian tindakan kelas siswa kelas v sdn baranangsiang kecamatan tanjungsiang kabupaten subang) fenomena kesantunan berbahasa acara indonesia lawyers club tv one penggunaan komik sebagai media pembelajaran keterampilan berbicara materi aisatsu siswa smp penelitian eksperimen semu siswa kelas vii smp taruna bakti bandung nilai-nilai kearifan lokal masyarakat cigugur-kuningan pelestarian lingkungan hidup sebagai sumber belajar geografi analisis daya terima konsumen kelayakan bisnis produk mousses berdasarkan proses berbahan dasar jagung manis pengaruh brand image purchase intention survei konsumen anata salon cabang pasirkaliki bandung gunung krakatau sebagai ide berkarya seni grafis cetak teknik etsa, aquatint, mezzotint softground the use of clustering technique in teaching writing narrative text penggunaan microsoft office powerpoint sebagai media pembelajaran pendidikan kewarganegaraan studi deskriptif analitis sma negeri 2 cimahi pemanfaatan sumber daya pendidikan ada masyarakat rangka pengembangan program wajib belajar pendidikan dasar 9 tahun kotamadya cirebon fokus studi hubungan kelembagaan mi masyarakat program bimbingan karir berdasarkan profil kompetensi karir peserta didik sekolah menengah pertama pengaruh pengetahuan kewirausahaan motivasi berprestasi sikap kewirausahaan survey mahasiswa fakultas pendidikan bahasa seni universitas pendidikan indonesia penerapan pembelajaran kontekstual cara broken triangle meningkatkan pemahaman konsep hukum bacaan nun mati/tanwin mim mati penelitian tindakan kelas siswa tunanetra kelas vii slb negeri tamansari kota tasikmalaya ppendapat dosem pendidikan kewiraan tentang pengembangan konsep ketahanan nasional ikip bandung penerapan model blended learning meningkatkan kemampuan menyusun bahan ajar tutor paud tunas mulia, pasar rebo, jakarta timur pengaruh konsentrasi inokulum monascus purpureus produksi pigmen substrat tepung kulit singkong (manihot esculenta) penggunaan metode al-barqy upaya peningkatan kemampuan membaca huruf hiragana penelitian kuasi eksperimen siswa kelas x7 sman 15 bandung implementasi analisis posisi perencanaan strategik pemerataan & peningkatan mutu pendidikan sd/mi propinsi daerah istimewa aceh pengaruh kebiasaan belajar motivasi belajar prestasi belajar siswa mata pelajaran seni budaya program bimbingan konseling pribadi sosial mengembangkan perilaku seksual sehat remaja studi deskriptif tentang perilaku seksual siswa kelas ix smpn 4 cimahi 2012/2013 subjective well-being pelaku wirausaha tergabung kelompok wirausahawan muda kota cimahi. skripsi.jurusan psikologi analisis makna fukugodoushi ~komu kalimat bahasa jepang pengaruh kemampuan usaha keberhasilan usaha penerima hibah bawaku makmur kelurahan gegerkalong pengembangan model pembelajaran meningkatkan akhlak mulia peserta didik mata pelajaran pai madrasah diniyah awwaliyah (mda) penerapan model pembelajaran fisika berbasis proyek meningkatkan pemahaman konsep kemampuan berpikir kreatif siswa sma pelaksanaan komunikasi total (komtal) pembelajaran tematik anak tunarungu kelas persiapan slb-b cicendo bandung meningkatkan kemampuan siswa merengga motif batik memanfaatkan tumbuhan sebagai sumber gagasan smp negeri 12 bandung tari topeng mak yong sanggar mak yong cilik tanjungpinang provinsi kepulauan riau pengaruh modifikasi bentuk ukuran ring hasil pembelajaran lay up shoot permainan bolabasket siswa mi miftahulfalah kajian tata ruang sas center smk negeri 6 bandung penerapan pendekatan inkuiri pembelajaran ipa materi gaya meningkatkan hasil belajar siswa studi konseptual tentang landasan pendidikan umum surat luqman penggunaan media kartu kata meningkatkan kemampuan membaca permulaan anak tunarungu kelas iii slb b-c fadhilah penerapan teknik kata kunci meningkatkan keterampilan menulis puisi siswa kelas v sekolah dasar negeri sukajaya kabupaten bandung barat upaya meningkatkan hasil belajar siswa pembelajaran senam melalui konsep bermain penelitian tindakan kelas siswa kelas iv sdn cisitu 1 penggunaan metode keterampilan proses meningkatkan hasil belajar siswa menulis puisi kelas v sdn panibungan kecamatan anyar serang – banten reduksi miskonsepsi siswa melalui pembelajaran remedial menggunakan strategi konflik kognitif materi kelarutan hasil kali kelarutan pengembangan bahan ajar matematika berkarakter materi persegi panjang persegi upaya meningkatan kemampuan koneksi disposisi matematis siswa smp internalisasi nilai kebersamaan melalui pembelajaran seni gamelan sunda sebagai upaya pendidikan karakter bagi mahasiswa jurusan karawitan sekolah tinggi seni indonesia bandung efektivitas penerapan model pembelajaran kooperatif murder pembelajaran pola kalimat dasar bahasa jepang eksperimen siswa kelas xi sman 15 bandung pengaruh pembelajaran berbasis kewirausahaan melalui pembuatan awetan insekta penguasaan konsep klasifikasi sikap wirausaha siswa pengaruh persepsi, motivasi, lingkungan sosial minat peserta didik memilih program studi ilmu pengetahuan sosial (ips) efektivitas penggunaan metode analisis kontrastif peningkatkan kemampuan siswa ilmu nahwu studi kuasi eksperimen siswa kelas xi ma pesantren persatuan islam 60 katapang bandung 2012/2013 penerapan model simulasi meningkatkan keterampilan membawakan acara penelitian tindakan kelas viii e siswa smpn 19 bandung 2012/2013 tingkat kesadaran nilai-nilai moral siswa-siswa sma negeri kotamadia bandung studi deskriptif mengenai tingkat kesadaran nilai-nilai moral siswa-siswa sering meninggalkan sekolah tari persembahan sekapur sirih sanggar karya seni kabupaten belitung peranan pembelajaran pendidikan kewarganegaraan membina karakter disiplin siswa smp negeri kabupaten subang penerapan metode demonstrasi mata pelajaran menetaskan telur kompetensi dasar memilih telur tetas meningkatkan hasil belajar siswa kelas x agribisnis ternak unggas (atu) smk negeri 1 cikalongkulon pengaruh iklim organisasi motivasi kerja produktivitas kerja karyawan bagian produksi pt megah nusantara perkasa cibinong-bogor pengaruh persepsi peserta diklat tentang pemberian penguatan positif keaktifan belajar pembelajaran menulis karangan eksposisi analisis proses berbasis kecakapan vokasional metode kolaborasi studi eksperimen siswa kelas xi akuntansi smk mutiara baru kota bekasi 2013/2014 pemanfaatan hasil pengukuran titik kontrol gps geodetik sebagai georeferencing hasil pengukuran tls (terrestrial laser scaner) pembangunan jalur kereta api wilayah jakarta implementasi mata kuliah budaya sunda sebagai muatan lokal pembinaan akhlak mahasiswa fkip unpasupaya pendidikan nilai moral membina disiplin siswa dl sekolah studi tentang upaya guru membina disiplin siswa smu negeri 2 bandung pengaruh model pembelajaran quantum teaching model pembelajaran langsung (direct instruction) peningkatan kemampuan pemahaman matematik siswa sekolah dasar studi eksperimen kuasi sdn pancasila lembang kabupaten bandung barat pengaruh penggunaan media pembelajaran geometri kemampuan mengenal bangun datar anak tunagrahita ringan perkembangan pondok pesantren miftahul huda dampaknya kehidupan sosial keagamaan masyarakat kabupaten tasikmalaya (1980 – 2009) politeness strategies used by an indonesian native speaker in a casual conversation penggunaan simulator it essential virtual desktop cisco meningkatkan penguasaan konsep perakitan personal komputer pengembangan pembelajaran aktivitas permainan bola kecil mengembangkan nilai-nilai kerjasama pengaruh penggunaan media pembelajaran animasi komputer peningkatan kemampuan mengenal huruf anak tunagrahita ringan penggunaan mind mapping pembelajaran ipa materi sumber daya alam meningkatkan hasil belajar siswa semiotika visual karya fotografi pemenang “pos indonesia photo contest 2010” pengaruh pengalaman belajar kewirausahaan pengetahuan kewirausahaan survey mahasiswa fakultas pendidikan ekonomi bisnis universitas pendidikan indonesia desain didaktis konsep komposisi fungsi pembelajaran matematika sma meningkatkan tanggung jawab siswa melalui model jigsaw pembelajaran ips penelitian tindakan kelas pembelajaran ips kelas viii-12 smp negeri 1 bandung proses pengembangan gerak motorik kasar anak usia dini melalui pembelajaran tari sisingaan analisis pengaruh tata letak peralatan optimasi kinerja kitchen restoran sindang reret bandung the use of picture books in teaching literacy to young learners pengaruh kemampuan manajerial diferensiasi produk pendapatan pengusaha emping melinjo kecamatan kedawung kabupaten cirebon efektivitas bimbingan pranikah mengembangkan sikap positif remaja pernikahan studi pra-eksperimen siswa kelas xi sma pgri 1 bandung 2013/2014 pengaruh penilaian portofolio hasil belajar siswa tentang pesawat sederhana sekolah dasar pengaruh biaya operasional profitabilitas perusahaan industri manufaktur terdaftar bei penerapan pendekatan konstruktivisme pembelajaran matematika materi pokok pecahan meningkatkan hasil belajar siswa penelitian tindakan kelas dilaksanakan siswa kelas iv sdn banyuhurip kecamatan lembang kabupaten bandung barat tahun pelajaran 2012/2013 der einsatz der lieder zur verbesserung der aussprache. abschlussarbeit pengaruh aktivitas ritmik kemampuan motorik kasar anak taman kanak-kanak tindak tutur meminta personal values kajian pragmatik tentang personal values guru siswa realisasi tindak tutur meminta guru respon siswa penerapan model pembelajaran kooperatif tipe stad meningkatkan hasil belajar aspek kognitif kemampuan interpretasi grafik siswa smp pemanfaatan media iklan produk lejel home shopping pembelajaran berbicara kelas x smkn 12 bandung analisis kompetensi caretaker berdasarkan skkni program pelatihan perawat lanjut usia pengendalian persediaan obat menggunakan metode probabilistik p pengaruh model pembelajaran kooperatif tipe cooperative integrated reading and composition (circ)terhadap kemampuan membaca karangan narasi penelitian eksperimen kemampuan membaca karangan narasi pembelajaran bahasa indonesia siswa sd negeri 2 parakanlima kelas v 2012-2013 penerapan teknik unjuk tutur kemampuan siswa menceritakan tokoh idola pelaksanaan pembelajaran tari jaipong bagi siswa tunagrahita ringan slb c purnama asih bandung penerapan mind mapping pembelajaran ipa materi daur air meningkatkan kemampuan kreatif siswa penelitian tindakan kelas siswa kelas v sdn 2 cibodas kecamatan lembang kabupaten bandung barat 2012/2013 pengembangan alat evaluasi menyimak apresiatif novel mata pelajaran bahasa indonesia smp kelas viii semester 2 cerminan budaya leksikon perkakas pertanian tradisional bahasa sunda studi etnolinguistik desa pangauban,kecamatan pacet, kabupaten bandung meningkatkan hasilbelajarsiswa padamata pelajaran ipa tentang sifat benda melalui penerapan metode eksperimen peningkatan hasil belajar ipa melalui penerapan pendekatan kontekstual sekolah dasar penelitian tindakan kelas siswa kelas iv materi hubungan antara makhluk hidup lingkungannya sdn pabuaran ii kecamatan pabuaran kabupaten subang 2012/2013 program bimbingan pribadi sosial mengembangkan konsep diri siwa pengaruh media kartu kata bergambar meningkatkan kemampuan menulis kata anak tunagrahita ringan penelitian eksperimen desain single subject research anak tunagrahita ringan kelas iv slb-b/c bina mandiri bogor pengaruh motivasi produktivitas kerja karyawan pt. inti (persero) bandung studi karyawan divisi manajemen sumber daya manusia studi penguasaan pengetahuan stimulasi perkembangan anak peserta bina keluarga balita desa cikeruh pengaruh program keselamatan kesehatan kerja (k3) kinerja karyawan pt len industri ( persero) bandung tahun 2009-2011 mengatasi kesulitan siswa kelas v sdn kadupandak 1 menulis karangan deskripsi gambar tunggal tari dwimuka karya didik nini thowok model pembinaan akhlak sma negeri 20 bandung sistem pengelolaan koperasi sekolah membina karakter kebangsaan studi deskriptif koperasi sekolah smk negeri 1 ciamis the effectiveness of small group discussion method in teaching reading pemaknaan kompensasi karyawan kontrak bagian sales studi fenomenologi perusahaan bergerak bidang penjualan kota bandung, bogor jakarta pengaruh penggunaan musik program audio pembelajaran peningkatan hasil belajar menyimak unsur instrinsik novel remaja eksperimen mata pelajaran bahasa indonesia siswa kelas viii smp negeri 1 lembang analisis perencanaan agregat biaya relevan minimum perusahaan 45 industry regresi spasial pendekatan geographically weighted poisson regression (gwpr) banyak penderita kusta kering tahun 2012 beberapa kota kabupaten provinsi jawa barat analisis scada penyaluran pusat pengaturan beban( p3b)region 2 area pengaturan beban (apb) cigereleng meningkatkan literasi matematis siswa melalui pendekatan keterampilan proses matematis studi kuasi eksperimen siswa madrasah tsanawiyah pengaruh pembelajaran resiprokal pembelajaran kontekstual materi sistem ekskresi keterampilan menulis berpikir kritis kontribusi keikutsertaan nihon kurabu kemampuan berbicara bahasa jepang pengaruh pendidikan pelatihan (diklat) kearsipan profesionalisme arsiparis bapusipda (badan perpustakaan kearsipan daerah) se-bandung raya pengaruh penggunaan audio visual pencapaian “kompetensi dasar mengolah stock, soup sauce”siswa smk 3 cimahi instructional media in teaching english to young learners a case study in elementary schools in kuningan students’ ability and difficulties in writing news item texts the use of total physical response method in teaching vocabulary to young learners a quasi experimental study in the third grade of an elementary school in bandung analisis struktural puisi mantra désa cimindi kacamatan cigugur kabupatén ciamis pikeun bahan pangajaran aprésiasi puisi sma kelas x penggunaan media tusuk puzzle pembelajaran persebaran hasil sumber daya alam dapat diperbaharui propinsi jawa barat meningkatkan hasil belajar siswa kelas iv sdn pasarean kecamatan sumedang selatan analisis relevansi desain kegiatan laboratorium kompetensi dasar konsep struktur fungsi sel desain didaktis pembelajaran ipa materi cahaya sekolah dasar keanekaragaman kelimpahan lepidoptera objek wisata hutan lindung curug sawer cililin bandung barat gambaran spiritualitas pelaku konversi agama studi fenomenologis 2 orang mualaf ypm salman itb bandung pemanfaatan jejaring facebook asesmen portofolio online menilai kreativitas siswa smp prktikum penjernihan air penerapan permainan sule meningkatkan kemampuan melengkapi bagian cerita hilang (rumpang) (penelitian tindakan kelas kelas iv sd negeri buahdua ii kecamatan buahdua kabupaten sumedang) peningkatan kemampuan berpikir kreatif siswa smp melalui pembelajaran matematika strategi relating, experiencing, apllying, cooperating, transffering (react) pengaruh metode pembelajaran menyenangkan (joyfull learning) keterampilan berpikir kreatif siswa kelas iv materi perubahan lingkungan games as warming-up activities in young learners’ classrooms at an english course pengelolaan sistem ujian negara meningkatkan fungsi keluaran kantor kopertis beberapa pts lingkungan kopertis wilayah vii jawa timur pengaruh kompetensi kewirausahaan keberhasilan usaha survei pengusaha industri genteng jatiwangi kecamatan jatiwangi kabupaten majalengka hubungan pengetahuan ibu pengetahuan anak tentang gizi lapangan remaja lingkungan ssb pengaruh olahraga tradisional bebentengan kemampuan motorik (motor ability) anak usia 6-8 tahun analisis kualitas ilustrasi desain busana mata kuliah proyek desain mode penerapan metode demonstrasi meningkatkan hasil belajar siswa pembelajaran ipa tentang cahaya sifat-sifatnya implementasi kompetensi profesional meningkatkan berpikir kritis siswa pembelajaran pkn studi deskriptif siswa kelas vii smp negeri 15 bandung pengaruh kualitas produk wisata keputusan berkunjung wisata pakuhaji survey wisatawan berkunjung ke pakuhaji penggunaan teknik imajinasi objek pembelajaran menulis puisi penelitian eksperimen siswa kelas x smkn 3 bandung 2012/ 2013 analisis efektifitas pengendalian food cost guna mengoptimalkan gross profit nirwana beach club restaurant nirwana gardens resort bintan perbandingan pengaruh gaya mengajar resiprokal gaya mengajar komando hasil belajar permainan tenis meja kelas viii smp negeri 4 tasikmalaya pengaruh pengulangan teknik permainan olahraga bola basket peningkatan kemampuanmotorik kasar (gross motor)anak tunagrahita ringan usia mental 5 - 9 tahun pengaruh pengulangan terknik permainan olahraga bola basket peningkatan kemampuan motorik kasar (gross motor) anak tunagrahita ringan usia mental 5 - 9 tahun studi eksperimen slb-g ybmu baleendah kabupaten bandung hubungan persepsi karyawan tentang efektivitas komunikasi organisasi kepuasan kerja karyawan pt. pos indonesia manfaat hasil belajar batik ikat celup sebagai kesiapan menjadi textile designer penggunaan multimedia interaktif model pembelajaran savi(somatic,auditory,visual,intelektual)dalam mata pelajaran teknologi informasi komunikasi studi kuasi eksperimen siswa kelas vii smpn 44 bandung implementasi pengawasan melekat dampaknya kinerja karyawan dinas pendidikan pengajaran kota bogor taahun 1999/2000 sistem pendukung keputusan pemilihan produksi sepatu sandal metode elimination et choix traduisant la realité (electre) perubahan status kepemilikan lahan pertanian kondisi sosial ekonomi masyarakat petani desa mekarwangi kecamatan lembang kabupaten bandung barat kecerahan langit malam arah zenit observatorium bosscha analisis awal waktu shubuh isya menggunakan sky quality meter pengaruh kinerja line extensions brand equity implikasi kebijakan pendidikan lingkungan departemen agama pengelolaan tenaga kependidikan madrasah aliyah man 1 kotamadya bandung kanwil dep. agama propinsi jawa barat perencanaan ulang struktur atas jembatan komposit desa tegal gubug blok rembes kabupaten cirebon pengaruh penggunaan media gambar kemampuan kosakata bahasa arab study eksperimen kuasi anak usia prasekolah tk firdaus percikan iman bandung 2012/2013 pengaruh penerapan latihan hipoksik menggunakan metode aktivasi neural bentuk latihan squat peningkatan power otot tungkai karakteristik pasta tio2 aplikasi dye sensitized solar cell (dssc) fleksibel . the implementation of cooperative learning student teams-achievement divisions technique in teaching reading comprehension analisis faktor-faktor kesulitan mahasiswa jurusan pendidikan teknik arsitektur fptk upi penyelesaian skripsi meningkatkan kemampuan pemahaman komunikasi matematika menggunakan model pendekatan realistic mathematics education (rme) siswa sekolah dasar studi kuasi eksperimen kelas iii sekolah dasar kecamatan sukajadi kota bandung tahun pelajaran 2011-2012 perbandingan efektivitas pembelajaran tutor sebaya model konvensional proses pembelajaran praktikum membuat pesawat elektronika 2 penerapan kompetensi tutor menumbuhkan kreativitas belajar anak usia dini melalui kegiatan bermainpada lembaga paud kembang pura ujungberung bandung pengaruh inovasi keberhasilan usaha pengusaha sentra industri kaos suci bandung eksperimen penggunaan media tutorial interaktif meningkatkan prestasi belajar siswa penelitian eksperimen smk negeri 2 garut kelas xi jurusan teknik gambar bangunan semester 1 2012/2013 penerapan metode eksperimen pembelajaran ipa meningkatkan hasil belajar siswa materi pesawat sederhana penelitian tindakan kelas mata pelajaran ipa kelas v sdn jenet kecamatan cikalongkulon kabupaten cianjur tahun pelajaran 2012-2013 analisis kebutuhan ruang parkir rumah sakit mata cicendo bandung pengembangan tes keterampilan menulis sebagai upaya penyiapan alat uji kemahiran berbahasa indonesia bagi penutur asing pengaruh penerapan model pembelajaran teams games tournament games cepat tepat penguasaan konsep sistem ekskresi pengaruh teknik cooperative learning menurunkan kecemasan komunikasi (communication apprehension) anak berbakat teman sebaya studi eksperimen siswa kelas xii program akselerasi sma negeri 3 kota sukabumi modél the learning cell dina pangajaran maca biografi studi kuasi ékspérimén ka siswa kelas xi ipa 2 sma negeri 13 bandung taun ajaran 2012/2013 pengaruh tekanan peran (role stress) kinerja auditor kantor akuntan publik kota bandung penggunaan media foto mengembangkan kemampuan kosakata menjadi kalimat bahasa jepang the use of commissive speech acts and its politeness implicationa case of banten gubernatorial candidate debate pengaruh efisiensi modal kerja profitabilitas studi koperasi pegawai dinas koperasi 12 juli pengaruh aktivitas jasmani permainan aktivitas luar sekolah kepedulian sosial siswa kelas x sma negeri 1 margahayu hubungan antara s1kap mahasiswa materi bidang studi metodologi pengajaran teknik prestasi belaiar studi deskriptif mahasiswa ttuc ( technical teacher upgrading centre ) bandung angkatan viii analisis kemampuan membaca teks berbahasa jerman siswa sma negeri 1 cibeber cianjur penerapan media pembelajaran animasi meningkatkan prestasi belajar siswa dasar kompetensi kejuruan dasar-dasar permesinan isolasi chitosan kulit udang pemanfaatannya buah strawberry(fragrariaananassa) die anwendung des videofilms als begleitmaterial des lehrwerkes studio d a1 zur verbesserung des hörverstehensergebnisses der schüler pembelajaran berbasis masalah meningkatkan kemampuan disposisi berpikir kritis matematis siswa sma modifikasi media pembelajaran meningkatkan waktu aktif belajar siswa penelitian tindakan kelas siswa kelas v sdn leuwimanggu cianjur perbandingan penggunaan lks teks, gambar, videoterhadap keterampilan proses sains pengetahuan prosedural pengaruh pelaksanaan penilaian kinerja motivasi kerja studi persepsional pt. askes (persero) kcu bandung ulikan tasawuf dina guguritan sinom gurinda pangrasa karya radén haji muhamad syu’eb analisis struktural jeung hermeneutik anak taman kanak-kanak mengalami hambatan berbicara statistika pengendalian mutu metode t2 hotelling data subgrup pengendalian kualitas teh pt perkebunan nusantara viii analisis kinerja storytelling brand equity produk minuman berkarbonasi merek coca cola pengaruh penerapan model cooperative learning tipe stad proses hasil pembelajaran karate nomor kata studi eksperimen mahasiswa pjkr upi perkuliahan pembelajaran karate 2012/2013 penerapan konsep pendidikan luar sekolah pembinaan penyuluhan industri kecil studi tentang proses pembelajaran pengusaha industri kecil kain besurek kotamadya bengkulu peningkatan mutu pembelajaran mata kuliah kurikulum pembelajaran melalui media lembar kerja mahasiswa penelitian tindakan kelas padamata kuliah dasar keguruan universitas pendidikan indonesia efektivitas teknik permainan bingo meningkatkan penguasaan kosakata bahasa jepang tingkat dasar kontribusi penguasaan mata kuliah kelompok praktikum bangunan pemahaman metode pelaksanaan konstruksi bangunan gedung mahasiswa program studi pendidikan teknik bangunan jpts fptk upi pengembangan green behaviour melalui model pembelajaran pelayanan(service learning)dalam mata pelajaran ips penelitian tindakan kelas siswa kelas vii-f smp negeri 4 bandung potensi pengembangan produksi ubi jalar (ipomea batatas l.) kecamatan cilimus kabupaten kuningan perbedaan pengaruh media pembelajaran balok flashcard sebagai alat permainan edukatif meningkatkan kreativitas anak usia dini studi eksperimen quasi kelompok b taman kanak-kanak negeri pembina sungaiselan bangka tengah 2012-2013 analisis nilai-nilai kewirausahaan pembelajaran ips sekolah dasar siswa kelas iv sdpn pajagalan 58 bandung studi tentang produktivitas tenaga edukatif ikip bandung pengawasan pelaksanaan pendidikan penyetaraan guru sekolah dasar kotamadya pekanbaru analisis phet ph scale membangun konsep larutan asam basa keterampilan proses sains siswa sma perbandingan penguasaan teknik dasar permainan sepakbola anak usia 11-13 tahun studideskriptif ssb dari kota bandung ssb dari kota cimahi efektivitas metode pembelajaran ki hajar dewantara meningkatkan kesadaran ibadah harta bagi siswa sma pgii 2 bandung penerapan metode hypnoteaching berbasis pemecahan masalah pembelajaran menyimak informasi meningkatkan kelincahan dalamkebugaranjasmani melalui permainan ambil bendera modelteams games tournament (tgt) (penelitian tindakan kelas siswa kelas v sdn mandalaherang ii kecamatan cimalaka kabupaten sumedang) implementasi model pembelajaran multi-strategi meningkatkan keterampilan menulis kreatif fakultas ilmu seni sastra universitas pasundan bandung analisis kesalahan penggunaan ~bekida ~nakerebanaranai kalimat bahasa jepang deskriptif mahasiswa tingkat ii jpbj fpbs upi 2012/2013 tenun songket palembang 1980-2000 kajian sosial budaya tentang warisan budaya masyarakat kelurahan 30 ilir kecamatan ilir barat palembang pengaruh pembelajaran praktikum kompetensi siswa mata pelajaran kewirausahaan survei siswa kelas xi smk negeri 1 subang simbol-simbol dina upacara tradisi guar bumi blok kampék désa salawana kacamatan dawuan kabupatén majalengka pikeun alternatif bahan pangajaran maca artikel budaya sma kelas xii kajian nilai moral cerita pendek majalah bobo sebagai upaya pemilihan bahan ajar apresiasi sastra kelas tinggi sekolah dasar pendayagunaan tenaga administratif lingkungan kantor dinas pendidikan studi tentang pendayagunaan tenaga administrarif rangka pelaksanaan otonomi daerah kantor dinas pendidikan kabupaten bandung) pengaruh penerapan quantum learning prinsip tandur peningkatkan kemampuan komunikasi matematis siswa smp pengaruh penggunaan model pembelajaran cooperatif tipe student teams achievement divisions (stad) prestasi belajar siswa kelas xi mata pelajaran ilmu bangunan gedung smk negeri 5 bandung pembelajaran ibing pencak silat siswa sdn 4 munjul jaya purwakarta penerapan model pembelajaran pembuktian meningkatkan kemampuan berpikir matematis tingkat tinggi siswa sma penerapan model cooperative learning tipe snowball throwing meningkatkan hasil belajar siswa mata pelajaran ipa tentang materi energi panas sifatnya penelitian tindakan kelas kelas iv madrasah ibtidaiyah futuuhiyah kecamatan cipanas kabupaten cianjur tahun pelajaran 2012/2013 implementasi multimedia interaktif pembelajaran fisika smp meningkatkan pemahaman konsep analisis kesalahan penggunaan settougo fu- mu- kalimat bahasa jepang mahasiswa tingkat iii jurusan pendidikan bahasa jepang fpbs upi 2012/2013 studi evaluatif kegiatan monitoring penampilan mengajar para dosen politeknik bandung oleh pedc penerapan pendekatan sains teknologi masyarakat (stm) konsep peristiwa alam beserta dampaknya meningkatkan hasil belajar siswaptk kelas v sekolah dasar negeri teras 1 kecamatan carenang kabupaten serang 2012/2013 kontribusi peran komite sekolah income generating sekolah sd negeri kecamatan sumur bandung meningkatkan hasil belajar siswa konsep hubungan khas antarmakhluk hidup menggunakan media komik ptk kelas iv sd negeri cijeruk kecamatan kibin kabupaten serang 2012/2013 lagu cublak-cublak suweng sebagai stimulus kreativitas gerak tari siswa paud babussalam kab.sukabumi meningkatkan hasil belajar siswa melalui pendekatan pailkem (pembelajaran aktif inovatif lingkungan kreatif efektif menarik) konsep perubahan kenampakan bumi benda langit pendekatan pengajuan masalah secara berkelompok meningkatkan kemampuan representasi visual matematik siswa smp pengaruh pembelajaran matematika berbasis ict kemampuan pemahaman pemecahan masalah matematis siswa smp carita maung padjajaran kecamatan surade struktur, proses penciptaan, konteks penuturan, fungsi, makna meningkatkan kemampuan berhitung anak usia dini melalui permainan book scavenger hunt pengaruh solvabilitas harga saham perusahaan sektor properti bursa efek indonesia (bei) periode 2008 – 2011 pengaruh kreativitas motivasi belajar siswa hasil belajar siswa mata pelajaran penanganan material smk negeri 2 bandung pengaruh pengembangan keprofesian berkelanjutan peningkatan kompetensi profesional guru sekolah dasar se-kecamatan pasirwangi pengaruh penggunaan media audio visual proses pembelajaran motivasi belajar siswa efektivitas pembelajaran metode tartila meningkatkan kompetensi siswa membaca al-qur’an sekolah dasar peningkatan kemampuan pemecahan masalah matematis siswa sekolah dasar kelas v melalui metode penemuan terbimbing kontribusi hasil belajar analisis model busana minat menjadi pattern maker butik kajian kualitas air tanah sekitar kawasan budidaya ikan keramba jaring apung waduk jatiluhur kabupaten purwakarta pengaruh metode multisensori kemampuan membaca dini anak usia dini penelitian kuasi eksperimen anak kelompok a tk merpati pos 2 kota bandung tahun pelajaran 2012-2013 peningkatan kemampuan representasi matematis siswa smp melalui penerapan pendekatan metakognitif pengembangan modul peningkatan kinerja guru pembelajaran sekolah dasar inklusif puisi sawér pangantén kacamatan nusahérang kabupatén kuningan pikeun bahan pangajaran ngaregepkeun smp analisis tingkat pemahaman aparatur pemerintah mengenai psap no. 12 laporan operasional pengelolaan pembelajaran rampak bedug sanggar bale seni ciwasiat pandeglang pengaruh model circ (cooperative integrated reading and composition) efektivitas pembelajaran seni tari siswa kelas vii smp yas bandung pengembangan atraksi wisata pantai nongsa sebagai kawasan wisata bahari kota batam karakterisasi morfologi hubungan filogenetik sepuluh kultivar nanas (ananas comosus (l.) merr.) kabupaten subang magic laws and the functions of fantasy in a fantasy novel penyelenggaraan administrasi akademik berdasarkan sistem kredit semester usaha meningkatkan proses belajar mengajar analisis efisiensi penggunaan faktor-faktor produksi industri sohun kabupaten cirebon penggunaan teknik permainan kotak kata upaya meningkatkan keterampilan berbicara penelitian tindakan kelas siswa kelas x sma negeri 3 cimahi 2012/2013 efektivitas penerapan metode kooperatif model tgt (team – game – tournament) pembelajaran menulis argumentasi kuasi eksperimen siswa kelas xi smkn 1 cimahi 2012/2013 pengaruh mutasi pegawai kepuasan kerja karyawan badan kepegawaian daerah kota bandung profil konsistensi representasi konsistensi ilmiah siswa smp konsep gerak budaya organisasi peningkatan mutu pendidikan persekolahan swasta studi kohesivitas, kelenturan, daya dukung budaya organisasi peningkatan mutu proses pendidikan persekolahan aj-irsyad al-islamiyyah kotamadya tegal pengaruh proses perencanaan partisipatif kinerja manajerial kepala sekolah efektivitas implementasi manajemen berbasis sekolah (mbs) sekolah dasar (sd) kecamatan pangkalan kuras kabupaten pelalawan riau analisis soal snmptn biologi berdasarkan domain kognitif taksonomi bloom revisi profil capaian siswa sma kelas xii pengaruh efisiensi biaya pemeliharaan mesin produktivitas produksi pt raya sugarindo inti tasikmalaya analisis kata ooi, takusan ippai sebagai sinonim kalimat bahasa jepang pujhan nilai filosofis pendidikan oleh dosen mkdu sebagai tenaga edukatif perguruan tinggi suatu studi dosen mkdu ikip bandung kajian semiotik novel perempuan berkalung sorban karya abidah el khalieqy pengaruh metode tipot (titik potong) meningkatkan pemahaman siswa kelas iv materi perkalian (penelitian eksperimen kelas iv sdn 2 paniis sdn 1 paniis kecamatan pasawahan kabupaten kuningan) pengaruh kompetensi guru disiplin belajar prestasi belajar siswa mata pelajaran ekonomi survey sma swasta kecamatan bogor barat pengaruh penerapan metode eksperimen nyata, virtual, gabungan pembelajaran ipa berbasis inkuiri pencapaian kemampuan kognitif keterampilan proses sains siswa sd pengaruh physical evidence pemandian air panas ciwalini keputusan berkunjung wisatawan survei wisatawan nusantara pemandian air panas ciwalini-ciwidey kabupaten bandung penerapan model kooperatif learning type team games tournament (tgt) meningkatkan pemahaman siswa konsep perubahan kenampakan bumi benda langit penelitian tindakan kelas kelas iv sdn anyer iv analisis kesalahan pembentukan kalimat bentuk perfekt karangan narasi mahasiswa keefektifan metode bbb (berpikir-berpasangan-berbagi) berorientasi multikultur pembelajaran membaca kreatif penelitian eksperimen semu siswa kelas vii smp laboratorium percontohan upi 2012/2013 dinamika pengambilan keputusan mantan anggota geng motor empat orang mantan anggota geng motor kota bandung pengaruh jus daun jati belanda (guazuma ulmifolia lamk.)terhadap berat histologi ginjal mencit (mus musculus l.) galur swiss webster pengembangan fasilitas wisata kawasan wisata waduk darma kabupaten kuningan pembelajaran tata boga kue sistik bagi siswa cerebral palsy spastik slb-d ypac bandung penerapan remedial teaching variasi metode oleh guru remedial teaching variasi metode oleh tutor sebaya meningkatkan penguasaan konsep fisika siswa smk pengaruh dari implementasi tipe pengelompokan meningkatkan hasil belajar interaksi siswa topik pencemaran lingkungan siswa sekolah menengah pertama pengaruh unique selling proposition brand equity minuman isotonik merek mizone survei komunitas mizone 100% indonesia pengaruh penggunaan w3schools hasil belajar domain kognitif siswa materi pemrograman web mata pelajaran tik pengembangan bahan ajar piano berbasis nilai lagu daerah indonesia analisis kemampuan pembelajar bahasa jepang upi kata tunjuk kore sore are pemetaan bahasa sunda dialek bojong kabupaten purwakarta jawa barat kajian geografi dialek pengaruh model pembelajaran pendekatan taktis antara kelompok motorik tinggi kelompok motorik rendah hasil belajar permainan futsal smk negeri 3 cimahi dampak pembelajaran hoki perkembangan karakter kebugaran jasmani siswa sma negeri 26 bandung analisis metafora berita olahraga implikasinya bagi pembelajaran bahasa indonesia sma kajian deskriptif analitik berita olahraga surat kabar indonesia pengaruh pengetahuan kewirausahaan efikasi diri intensi berwirausaha program bimbingan konseling pribadi sosial meningkatkan kemandirian perilaku siswa studi deskriptif siswa kelas xi jurusan administrasi perkantoran smk pasundan 3 bandung 2012/2013 studi evaluasi program praktik kerja industri smk negeri 8 bandung eksplorasi pola komunikasi diskusi menggunakan moodle perkuliahan simulasi pembelajaran kimia analisis kesesuaian cakupan materi bahan ajar kompetensi dasar buku teks biologi smp pengaruh tata ruang kantor stress kerja karyawan bagian produksi perusahaan daerah air minum (pdam) tirtawening kota bandung upaya meningkatkan hasil belajar matematika soal cerita melalui strategi pembelajaran kontekstual siswa kelas v sdlb slb a perwari kabupaten kuningan efektivitas teknik drama menggantung pembelajaran menulis cerpen penelitian eksperimen semu siswa kelas x sman 7 bandung 2012/2013 landasan pengetahuan upaya guru membuat melaksanakan fancangan satuan pembelajaran sekolah lanjutan tingkat pertama bandung penerapan teknik pembelajaran picture and picture meningkatkan pemahaman siswa tentang kenampakan alam sd penelitian tindakan kelas kelas v sdn 4 pamalayan kecamatan cijeungjing kabupaten ciamis minat kerja mahasiswaprogram studi pendidikan teknologi agroindustri fakultas pendidikan teknologi kejuruan universitas pendidikan indonesia pengaruh penerapan metode role playing motivasi belajar keterampilan sosial siswa mata pelajaran ips metode fuzzy time series berdasarkan selisih data historis metode chen penentuan interval berbasis rata-rata sistem pendukung keputusan kelayakan mitra pembiayaan syariah metode multi attribut global inference of quality (magiq) analytical hierarchy process (ahp) analisis kelayakan multimedia interaktif biologi sma materi sel, jaringan tumbuhan, jaringan hewan, sistem gerak manusia, sistem peredaran darah efektivitas penggunaan gesture (gerak isyarat) pengajaran verba (doushi) kelas xi sman 1 lembang pengaruh efesiensi modal kerja profitabilitas ksp rukun wargi pengaruh penggunaan model contextual teaching and learning (ctl) motivasi belajar bahasa arab siswa penggunaan media visual meningkatkan minat belajar siswa kelas viia smpn 1 bojonggenteng, kabupaten sukabumi pengembangan atraksi kesenian sebagai faktor pendukung guna meningkatkan kepuasan pengunjung kampung daun pengaruh metode praktek distribusi metode praktek padat hasil belajar pembelajaran permainan bola bakar manfaat praktikum anatomi fisiologi ternak kemampuan uji performan itik penerapan metode continuous review system (metode q) sistem pengelolaan persediaan barang berbasis web toko barokah peningkatan keterampilan menulis surat pembaca bersumber dari media online analisis pengaruh pembebanan sistem tenaga listrik tiga fasa. engd thesis, universitas pendidikan indonesia. analisis pertumbuhan tanaman kubis (brassica oleracea) tanah terakumulasi logam berat kadmium (cd) perkebunan pangalengan kabupaten bandung students’ self-efficacy in speaking english a study of students’ self-efficacy in a senior high school in bandung pengaruh model pembelajaran inkuiri peningkatan keterampilan proses sains siswa sd kelas v materi gaya magnet (suatu penelitian eksperimen siswa kelas v sdn ckareo i sdn cikareo ii kabupaten sumedang) meningkatkan kemampuan teknik dasar passing menggunakan kaki bagian pembelajaran sepak bola melalui pengelolaan gawang kecil kelas iv sdn corenda kecamatan cisitu kabupaten sumedang pengaruh partisipasi anggaran kinerja manajerial komitmen organisasi sebagai variabel moderating pt telekomunikasi indonesia kajian fonetis tuturan anak penyandang tunagrahita slb-c sukapura kiaracondong pengaruh penerapan learning cycle keterampilan mengajukan pertanyaan berkomunikasi siswa kelas x subkonsep pencemaran air analisis deskriptif danseigo drama televisi asuko march efektivitas teknik pembelajaran two stay two stray meningkatkan keterampilan menulis karangan deskripsi bahasa perancis siswa kelas xii bahasa sma negeri 3 cimahi 2012/2013 pengaruh metode pembelajaran resitasi hasil belajar siswa akuntansi siswa kelas xii ips sma negeri 1 cibeber materi jurnal khusus manfaat hasil belajar nail art sebagai kesiapan menjadi nail stylist pengaruh kompetensi guru motivasi belajar siswa mata pelajaran akuntansi sman 14 bandung survey siswa kelas xi ips profil kemampuan berpikir logis pemahaman konsep kinematika gerak lurus siswa sma pengaruh program praktek kerja industri (prakerin) kesiapan kerja siswa kompetensi keahlian administrasi perkantoran smkn 11 bandung permainan sosiodramauntuk mengurangi perilaku pelanggaran disiplin anak hambatan emosi perilaku kelompok bermain al hadi learning center pengaruh model pembelajaran kooperatifdan ekspositori hasil belajar keterampilan bola voli sikap sosial penerapan metode kerja kelompok meningkatkan pemahaman konsep operasi hitung bilangan bulat anak didik penerapan metode kerja kelompok meningkatkan pemahaman konsep operasi hitung bilangan bulat anak didik penelitian tindakan kelas sdn paniis kelas iv semester i 2012/2013 kecamatan tanjungkerta kabupaten sumedang pengaruh sistem manajemen kelas motivasi belajar siswa implikasinya prestasi belajar siswa smk pasundan 1 kota bandung politik beras indonesia masa orde baru (1969-1998) dari subsistensi swasembada pangan hingga ketergantungan impor pembelajaran tari surantang-surinting meningkatkan kecerdasan kinestetik anak usia dini tk nusantara cilegon banten pengaruh promosi melalui above the line ekuitas merek survei komunitas clear indonesia @clearindonesia sistem pendukung keputusan pemilihan produk provider gsm menggunakan metode weighted product peningkatan hasil belajar siswa pembelajaran ips mengenai masalah sosial melalui penerapan model pakemptk kelas iv sd negeri tegal kecamatan anyar kabupaten serang efektivitas penggunaan teknik permainan riddle pembelajaran kosakata bahasa arab studi eksperimen kuasi siswa kelas viii smp muhammadiyah antapani bandung 2012/2013 pengembangan media cerita sosial pembelajaran keterampilan sosial bagi siswa autism spectrum disorder (asd) sd x hasil belajar “menggambar ornamen” pembuatan motif hiasan busana anak penerapan model pembelajaran kooperatif tipe the power of two meningkatkan kemampuan penalaran komunikasi matematis siswa sekolah menengah pertama jacobson radikal ring perluasannya analisis faktor faktor mempengaruhi audit delay studi empiris perusahaan indeks lq 45 terdaftar bursa efek indonesia ( bei) pengaruh tipe kepribadian kompetensi sosial resiliensi remaja tunanetra kota bandung manfaat hasil belajar pelayanan prima sebagai kesiapan waiter hotel hubungan antara daya konsentrasi hasil belajar menulis istilah-istilah dina kasenian penca silat panglipur kalurahan balééndah kacamatan balééndah kabupatén bandung pikeun salah sahiji alternatif bahan ajar maca bahasan kasenian sma kelas xii analisis perbandingan pertumbuhan investasi sebelum sesudah penerapan flat rate penerimaan pajak penghasilan studi wajib pajak badan provinsi banten pengembangan kit pembelajaran kontrol robotika tingkat dasar efektivitas model pembelajaran circle of learning (cl) berbantu multimedia pembelajaran interaktif peningkatan kemampuan visual-spatial intelligence siswa pengaruh concept attainment model kemampuan komunikasi berpikir kritis serta disposisi berpikir kritis matematis mahasiswa pgmi kuasi-eksperimen mahasiswa pgmi uin syarif hidayatullah, jakarta pengaruh bauran promosi keputusan pembelian jeans cardinal survei pembeli jeans cardinal mds galeria bip bimbingan pribadi meningkatkan penerimaan diri siswa studideskriptifterhadapsiswakelasviii smpnegeri 19 bandung tahunajaran 2012/2013 efektivitas media permainan buchstabendiktat pembelajaran kosakata bahasa jerman pengaruh asistensi lembar kerja hasil belajar menggambar konstruksi bangunan gedung analisis struktural puisi mantra desa cengcal kacamatan japara kabupaten kuningan pikeun bahan pangajaran apresiasi puisi sma aplikasi arima arfima data konsentrasi black carbon partikulat udara halus 〖pm〗_(2.5) daerah lembang bandung penerapan model kekola menggunakan media kakataca meningkatkan keterampilan melengkapi percakapan (penelitiantindakankelas kelas iv sd negeripakuwon ii kecamatansumedang selatan kabupatensumedang) pengaruh penggunaan web software berbasis open source peningkatan berpikir kreatif siswastudi kuasi eksperimen siswa kelas ix smpn 9 cimahi model pembelajaran konstruktivisme meningkatkan hasil belajar siswa konsep perkembangan teknologi dikelas iv sdn giripawana 1 kecamatan mandalawangi penerapan pendekatan matematika realistik meningkatkan hasil belajar siswa sd mata pelajaran matematika materi pokok bangun datar penelitian tindakan kelas kelas v sdn barunagri kecamatan lembang kabupaten bandung barat pengelolaan sekolah dasar studi tentang efektivitas efisiensi pengelolaan tingkat sekolah dasar kecamatan iv koto kabupaten agam provinsi sumatera barat profil keterampilan proses sains siswa pembelajaran pembuatan sistem koloid menggunakan metode discovery-inquiry penentuan struktur patahan lapangan panas bumi “x” menggunakan metode relokasi relatif kasus gempa mikro hubungan antara motivasi berprestasi kemampuan berpikir kreatif remaja studi korelasional siswa kelas xi sekolah menengah atas negeri 6 bandung penerapan pendekatan konstruktivisme meningkatkan hasil belajar siswa pembelajaran ipa materi gaya penelitian tindakan kelas kelas v sd negeri bukanagara lembang semester ii 2012/ 2013 pengaruh kekuatan pemasok strategi produk implikasinya penjualan analisis pengaruh servicescape keputusan pembelian etcetera café and resto bandung survei konsumen etcetera café and resto bandung peningkatan kemampuan komunikasi matematis menggunakan pendekatan kontekstual teknik scaffolding teacher’s strategies in teaching speaking to students at secondary level upaya pengembangan gerak dasar menendang melalui penerapan pembelajaran aktivitas soccer like games analisis kontrastif modalitas desideratif bahasa indonesia bahasa jepang pengaruh fasilitas belajar motivasi belajar matapelajaran produktif administrasi perkantoran smk negeri 3 bandung penerapan model sinektik melalui pembelajaran musik angklung meningkatkan interaksi sosial anak autis sekolah inklusif teachers’ difficulties in teaching writing descriptive texts pengelolaan program pos paud rw 04 desa kertamukti kecamatan haurwangi faktor - faktor penyebab wanita karir dewasa madya menunda pernikahan wanita karir dewasa madya kota bandung analisis overlay pembuatan peta tingkat bahaya erosi wilayah das cimandiri kabupaten sukabumi pengembangan tes diagnostik pilihan ganda dua tingkat mengidentifikasi miskonsepsi siswa sma kelas x materi hidrokarbon penerapan metode inkuiri meningkatkan aktivitas hasil belajar siswa mata pelajaran ipa materi tanah sekolah dasar penelitian tindakan kelas siswa kelas v sdn barunagri, lembang pengembangan alat tes ukbipa-membaca berbasis teknologi informasi mengukur kompetensi membaca pembelajar bipa rancang bangun sistem pendukung keputusan seleksi penerima jaminan kesehatan masyarakat kombinasi metode analythical hierarchy process logika fuzzy tsukamoto hubungan antara persepsi peserta diklat penyelenggaraan program pendidikan pelatihan dasar komputer motivasi belajar studi deskriptif korelasional peserta diklat dasar komputer bpptk-pk hubungan antara persepsi peserta diklat penyelenggaraanprogram pendidikan pelatihan dasar komputerdengan motivasi belajar efektivitas teknik permainan pantomim pembelajaran kosakata bahasa jerman pengaruh kualitas kinerja kepala sekolah prestasi belajar siswa rancang bangun virtual laboratory experimentation fisika pokok bahasan induksi magnet elektromagnet pelaksanaan demokrasi masa pemerintahan thomas jefferson amerika serikat tahun 1801-1809 perbandingan model pendekatan taktis pendekatan tradisional hasil belajar permainan kasti studi eksperimen siswi smk 45 lembang analisis metagenomik gen ketosynthase nonribosomal peptide syntethase bakteri endofit akar vetiveria zizanioides l mengungkap miskonsepsi topik stoikiometri siswa kelas x melalui tes diagnostik two-tier perbandingan pembelajaran pendekatan taktis teknis motivasi siswa pembelajaran hoki sma negeri 26 bandung pikeun ngaronjatkeun kamampuh maca artikel panalungtikan tindakan kelas ka siswa kelas xii-ips ma yasyfiy taun ajaran 2012-2013 program bimbingan pribadi sosial mengembangkan harga diri (self esteem) siswa berstatus sosial ekonomi rendah upaya memahami konsep sifat kegunaan air menggunakan pendekatan keterampilan proses pembelajaran ipa sekolah dasar siswa kelas iv sekolah dasar kabupaten buton pengaruh strategi diversifikasi produk keputusan menginap hotel grand royal panghegar bandung survei tamu menginap hotel grand royal panghegar bandung implementasi media pembelajaran e-learning pembelajaran pendidikan agama islam pokok bahasan pengurusan jenazah profil penguasaan konsep siswa sma pembelajaran tumbukan efektif menggunakan metode discovery-inquiry manajemen pengembangan tenaga edukatif manajemen perguruan tinggi swasta suatu analisa deskriptif tentang pengembangan tenaga edukatif universitas siliwangi tasikmalaya pengembangan model pengorganisasian materi pelajaran menerapkan advance organizers mengajarkan konsep ilmu sosial bermuatan iptek imtak madrasah aliyah penelitian mata pelajaran geografi kelas i irak bawah kepemimpinan saddam hussein kejayaan sampai kejatuhannya dari tahun 1979-2003 pembelajaran terpadu mengembangkan nilai-nilai keagamaan siswa studi khusus smu (plus) muthahari bandung pengaruh modifikasi bola sepak penguasaan keterampilan dasar passing pendek sepak bola pembelajaran pendidikan jasmani peran pelatih program pelatihan keterampilan bermusik meningkatkan motivasi kemandirian musisi jalanan kasus rumah musik harry roesli (rmhr) kota bandung kemandirian berwirausaha alumni peserta program kecakapan hidup alumni lkp tisaga caterias kota cimahi penerapan model pembelajaran kooperatif tipe teams games tournament meningkatkan proses pembelajaran lompat jauh melalui permainan sang bangodan sang kodok (penelitian tindakan kelas siswa kelas iv min ciguling kec. sumedang selatan kab. sumedang) penerapan modifikasi alat pembelajaran sepak takraw penelitian tindakan kelas smp negeri 1 conggeang penerapan metode bermain peran mengurangi perilaku agresif anak taman kanak-kanak pemberitaan pilgub jabar 2013 harian umum pikiran rakyat inilah koran suatu analisis wacana kritis studi evaluasi sarana prasarana mata pelajaran bubut dasar sekolah menengah kejuruan negeri 12 bandung pengaruh model experiential learning peningkatan kemampuan pemahaman matematis siswa sma pengaruh profitabilitas solvabilitas harga saham emiten sektor property real estate bursa efek indonesia tahun 2011 struktur carita dina kumpulan carpon ma inung néwak cahaya karangan mamat sasmita pikeun bahan pangajaran maca smp kemampuan kolaboratif mahasiswa perkuliahan bimbingan perawatan anak melalui kegiatan lesson study penerapan pendekatan konstruktivisme meningkatkan hasil belajar siswa materi bilangan bulat penelitian tindakan kelas siswa kelas iv sekolah dasar negeri cibeunying kecamatan lembang kabupaten bandung barat 2012/2013 penggunaan teknik numbered heads together pembelajaran menulis puisi bebas keterlibatan uni soviet republik rakyat cina pendudukan vietnam kamboja 1978-1991 analisis adjektiv als nomen roman “herr der diebe” karya cornelia funke implementasi value clarification technique model analisis nilai meningkatkan tanggung jawab siswa sebagai warga negara baik studi deskriptif siswa kelas xi pemasaran smk negeri 3 bandung mengatasi kesulitan siswa kelas v sdn pasireurih 1 membaca pemahamanmenggunakan model cooperative learning tipe circ model pembelajaran synectic mengembangkan kemampuan ekspresi kreatif siswa pembelajaran seni tari smk mvp ars internasional bandung implementasi penggunaan media pembelajaran berbasis perangkat lunak adobe flash pembelajaran teknik digital efektivitas penggunaan media permainan dadu pembentukan w-fragen (wer, wo, wann, wie, was, woher) korelasi antara kemampuan cadence prestasi lari sprint 100 meter cabang olahraga atletik studi deskriptif sprinter ukm atletik upi bandung profil motivasi berprestasi kondisi fisik atlet bola basket kota banjar desain didaktis konsep fungsi pembelajaran matematika smp suatu penelitian kualitatif siswa kelas viii suatu smp bandung pengaruh penilaian kinerja disiplin kerja pegawai bidang pendidikan dasar dinas pendidikan provinsi jawa barat pengasuhan perkembangan fisik anak usia dini oleh guru taman kanak-kanak kelurahan isola kota bandung pengaruh penerapan model cooperative learning tipe think pair share (tps) kemampuan berpikir kritis siswa pembelajaran ekonomi efektivitas penggunaan index card match penguasaan kosakata bahasa arab kontribusi minat belajar siswa kelas xii jurusan teknik gambar bangunan smk negeri 1 sumedang tahun pelajaran 2012/2013 kesiapan memasuki dunia kerja kontribusi hasil belajar room section kompetensi praktek kerja industri hotel persepsi motif wanita umpire cabang olahraga softball studi deskriptif wasit atlet olahraga softball pengaruh manajemen kelas prestasi belajar siswa mata pelajaran produktif administrasi perkantoran kelas x smk negeri 3 bandung gambaran depresi wanita lanjut usia panti sosial tresna wredha budi pertiwi pengaruh picture word inductive model keterampilan membaca menulis permulaan siswa kelas ii sdn sirnagalih kecamatan jatinangor kabupaten sumedang pengaruh media audio visual peningkatan hasil belajar pembelajaran senam lantai guling belakang sman 1 tanjungsari penggunaan media adobe flash meningkatkan kemampuan mengingat huruf hijaiyah anak tunarungu kelas 4 sekolah dasar luar biasa penelitian eksperimen single subject research slb negeri cicendo kota bandung analisis kebutuhan sarana prasarana taman wisata alam curug cilengkrang kabupaten bandung penerapan pendekatan konstruktivisme mata pelajaran matematika pokok bahasan sifat-sifat bangun ruang balok kubus meningkatkan hasil belajar siswa penentuan aktivitas antioksidan minuman sari wortel (daucus carota l) ajén palsapah dina upacara jaroh kampung dukuh désa ciroyom kabupatén garut pikeun bahan pangajaran maca bahasan sma kelas xi efektivitas program bimbingan pribadi meningkatkan penalaran moral peserta didik pengaruh model pembelajaran penemuan ( discovery learning) keterampilan berpikir kreatif siswa materi sifat-sifatcahaya implementasi model pembelajaran value time pie meningkatkan motiasi belajar pelajaran pkn penelitian tindakan kelas pelajaran pkn dikelas x-5 sma conggeang sumedang pengaruh pengunaan e-magazine hasil belajar siswa ranah kognitif mata pelajaran teknologi informasi komunikasi (tik) kuasi eksperimen sman 4 bandung efektivitas teknik restrukturisasi kognitif mereduksi kecemasan komunikasi remaja pra- eksperimen peserta didik kelas x sma pasundan 2 bandung 2013/2014 penerapan model pendekatan taktis upaya meningkatkan penguasaan keterampilan dasar passing permainan sepakbola meningkatkan kemampuan membaca dini anak taman kanak-kanak melalui penggunaan media kartu suku kata bergambar perencanaan wisata budaya berbasis kearifan lokal kampung naga kabupaten tasikmalaya local wisdom in pictures contained in english textbooks an analysis of illustrations in english textbooks for primary school meningkatkan kemampuan spasial self-efficacy siswa smp melalui model kooperatif stad berbantuan wingeom analisis kesulitan belajar siswa sekolah menengah atas simulasi lift barang berbasis mikrokontroler perbandingan pembiayaan alat berat digunakan pembangunan gedung sudirman suites apartment penerapan metode improving learning melalui teknik inkuiri meningkatkan hasil belajar siswa mata pelajaran matematika materi bilangan pecahan efektivitas media gambar animasi meningkatan penguasaan kosakata bahasa arab the representation of social actors in the 1945 constitution of the republic of indonesia a critical discourse analysis pengaruh modifikasi alat bantu hasil belajar lempar cakram studi eksperimen sman 4 cimahi layanan konseling pribadi sosial meningkatkan self esteem remaja terlibat prostitusi remaja usia 15-18 tahun kap indonesia-bandung sistem pengenalan entitas perceptron tweets pengaruh penerapan metode pembelajaran brainstorming problem based instruction aktivitas belajar pemahaman konsep peserta didik studi eksperimen mata pelajaran ekonomi siswa kelas x sma kartika siliwangi 2 bandung 2012-2013 pengaruh pengungkapan sustainability report perubahan harga saham pengembangan model pembelajaran membaca meningkatkan kemampuan membaca pemahaman studi politeknik sumatera selatan hubungan antara antropometri tubuh kelincahan (agility) daya tahan kardiovaskular (vo2max) olahraga basket studi deskriptif eskul basket smpn 1 cikaum kabupaten subang dinamika penyesuaian diri pilot asing bekerja maskapai penerbangan lokal tiga pilot asing maskapai penerbangan susi air kajian bahasa tutur ragam pramuwisata studi deskriptif penggunaan bahasa indonesia kegiatan memandu wisatawan oleh mahasiswa sekolah tinggi parawisata bandung 1996/1997 meningkatkan hasil belajar siswa konsep kegiatan ekonomi menggunakan model sains teknologi masyarakat (stm) kelas iv sdn jenggot 1 kecamatan mekar baru kabupaten tangerang penerapan metode eksperimen pembelajaran ipa materi pokok sifat - sifat cahaya meningkatkan hasil belajar siswa pengembangan performance assessment pembelajaran teknik pemeliharaan ikan hubungan motivasi masyarakat macam kegiatan olahraga rekreasi car free day bandung pembelajaran berbasis praktikum virtual meningkatkan keterampilan berpikir kritis sikap ilmiah siswa tentang kesehatan reproduksi manusia peran pengelola lembaga pemberdayaan masyarakat (lpm) meningkatkan partisipasi masyarakat pembangunan rumah layak huni bagi masyarakat miskin studi kelurahan setiamanah kecamatan cimahi tengah kota cimahi identifikasi miskonsepsi siswa smp konsep fotosintesis melalui analisis gambar pengembangan program pembelajaran bahasa inggris bagi siswa disleksia smpn 15 sukabumi pengaruh metode inquiry kemampuan berpikir kritis peserta didik studi quasi eksperimen peserta didik kelas xi akuntansi kompetensi dasar mengentri saldo awal smkn 1 garut pengaruh anggaran atribut produk preferensi konsumen provider indosat kota bandung survei mahasiswa perguruan tinggi negeri kota bandung penerapan pendekatan pembelajaran visual thinking disertai aktivitas quick on the draw meningkatkan kemampuan pemecahan masalah komunikasi matematis siswa nilai budaya sunda kesenian gaok desa kulur kabupaten majalengka pengajaran membaca sma kelas xii penerapan latihan graphomotor meningkatkan kemapuan menulis permulaan anak cerebral palsydi slb-d ypac bandung pengaruh bauran produk museum keputusan berkunjung wisatawan museum jawa tengah ranggawarsita survei pengunjung umum museum jawa tengah ranggawarsita pengaruh pengendalian intern transparansi pengelolaan keuangan daerah pemerintah kabupaten bandung barat hubungan antara konsep diri kualitas interaksi sosial tim bola basket perencanaan campuran beton kekuatan awal tinggi (high early strength concrete)dengan bahan tambah superplasticizer tipe polycarboxylate ethers pengajaran bahasa indonesia dua perguruan tinggi medan analisis tujuan, pbm, materi pengajaran bahasa indonesia mahasiswa semester 1 fakultas hukum uisu fpips ikip medan penyajian seni domyak grup sinar pusaka muda kabupaten purwakarta tradisi budaya "ngalaksa" masyarakat rancakalong kabupaten sumedang studi naturalistik tentangnilai-nilai budaya sebagai upaya pengembangan pendidikan umum analisis kemampuan pembelajar bahasa jepang pelafalan bunyi za, zu, ze zo penelitian deskriptif mahasiswa pendidikan bahasa jepang fpbs upi peranan george washington perang kemerdekaan amerika serikat tahun 1775 - 1783 penerapan model blended learning bsk tik psk teknik komputer jaringan menurut perpektif guru smk model bimbingan konseling islami memenuhi kebutuhan spiritual pasien rawat inap rumah sakit studi ke arah pengembangan model bimbingan konseling islami rumah sakit umum daerah al-ihsan kabupaten bandung fabrikasi kertas magnetik melalui impregnasi cairan ionik cis-oleil-imidazolinium tetrakloroferat(iii) biomassa selulosa batang pisang isolasi identifikasi bakteri pendegradasi senyawa fenol dari limbah cair industri kertas internalisasi nilai sportivitas melalui pembelajaran pendidikan jasmani sekolah dasar negeri studi sekolah dasar negeri loktabat 1 banjarbaru kritik sosial naskah drama jangan menangis indonesia karya putu wijaya efektivitas teknik self instruction mereduksi perilaku konsumtif penelitian pra-eksperimen peserta didik kelas xi sma negeri 6 bandung 2012/2013 penerapan peer assessment penilaian kinerja siswa praktikum pencemaran tanah analisis program pelatihan kinerja karyawan departemen front office hotel lido lakes resort & conference bogor analisis kualitas produk citra merek kepuasan konsumen rumah makan sunda ampera kota bandung pengaruh pembelajaran kontekstual direct instruction kemampuan koneksi pemecahan masalah matematis siswa sekolah dasar studi eksperimen kuasi siswa kelas iv sekolah dasar gugus iii kecamatan karangsembung kabupaten cirebon tahunajaran 2012/2013 kajian etnokoreologi tari wayang srikandi-mustakaweni pengaruh penerapan model pembelajaran kooperatif tipe jigsaw hasil belajar siswa studi eksperimen standar kompetensi mengelola pertemuan/rapat program keahlian administrasi perkantoran smk pasundan putra cimahi hubungan penguasaan mata kuliah rencana anggaran biaya penyelesaian tugas mata kuliah manajemen konstruksi model layanan pendidikan siswa berbakat matematika pendekatan enrichment problem solving smp penerapan model pembelajaran kooperatif think pair share meningkatkan hasil belajar siswa kompetensi dasar memahami administrasi perkantoran studi eksperimen kuasi siswa kelas x ap1 xap2di smk negeri 1 bandung studi deskriptif kinerja masing-masing bagian lembaga penjaminan mutu pendidikan provinsi jawa barat sikap kasunanan surakarta mengatasi gerakan anti swapraja surakarta tahun 1945-1946 efektivitas konseling kelompok menggunakan media clay meningkatkan perilaku altruisme siswa pengaruh strategi posisioning peningkatan citra atraksi wisata taman budaya jawa barat sebagai tempat pelestarian, pemeliharaan, pengembangan pemanfaatan seni budaya jawa barat survei pengunjung taman budaya jawa barat kalimah pananya dina novél kolébat kuwung-kuwungan kinasih katumbirian karangan tatang sumarsono fenomena hubungan seksual pranikah kalangan mahasiswa anak kost gegerkalong bandung hubungan kebugaran jasmani prestasi akademik mahasiswa ilmu keolahragaan fpok upi relevansi kurikulum fakultas kedokteran gigi perkembangan kebutuhan masyarakat pelayanan kesehatan gigi mulut suatu studi deskriptif analitik kurikulum fakultas kedokteran gigi unpad serta tugas-tugas pelayanan kesehatan gigi mulut puskesmas proses pembelajaran diklat perlindungan anak meningkatkan pelayanan kesejahteraan anak tksm studi deskriptif balai besar pendidikan pelatihan kesejahteraan sosial bandung meningkatkan kemampuan pemahaman, komunikasi, disposisi matematis siswa sma melalui pendekatan induktif-deduktif belajar kooperatif tipe numbered-heads-together model pembelajaran menyimak aktif integratif melalui multimedia interaktif sebagai determinan peningkatan keterampilan menyimak kritis mahasiswa penelitian pengembangan model pembelajaran menyimak mahasiswa program studi pendidikan bahasa sastra indonesia fkip universitas bengkulu the phonemic − syllabic comparisons of standard malay and palembang malay using a historical linguistic perspective poetry and students’ reading engagement an exploratory study in an efl classroom at a senior high school in bandung desain didaktis konsep teorema sisa pembelajaran matematika sekolah menengah atas (sma) analisis kemampuan literasi sains siswa smp pembelajaran ipa terpadu tema cuaca ekstrim penerapan pendekatan contextual teaching and learning meningkatkan pemahaman materi konsep gerak benda mata pelajaran sains siswa tunarungu kelas iii the use of classroom blog in teaching writing to junior high school students a case study of second year junior high school in one of public schoool in bandung year 2011/2012 pengaruh kondisi lingkungan kerja kinerja mengajar guru smk pgri 2 cimahi pengaruh gaya mengajar kebugaran jasmani hasil belajar keterampilan teknik dasar tenis sekolah fiks penerapan model pembelajaran kooferatiftipejigsaw pelajaran matematika pokok bahasan waktu meningkatkan hasil belajar siswa penerapan model pembelajaran kooferatiftipejigsaw pelajaran matematika pokok bahasan waktu meningkatkan hasil belajar siswa penelitian tindakan kelas siswa kelas v sdn babakan kota bandung pengajaran bahasa lampung sebagai muatan lokal wilayah transmigrasi kabupaten lampung tengah penerapan problem based learning (pbl) berbantuan teknologi informasi komunikasi meningkatkan kemampuan berpikir kritis sikap ilmiah siswa konsep pencemaran lingkungan rancang bangun sistem estimasi menu favorit meningkatkan penjualan menggunakan metode winters restoran payo penerapan pendekatan ketrampilan proses meningkatkan motivasi belajar ipa manajemen bursa kerja khusus (bkk) pemasaran lulusan pengaruh kredit bermasalah rentabilitas bank jabar banten cabang pusat bandung tahun 2005-2012 pemetaan jaringan jalan kota bandung pengaruh penggunaan sistem pengadaan secara elektronik (spse) efisiensi kerja pegawai bidang pengadaan barang jasa unit layanan pengadaan (ulp) layanan pengadaan secara elektronik (lpse) pemerintahan kota cimahi kalungguhan tokoh wanoja dina kumpulan carpon haté awéwé karangan risnawati tilikan féminisme model pembinaan sikap keluarga hubungannya pembentukan karakter siswa mts al-ghifari indramayu implementasi pembelajaran induktif materi kalor meningkatkan pemahaman konsep keterampilan berpikir rasional siswa smp kinerja sekolah dasar negeri ditinjau dari profil kepemimpinan kepala sekolah studi sekolah dasar negeri daerah kabupaten indragiri hilir riau perbandingan pendekatan bermain pendekatan tradisional pembelajaran pendidikan jamani minat belajar mata pelajaran pasca pendidikan jasmani pengembangan keterampilan sosial calon guru pogram praktek kependidikan khidmat jamiyyah (pkkj) muallimin pesantren persatuan islam 3 pameungpeuk bandung the effect of modified teacher’s question on describing things in efl classroom interaction an experimental study at a state vocational school in tasikmalaya pendekatan keterampilan metakognitif meningkatkan kemampuan pemecahan masalah matematis siswa sd studi kuasi eksperimen dilaksanakan siswa kelas v desa tanah baru kecamatan pakisjaya kabupaten karawang 2012-2013 pengaruh model pembelajaran kooperatif tipe number head together kemampuan berbicara bahasa arab siswa studi eksperimen kuasi siswa kelas viii smp muhammadiyah cilawu garut meningkatkan keterampilan komunikasi berbasis pengalaman historis siswa melalui metode diskusi tipe dialog kreatif meningkatkan kemampuan membaca permulaan anak tunagrahita ringan melalui metode kupas rangkai teknik reposisi bunyi penelitian subjek tunggal anak tunagrahita ringan penerapan pembelajaran kooperatif tipe teams-games-tournaments classroom questioning strategies (tgtcqs) meningkatkan kemampuan pemahaman komunikasi matematis siswa smp penerapan metode ceramah bervariasi meningkatkan motivasi belajar siswa pembelajaran pkn studi deskriptif siswa kelas xi ipa 2 sma negeri 1 cimalaka tingkat kepercayaan diri atlet pertandingan kyorugi (sparring) cabang olahraga taekwondo the analysis of two pre-reading strategies contextual redefinitionand word list in efl learners’ reading comprehension analisis frekuensi getaran gearbox cooling tower optimalisasi predictive maintenance pengaruh kegiatan ektrakurikuler pramuka prilaku disiplin siswa smk bhakti pertiwi kabupaten bandung barat penerapan algoritma genetika optimasi rute dari rumah sakit umum kota bandung menuju rumah sakit hasan sadikin bandung analisis korelasi penurunan intensitas sinar kosmik (forbush decrease) terkait lontaran massa korona (cme). flare, parameter medium antarplanet lainnya upaya meningkatkan kepuasan tamu menginap grand seriti boutique hotel bandung melalui program service recovery survei tamu individu grand seriti boutique hotel bandung penerapan metode membaca terbimbing meningkatkan keterampilan membaca intensif siswa kelas iv sekolah dasar negeri 2 suntenjaya kabupaten bandung barat kesenian gembyungan upacara nyangku desa panjalu kecamatan panjalu kabupaten ciamis study tentang kinerja mengajar guruanalisis pengaruh kepemimpinan kepala madrasah, budaya madrasah, motivasi kerja, komitmen kerja kinerja mengajar guru madrasah aliyah se-kota bekasi efektivitas pengelolaan program penyetaraan si jabatan fkip universitas bengkulu sistem pengawasan inventarisasi prasarana sarana pendidikan sekolah dasar negeri kota bandung efektivitas metode jibril pembelajaran tahfidz surat -surat pendek studi eksperimen quasi siswa kelas vii smp pgii 2 bandung analisis pengukuran kinerja pemasaran melalui financial metrics produk cn-235 pt. dirgantara indonesia analisis faktor-faktor mempengaruhi minat kunjungan wisatawan asing restoran khas sunda kawasan bandung utara pengaruh kompetensi kinerja karyawan pt pln(persero) distribusi jawa barat banten area pelayanan jaringan cimahi pengaruh lingkungan persaingan differensiasi produk pendapatan kasus produsen yogurt desa jelegong kecamatan rancaekek kabupaten bandung campur kode dina nulis surat pribadi siswa kelas viii smpn 1 lembang analisis visual poster pertunjukan teater sunda kiwari tahun 1979-1995 analisis pengaruh kualitas sumber daya manusia, standar resep peralatan kualitas produk surabi warung colenak kota bandung peran himpunan pendidik tenaga kependidikan anak usia dini indonesia ( himpaudi ) meningkatkan kompetensi pendidik paud studi deskriptif himpaudi kecamatan lembang kabupaten bandung barat hubungan antara meneladani kepahlawanan tokohdengan sikap patriotisme siswa kelas iv sekolah dasar penelitian deskriptif kelas iv sd negeri 2 cibungur kecamatan cipatujah kabupaten tasikmalaya pemodelan runtun waktu auto regressive integrated moving averagewith exogenous variable (arimax) efek variasi kalender meningkatkan gerak dasar lompat jauh gaya jongkok melalui permainan engklek kelas iv sdn baginda ii kecamatan sumedang selatan kabupaten sumedang penggunaan abreviasi kalangan remaja kota bandung suatu kajian sosiolinguistik pengaruh prestasi belajar mata pelajaran kewirausahaan minat berwirausaha siswa survey siswa kelas xi sma pasundan 2 bandung 2012/2013 pengembangan metode penetapan kadar edta produk pangan mayonais secara spektrofotometri uv pengaruh metode pembelajaran peta konsep value clarification technique (vct) kompetensi kewarganegaraan siswa konsep norma studi eksperimen kuasi kelas vii smpn 2 tomo sumedang pembuatan peta zona nilai tanah pelayanan informasi zona nilai perbidang tanah kantor pertanahan kabupaten karanganyar pengaruh fasilitas belajar disiplin belajar prestasi belajar siswa mata pelajaran ekonomi survey siswa kelas xi ips sma pasundan se-kota bandung language attitudes towards written alay variety in facebook interaction pengaruh kepemimpinan mutu kepala sekolah komitmen pegawai menerapkan sistem manajemen mutu iso 9001 2008 smk negeri kota pembelajaran penggunaan pembalut wanita meningkatkan keterampilan merawat diri remaja wanita tunagrahita hubungan antara dukungan sosial coping strategy ibu memiliki anak penyandang tunagrahita studi deskriptif korelasional ibu memiliki anak tunagrahita slb-c yplb cipaganti kota bandung pengaruh event marketing keputusan pembelian produk rokok envio mild survei konsumen bisnis mitra usaha pt. djarum kab. bandung hubungan antara kesadaran linguistik kemampuan membaca dini anak usia dini pengembangan perangkat pembelajaran geografi berbasis pendidikan karakter materi pokok hidrosfer penelitian pengembangan membangun karakter peduli lingkungan peserta didik kelas x sma negeri pekanbaru effectiveness of implementation to iso quality management system case study of iso qms 90012008 policy implementation at uin maulana malik ibrahim malang implementasi pendekatan problem posing pembelajaran berbasis masalah (pbm) meningkatkan hasil belajar fisika kemandirian belajar siswa sma penerapan model pembelajaran berbasis masalah meningkatkan aktivitas hasil belajar siswa standar komptensi merancang kandang peralatan smk n 2 subang kritik teks telaah fungsi naskah wawacan jaka mursyid pengaruh job description kinerja karyawan daerah operasi iii pt kereta api (persero) cirebon revitalisasi pendidikan kewarganegaraan program pembinaan warga negara indonesia muda lembaga pemasyarakatan anak studi deskriptif lembaga pemasyarakatan anak kelas ii.b propinsi kalimantan barat isolasi identifikasi senyawa metabolit sekunder bionutrien agf penerapan model kooperatif tipe two stay two stay pembelajaran ipa materi pemanfaatan sumber daya alam meningkatkan hasil belajar siswa analisis buku teks biologi smp kota bandung berdasarkan hakikat sains pengaruh media audio visual hasil belajar passing pembelajaran sepakbola smp negeri 3 lembang penerapan model pembelajaran inkuiri metode pictorial riddle berbantuan multimedia pembelajaran interaktif meningkatkan hasil belajar smp matapelajaran teknologi informasi komunikasi (tik) pengaruh word of mouth keputusan berkunjung wisatawan grup desa wisata lembur kahuripan pasanggrahan sensus pengambil keputusan wisatawan grup berkunjung lembur kahuripan pasanggrahan pengaruh model pembelajaran kooperatif tipe crh (course, review, hurray) kemampuan pemahaman matematis kecemasan matematika siswa smp techniques in presenting vocabulary to young efl learners pembuatan stereo mate menggunakan ifsar wilayah sulawesi barat proses awal pembuatan peta rbi menggunakan software summit evolution v.6.4. engd thesis, universitas pendidikan indonesia. kontribusi keterampilan juggling kaki agility dribbling cabang olahraga sepak bola studi deskriptif ukm sepakbola upi bandung konsep hidup mati leksikon khaul buyut tambi meningkatkan loyalitas tamu bisnis marbella suites bandung melalui relationship marketing survei tamu bisnis menginap marbella suites bandung studi tingkat penguasaan pengetahuan pelayanan lanjut usia peserta didik smkn 15 bandung gaya menyanyi musik keroncong tugu analisis gaya saartje margaretha michiels studi tentang tingkat kesadaran hukum pedagang pasar mingguan membayar retribusi perbandingan pengaruh susu sapi murni susu kedelai peningkatan massa otot latihan beban students’ engagement in english learning pengaruh penempatan pegawai motivasi kerja pegawai bidang pendidikan menengah tinggi dinas pendidikan provinsi jawa barat pengaruh working capital profitabilitas studi pt. adhi karya (persero), tbk. tahun 2004-2011 pengaruh perputaran piutang profitabilitas pt siaga mitra utama dental pengaruh persaingan perilaku kewirausahaan laba pengusaha tas desa margahayu tengah kecamatan margahayu kabupaten bandung pengaruh kepuasan kerja perilaku kewargaan organisasi (organizational citizenship behavior) pt.perdana perkasa elastindo (persaels) bandung pengaruh sedimen umur layanan waduk jatigede kabupaten sumedang efektivitas penggunaan media audio visual berbasis flash peningkatan penguasaan kosakata bahasa arab studi eksperimen kuasi siswa kelas x sma pasundan 2 bandung 2012/2013 peranan kpu mengatasi angka golput serta meningkatkan partisipasi politik masyarakat studi deskriptif analitis kpu daerah kota cimahi pengaruh pembelajaran kooperatif tipe student team achievement division (stad) hasil belajar aktivitas permainan bolabasket penelitian kuantitatif siswa kelas viii smp negeri 2 bayongbong pola pengintegrasian mata pelajaran adaptif kimia smk pelayaran pengaruh tata ruang kelas efektivitas pembelajaran jurusan pendidikan teknik arsitektur universitas pendidikan indonesia pondok pesantren mansyaul huda desa heuleut kecamatan kadipaten kabupaten majalengka 1980-2008 pemanfaatan arcgis analisis potensi kerusakan lahan produksi biomassa kabupaten bogor efektivitas penggunaan media film pembelajaran menulis permulaan sekolah dasar penelitianeksperimenkuasimata pelajaranbahasa indonesia dilakukan kelas 2 sdit al-bina kecamatanpurwakartakabupatenpurwakartatahunajaran 2012/2013 peranan orangtua memilih lembaga bimbingan belajar meningkatkan prestasi anak penggunaan software proteus sebagai media pembelajaran meningkatkan penguasaan materi pemrograman mikrokontroler perbandingan detektor tepi prewitt detektor tepi laplacian berdasarkan kompleksitas waktu citra hasil pengembangan analisis soal tes open-ended problem mengukur keterampilan berpikir kreatif siswa materi minyak bumi mengungkap kreativitas serta pemahaman konsep siswa sma melalui pembuatan media diorama konsep pencemaran lingkungan pengaruh pendidikan pelatihan kewirausahaan motif berwirausaha peserta bimbingan belajar softskill life school bandung analisis kontrastif verba tsutsumu, kurumu, maku bahasa jepang membungkus bahasa indonesia aplikasi mat foundation tower e apartemen green bay pluit pengaruh risiko sistematis kinerja perusahaan implikasinya nilai perusahaan studi perusahaan food and beverage bursa efek indonesia tahun 2007-2011 media audio visual pikeun ngaronjatkeun kamampuh ngaregepkeun tembang pupuh sekar ageung the use of video to improve students’ writing of procedural text penggunaan media modifikasi melalui pendekatan peer lesson sebagai upaya meningkatkan kemampuan berhitung permulaan kemampuan mengingat anak usia dini lesson planningthe development and implementation in the teaching of english a case study in a senior high school in cianjur, west java peningkatan kemampuan membaca permulaan siswa menggunakan metode struktur analitik sintetik (sas) penelitian tindakan kelas siswa kelas i sd negeri galumpit kecamatan tegalwaru kabupaten purwakarta 2012/2013 pengaruh penerapan metode card sort penguasaan kosakata bahasa arab studi eksperimen kuasi siswa kelas vii mts. baabussalaam bandung efektivitas teknik permainan kuartet pembelajaran konjugasi verba faktor-faktor mempengaruhi pengungkapan corporate social responsibility studi perusahaan manufaktur pertambangan listing bursa efek indonesia tahun 2011 bimbingan pengembangan konsep diri siswa tunanetra tingkat lanjutan pertama dislbn a bandung pengaruh pendekatan bermain meningkatkan teknik passing pendek studi eksperimen ekstrakurikuler futsal siswa mts pesantren persatuan islam benda 67 tasikmalaya legalisme pemerintahan qin shihuang (238-211 sm) hubungan antara tingkat kepercayaan diri kinerja kepemimpinan wasit bola voli indoor jawa barat model pelatihan pendidikan lingkungan hidup berbasis eco campus meningkatkan perilaku arif lingkungan studi universitas pancabudi medan kontribusi pembelajaran guru pendidikan kewarganegaraan pembentukan karakter disiplin siswa sekolah study deskriptif analitis pembelajaran pendidikan kewarganegaraan sma unggulan pandeglang banten perbandingan tembakan loncatan lurus tembakan loncatan kebelakang berdasarkan hasil tembakan dua angka bola basket hubungan antara keterampilan menyimak keterampilan menulis bahasa arab penelitian deskriptif korelatif siswa kelas vii mts al-hasan cikampek karawang 2012/2013 efektivitas media pembelajaran menggunakan model e-learning berbasis moodle meningkatkan hasil belajar siswa mata pelajaran dasar-dasar elektronika smk negeri 2 kota cimahi proses belajar mengajar pendidikan agama dl sma sma mutiara 1 bandung an investigation of theme and theme progression of students’ exposition text a case study in a state university in bandung meningkatkan gerak dasar passing kaki bagian pembelajaran sepak bola melalui model kooperatif tipe team-game-tournament (tgt) kelas iv sdn gudang ii kecamatan tanjungsari kabupaten sumedang pengaruh digitalisasi dokumen pajak efektivitas pengelolaan kearsipan kantor penerimaan pajak (kpp) pratama bandung tegallega sistem reservasi departemen front office banyan tree resort and spa bintan pengembangan program bimbingan belajar berdasarkan motivasi belajar peserta didik sma studi deskriptif peserta didik kelas xi sman 1 cimalaka 2012-2013 media audio visual pikeun ngaronjatkeun kamampuh ngaregepkeun tembang pupuh sekar ageung (panalungtikan tindakan kelas ka siswa kelas ix b smpn 14 bandung taun ajaran 2012/2013 meningkatkan kreativitas menggambar anak taman kanak-kanak melalui metode bercerita penelitian tindakan kelas tk al-ghozali kecamatan majalaya kabupaten bandung tahun pelajaran 2012-2013 implementasi pendekatan bermain upaya meningkatakan jumlah waktu aktif belajar gerak siswa pembelajaran pendidikan jasmani sekolah dasar negeri sukarasa 3 4 bandung dampak kawasan wisata masyarakat lokal menangani wisatawan emte highland resort efektivitas penyelenggaraan ujian negara perguruan tinggi swasta hubungan kekuatan otot lengan fleksibilitas pinggang hasil bantingan teknik tsuri goshi olahraga judo pelaksanaan program mentoring agama islam sebagai alternatif pembentukan perilaku siswa pendidikan berbasis karakter penerapan metode misi meningkatkan kemampuan menulis karangan berdasarkan pengalaman (penelitian tindakan kelaspada siswakelas v sd negeri cipicung ii kecamatan maja kabupaten majalengka) perbandingan pengaruh metode bagian metode keseluruhan penguasaan teknik push cabang olahraga hoki penggunaan media gambar meningkatkan kemampuan menulis mata kuliah sakubun penelitian eksperimental mahasiswa semester iv bahasa jepang fkip universitas riau pengaruh model pembelajaran inkuiri kemampuan berpikir kritis siswa kelas v materi gaya magnet (penelitian kuasi eksperimen siswa kelas v sdn jatimulya ii sdn jatimulya iii kecamatan kasokandel kabupaten majalengka) pengaruh kinerja advertising word of mouth marketing keputusan menjadi mahasiswa survey mahasiswa akademi sekretari manajemen ariyanti bandung penaksiran parameter persamaan simultan menggunakan metode full information maximum likelihood (fiml) pengaruhprice adjustment strategies keputusan menggunakan meeting package the jayakarta bandung boutique suite hotel and spa survei tamu bisnis menggunakan meeting package fullboard the jayakarta bandung boutique suite hotel and spa analisis citra perguruan tinggi amerika serikat keputusan melanjutkan studi survei komunitas persatuan mahasiswa indonesia amerika serikat the use of pq4r in teaching students’ reading comprehension of narrative text kecap pagawéan intransitif dina novel mercedes 190 karangan muh. rustandi kartakusuma pikeun bahan pangajaran sma tilikan struktur jeung semantis pendidikan kewarganegaraan sebagai wahana meningkatkan kesadaran hukum mahasiswa stkip pasundan cimahi perbedaan tingkat kebugaran jasmani siswa mengikuti ekstrakurikuler bola basket futsal smpn 1 paseh kabupaten bandung tahun 2013 pengelolaan fasilitas belajar sekolah tinggi seni indonesia bandung peranan pgri meningkatkan profesionalisme guru sekolah dasar kota bandung studi evaluatif tentang implementasi program kerja pgri kota bandung masa bakti 1995-2000 analisis kemampuan inkuiri siswa smp melalui pembelajaran levels of inquiry model topik gerak bumi pengelolaan praktek pengalaman lapangan fkip universitas syiah kuala banda aceh program d-ii pgsd transformasi bentuk superman sebagai gagasan berkarya seni grafis proses screen printing analisis kualitas hasil belajar grading pola mahasiswa prodi teknologi bisnis garmen angkatan tahun 2010 efektivitas metode stop and stop penguasaan kosakata bahasa jepang penelitian eksperimen siswa kelas x smkn 3 bandung peranan majlis taklim riyadus sholihah peningkatan kualitas pendidikan keluarga implementasi pembelajaran berbasis masalah meningkatkan hasil belajar matematika siswa smp aplikasi sistem informasi geografis pemetaan zonasi kerentanan banjir kecamatan banjaran kabupaten bandung dampak keberadaan pasar tradisional lingkungan keraton kanoman kecamatan lemahwungkuk kota cirebon kontribusi pengalaman pelatihan, latar belakang pendidikan sikap profesional kualitas kinerja kajian tenaga plkb/pkb kabupaten bandung, tahun 2004) kontribusi persepsi siswa tentang layanan bimbingan belajar motivasi belajar siswa studi deskripsif siswa kelas viii smpn 10 bandung 2012-2013 pengembangan modul kit arm robot pembelajaran ekstrakulikuler robotika implementasi algoritma run length encoding (rle) kompresi citra digital smartphone blackberry peningkatkan keterampilan menulis naskah drama melalui metode sugestopedia penelitian tindakan kelas siswa kelas xi ipa ma tanwiriyyah cianjur 2012/2013 kesesuaian pelaksanaan pembelajaran biologi ditingkat sma kota bandung tuntutan kompetensi dasar implikasinya ujian nasional tradisi upacara mane’e masyarakat pesisir pulau talaud sulawesi utara rencana anggaran biaya berbasis database. engd thesis, universitas pendidikan indonesia. pembinaan kemampuan profesional guru proses pembelajaran studi kualitatif tentang pembinaan kemampuan profesional guru proses pembelajaran oleh pengawas tk/sd sekolah dasar negeri kecamatan cimanggung kabupaten sumedang penerapan metode demonstrasi mata pelajaran ipa materi sistem pernafasan meningkatkan hasil belajar siswa kelas v penerapan pendekatan belajar catur asrama melalui taksonomi tri kaya parisudha pkn studi quasi experiment peningkatan kompetensi kewarganegaraan siswa sma negeri kota singaraja hubungan penerapan metode diskusi keaktifan siswa pembelajaran sejarah studi korelasional siswa kelas xi sekolah madrasah aliyah negeri sukamanah penggunaan media tayangan iklan layanan masyarakat pembelajaran menulis puisi siswa kelas x semester genap sma pasundan 3 cimahi pengaruh perbedaan individu lingkungan sosio-budaya behavioral intention google plus survei pengguna google plus indonesia model pembelajaran matematika meningkatkan kemampuan pemecahan masalah siswa sekolah dasar dongeng si kabayan kehidupan masyarakat sunda kajian watak nilai falsafah hidup penerapan pendidikan teknologi dasar (ptd) pembelajaran fisika meningkatkan pemahaman konsep technological literacy siswa meteri tekanan perbedaan tingkat efektivitas antara penerapan model inkuiri penerapan cooperative learning hasil belajar siswa mata pelajaran ipa sistem pendukung keputusan anggota kepolisian calon seleksi alih golongan (sag) menggunakan metode smart pengaruh modal kerja persaingan pendapatan survey pedagang sentra oleh-oleh khas kota bandung pengaruh penggunaan film dokumenter hasil belajar siswa mata pelajaran ips-sejarah kuasi eksperimen siswa kelas v sdn 1 jayagiri lembang pemanfaatan media pembelajaran audio visual (video) meningkatkan prestasi belajar siswa smk peternakan negeri lembang kajian bionukien rsri rsr2 diaplikasikan pertumbuhan hasil panen tanaman padi (oryza sativa l) analisis kredit bermasalah profitabilitas pt. bank tabungan negara (persero) tbk. jakarta periode 2007-2011 peranan orang tua membina ketaatan anak mendirikan sholat suatu studi deskriptif keluarga petani, pedagang nelayan desa kaliwiingi kecamatan brebes kabupaten brebes kajian tentang makna modernisasi pesantren terpadu menyimak keterpaduan kegiatan penyelenggaraan pendidikan luar sekolah pendidikan sekolah pesantren al-fath cicalengka bandung program pengendalian persediaan barang menggunakan model probabilistik q gerakan himpunan mahasiswa islam (hmi) masa peralihan pemerintahan soekarno menuju soeharto (1965-1966) penerapan strategi pembelajaran discovery menggunakan aplikasi search engine meningkatkan hasil belajar siswa mata pelajaran tik materi program pengolah kata kelas x sma 10 bandung penerapan pendekatan keterampilan proses meningkatkan hasil belajar siswa pembelajaran ipa konsep isolator konduktor sdn giri mekar kabupaten subang pelatihan sekar dalang wayang golek paguron munggul pawenang kota bandung pengembangan keterampilan berpikir kritis siswa sekolah dasar kelas v melalui pembelajaran children learning in science (clis) materi gaya magnet (suatu penelitian mixed methode siswa kelas v sd negeri werasari iii kecamatan malausma kabupaten majalengka) ajén moral jeung psikologi perkembangan rumaja dina novelét jamparing karya chye retty isnendes pikeun bahan pangajaran nyarita smp kelas ix rarangkén tukang dina kumpulan carita pondok rusiah kaopatwelas karya darpan tilikan struktur jeung semantis pengaruh media simulasi phet peningkatan prestasi belajar siswa konsep pembiasan cahaya gaya eksplanatori wanita menikah belum dikaruniai keturunan studi deskriptif dua wanita menikah belum dikaruniai keturunan studi komparasi potensi desa wisata wangunharja desa wisata sari bunihayu satuan kawasan wisata ciater kabupaten subang pembelajaran menulis karangan narasi ekspositoris (autobiografi) melalui teknik pembelajaran tari bambu media tayangan televisi “hitam putih trans 7” penelitian eksperimen semu siswa kelas vii smp laboratorium percontohan upi bandung 2013/2014 penerapan pendekatan contextual teaching and learning (ctl) pelajaran matematika materi bilangan bulat meningkatkan hasil belajar siswa hubungan penggunaan media film true story kebermaknaan belajar mahasiswa mata kuliah psikologi umum kesinambungan pengasuhan anak usia dini antara pendidik orang tua melalui buku penghubung studi deskriptif kelompok bermain laboratorium pg-paud upi efektivitas penggunaan bahan ajar interaktif berbasis terjemah arab sunda penguasaan kosa kata bahasa arab pengaruh bentuk latihan mengurangi kecemasan hasil free throw (tembakan bebas) cabang olahraga bola basket atlet sma negeri 9 bandung pengaruh model pembelajaran penemuan terbimbing (guided discovery) kemampuan berpikir kritis siswa kelas v sd materi gaya gesek (penelitian kuasi eksperimen siswa kelas v sdn parungjaya ii sdn ciparay i kecamatan leuwimunding kabupaten majalengka) hubungan antara pelaksanaan pembelajaran jurnalistik melalui experiential learning kemampuan menulis artikel program koran anak analisis faktor-faktor mempengaruhi fee audit dari segi client attribute studi perusahaan listing bursa efek singapura tahun 2011-2012 kesesuaian desain kurikulum implementasinya serta dampaknya kemampuan mahasiswa akhir pendidikan suatu studi evaluatif tentang kurikulum program studi manajemen patiseri, sekolah tinggi pariwisata bandung upaya meningkatkan prestasi belajar siswa pembelajaran ipa fisika kelas viii o smpn 1 rengasdengklok karawang melalui pendekatan kontekstual model cooperative learning adaptasi pengelolaan pembelajaran seni gambar ilustrasi tiga madrasah tsanawiyah negeri kabupaten bandung barat kontribusi kualitas kinerja pegawai bagian tata usaha menunjang keberhasilan pengelolaan pendidikan sekolah lanjutan tingkat pertama studi deskriptif analitik kinerja pegawai bagian tata usaha sltp negeri wilayah kota bandung timur) pembinaan karakter melalui seni tradisional menumbuhkan rasa cinta tanah air bangsa penerapan model pembelajaran konstruktivisme meningkatkan hasil belajar siswa konsep energi bunyi ptk kelas iv sdn pontang 1 kabupaten serang – banten tahun 2013 dampak kecemasan siswa hasil belajar renang gereja katolik bebas suatu kajian historis perkembangannya hindia belanda 1926-1942 pengaruh servicescape keputusan berkunjung ke padepokan dayang sumbi bandung sensus kepada instansi berkunjung ke padepokan dayang sumbi pengaruh direct marketing keputusan menggunakan meeting package mitra hotel bandung pengaruh pembelajaran problem based instruction (pbi) kemampuan pemecahan masalah matematis siswa sdpenelitian eksperimen materi pecahan biasa kelas iv sd negeri kubang kec. curug kota serang pengaruh model inkuiri kemampuan berpikir kritis siswa kelas v materi perubahan sifat benda. (penelitian eksperimen kelas v sdn i muara kelas v sdn ii muara kecamatan suranenggala kabupaten cirebon) perbandingan jump serve dari sisi kanan, tengah, sisi kiri hasil serve atlet bola voli senior alko bandung korelasi prestasi belajar, kemampuan berfikir kreatif, sikap sains siswa smpsetelah diterapkan pendekatan sains teknologi masyarakat lingkungan pembelajaran ipa-fisika analisis kebijakan pengembangan karier pegawai negeri sipil (pns) kebijakan pengembangan karier kepegawaian lingkungan kantor dinas pendidikan provinsi jawa barat efektivitas teknik permainan circular word puzzles meningkatkan keterampilan siswa menulis kalimat bahasa perancis berdasarkan evaluasi cecrl studi pra eksperimen siswa kelas xii program ips sma negeri 1 rancaekek 2012/2013 an analysis of contextual meaning on the idiomatic expression in the parent trap film script pengaruh pembelajaran partisipatif peningkatan kinerja tutor pelatihan tutor kejar paket b skb kulon progo propinsi daerah istimewa yogyakarta sintesis, karakterisasi, uji kinerja biohidrogel berbahan dasar egn-pva crosslinker glutaraldehida penerapan model cooperative learning tipe nht pembelajaran ipa meningkatkan hasil belajar siswa analisis nilai pengalaman berbelanja online melalui experiential marketing survei pembeli situs strategi pengembangan tari topeng sebagai daya tarik wisata budaya kabupaten cirebon efektivitas penggunaan media software read write hiragana penguasaan huruf hiragana penelitian kuasi eksperimen siswa kelas x sman 1 ciamis implementasi pembelajaran mandiri pembelajaran terompet penelitian tindakan pembelajaran terompet mata kuliah instrumen pilihan wajib i jurusan pendidikan seni musik universitas pendidikan indonesia pengaruh penetapan tujuan proses hasil belajar keterampilan dasar lob bertahan motivasi olahraga penerapan metode discovery meningkatkan hasil belajar siswa sd mata pelajaran matematika materi pokok bangun ruang penelitian tindakan kelas kelas iv sdn barunagri kecamatan lembang kabupaten bandung barat penerimaan pasangan religiusitas sebagai kepuasan pernikahan pasangan menikah melalui proses ta’aruf pasangan menikah melalui proses ta’aruf kota bandung pembelajaran berbasis praktikum virtual meningkatkan kemampuan berpikir kritis sikap ilmiah siswa kelas xi materi pengaruh hormon metabolisme program bimbingan teman sebaya meningkatkan penyesuaian diri siswa penelitian deskriptif siswa kelas x sma negeri 11 bandung 2012/2013 model pembelajaran bernyanyi meningkatkan artikulasi bicara anak autis penerapan pendekatan keterampilan proses meningkatkan hasil belajar siswa kelas vi pembelajaran ipa konsep isolator konduktor sdn giri mekar kabupaten subang analisis kemampuan siswa smk pertanian pembangunan negeri tanjungsari melakukan pembenihan ikan lele upaya meningkatkan kemampuan siswa membuat karya menerapkan konsep perubahan energi gerak melalui metode inkuiri pengaruh kompetensi kepuasan kerja kinerja karyawan studi persepsional karyawan bagian sumber daya manusia pt ultrajaya tbk pr0filpembinaan keimanan ketaqwaan siswa sekolah smu durul hikam bandung kontribusi motif berprestasi, konsep mengajar persepsi peranan penampilan kerja guru sma negeri kabupaten sumedang penerapan metode eksperimen meningkatkan hasil belajar siswa mata pelajaran ipa materi alat indra pengecapan rasa manusia pemberdayaan masyarakat berbasis ekonomi kreatif kampung wisata pasir kunci kota bandung pengaruh pembelajaran discovery learning peningkatan kemampuan literasi sains sikap ilmiah siswa smp materi ekosistem kepuasan pernikahan pasangan suami isteri terlibat dual career family tiga pasangan suami isteri kota bandung pengaruh penerapan model pembelajaran kooperatif tipe team games tournament hasil belajar siswa mata pelajaran ekonomi studi eksperimen standar kompetensi memahami konsep ekonomi kaitannya kegiatan ekonomi konsumen produsen siswa kelas x sma negeri 1 cimahi tindak tutur kiai mengenai syarah (penjelasan) kitab al-hikam tafsir al-qur’an ibu-ibu pengajian masjid nurul huda kampung cireungit garut penyelenggaraan program akselerasi belajar bagi peserta didik cerdas istimewa dilihat dari opini guru, orang tua peserta didik kontribusi penguasaan program autocad hasil prakerin siswa smk negeri 1 cilaku – cianjur penggunaan balok sempoa meningkatkan kemampuan operasi hitung perkalian siswa tunarungu penelitian eksperimen siswa tunarungu kelas iv sdlb kab. subang pengaruh model pembelajaran kooperatif tipe stad kemampuan berfikir kritis penguasaan konsep sistem reproduksi siswa kelas xi pengaruh teknik self control mengurangi perilaku bullying siswa tunalaras slb e prayuwana yogyakarta penggunaan catatan mind map meningkatkan hasil belajar siswa sd mata pelajaran ipa materi pokok peristiwa alam penelitian tindakan kelas kelas v sdn barunagri lembang analisis genitiv roman “café saratoga” karya schwerdtfeger implementasi metode inquiry berbasis isu-isu sosial kontemporer meningkatkan motivasi belajar siswa pembelajaran ips penelitian tindakan kelas siswa kelas viii h smp n 40 bandung studi perbandingan antara kurikulum smuta, smkta politeknik studi tentang pengalaman mahasiswa mengatasi kesulitan dihadapinya suatu studi kurikulum smuta, smkta politeknik pengalaman mahasiswa mengatasi kesulitan dihadapinya politeknik jurusan sipil program studi bangunan gedung efektivitas metode doktor cilik penguasaan kosakata bahasa arab legenda ciung wanara cerita bergambar menggunakan teknik pop-up studi evaluasi program pendampingan anak konflik hukum melalui keterampilan pengolahan limbah plastik rutan kelas i kebon waru peranan kyayi membina keimanan dan penelitian pesantren darul arqam muhammadiyah garut pengaruh dana pihak ketiga non performing loan penyaluran kredit (pt. bank icb bumiputera., tbk) pembinaan kemampuan profesional mahasiswa praktikan dilakukan oleh guru pamong smu kotamadya cirebon evaluasi tentang kinerja guru pamong kinerja mahasiswa praktek kesenian surak ibra kampung sindangsari desa cinunuk kecamatan wanaraja kabupaten garut penguasaan konsep motivasi belajar siswa sma kegiatan pembelajaran menggunakan media animasi konsep sistem pernapasan penelitian siswa kelas xi program keahlian teknik gambar bangunan sekolah menengah kejuruan negeri 6 bandung 2012/2013 implikasi kebijaksanaan fungsionalisasi jabatan pengawas sekolah peningkatan kinerjanya suatu studi deskriptif analitis peningkatan kinerja pengawas sekolah rumpun mata pelajaran smu lingkungan dinas pendidikan propinsi jawa barat pengelolaan klinik kerja mahasiswa fakultas kedokteran gigi universitas padjadjaran rangka menyediakan tenaga dokter gigi studi evaluatif tentang pelaksanaan standar klinik kerja mahasiswa implementasi pendekatan taktis pembelajaran forehand groundstroke permainan tenis lapang penelitian tindakan kelas siswa kelas x2 sma negeri 3 karawang the use of ‘one stays rest stray’ technique in teaching reading comprehension of narrative text pengaruh penggunaan pendekatan brain-based learning berbantuan geogebra pembelajaran matematika conceptual and procedural knowledge siswa sma penggunaan metode montessori meningkatkan kemampuan menulis anak usia dini strategi pengembangan taman wisata alam gunung tampomas sebagai kawasan ekowisata kabupaten sumedang implementasi manajemen inovasi pendidikan nonformal pusat pengembangan pendidikan anak usia dini,nonformal informal regional 1 jaya giri bandung the use of comic strips in improving students’ reading comprehension of narrative texts a quasi-experimental research in eight grade students of a junior high school in bandung analisis faktor-faktor mempengaruhi hasil produk bolu tape pabrik liana cake jakarta barat pemanfaatan lingkungan sekolah sebagai sumber belajar meningkatkan hasil belajar afektif siswa mata pelajaran pkn studi deskriptif smp pasundan 4 bandung efektivitas penggunaan software mind map metode quantum learning meningkatkan kemampuan menyimak cerita pendek ( studi kuasi eksperimen mata pelajaran bahasa indonesia media pembanding microsoft powerpoint siswa kelas vi sdn 6 cikidang kecamatan lembang kabupaten bandung barat) kajian tentang kecerdasan sosial mahasiswa pelatihan manajemen kepemimpinan efektif proses pelatihan manajemen kepemimpinan mahasiswa efektif jurusan pendidikan kewarganegaraan fakultas pendidikan ilmu pengetahuan sosial universitas pendidikan indonesia transliterasi jeung ajén kaagamaan dina naskah wawacan suluk dua pandita rai sareng raka pengaruh kompensasi lingkungan kerja produktivitas kerja pegawai pt. pindad (persero) bandung program bimbingan karir meningkatkan kompetensi komunikasi interpersonal sales promotion girl desain hybrid magnetic sensor menguji jenis logam pengaruh motivasi disiplin kerja kinerja pegawai bidang koperasi dinas koperasi ukm perindustrian perdagangan kota bandung kepemimpinan transaksional kerjasama kelembagaan smea negeri kotamadia bandung kajian tentang gaya dampaknya fungsi sekolah kebutuhan personal faktor picu kepemimpinan pesantren menyimak faktor picu kepemimpinan pesantren buntet desa martapada kecamatan astanajapura kabupaten dt ii cirebon penerapan model pembelajaran sinektik meningkatkan kemampuan berpikir kreatif komunikasi matematis siswa madrasah tsanawiyah penggunaan media video tama tamako’s nihongo learning animations-let’s learn japanese! upaya meningkatkan pemahaman tata bahasa jepang tingkat dasar studi eksperimen siswa sma pasundan 3 bandung kelas xi 2012-2013 kepedulian masyarakat kelurahan ciumbuleuit kecamatan cidadap kota bandung wilayah punclut sebagai kawasan konservasi kawasan bandung utara (kbu) pengaruh manajemen sarana prasarana mutu layanan sarana prasarana diklat pusat pendidikan pelatihan (pusdiklat) geologi bandung pengaruh konsep diri, pengetahuan kewirausahaan, lingkungan keluargaterhadap minat berwirausaha survey mahasiswa fakultas pendidikan ekonomi bisnis upi mengatasi kesulitan siswa sd menemukan ide pokok suatu wacana denganmenggunakan metode cooperative learning tipe jigsaw perbandingan kinerja guru sudah lulus sertifikasi belum disertifikasi pembelajaran pendidikan jasmani smp negeri kabupaten bandung pengaruh implementasi good governance kinerja pegawai kantor pelayanan perbendaharaan negara bandung ii penerapan pendekatan contextual teaching and learning (ctl) pembelajaran matematika materi bangun ruang meningkatkan hasil belajar siswa perkembangan industri kaos sablon kecamatan cibeunying kaler kota bandung tahun 1995-2008 kajian sosial ekonomi kajian potensi ekstrak metanol etil asetat bionutrien arh pertumbuhan perkembangan tanaman padi (oryza sativa l.) teknik permainan terka aksi pembelajaran kosakata bahasa jepang studi eksperimen siswa kelas xi sma negeri 1 bandung 2012/2013 penyelesaian model lexicographic goal programming penerapan strategi pembelajaran problem solving reading infusion meningkatkan prestasi belajar mengetahui profil kemampuan berpikir kritis siswa sma pembelajaran tari sanggar ringkang guniwang yayasan pusat kebudayaan bandung efektivitas metode drill multimedia meningkatkan keterampilan menulis huruf hiragana analisis pengaruh terapan kit praktikum skala kecil aspek psikomotor siswa kelas x sma pembelajaran larutan elektrolit larutan non elektrolit penerapan model children’s learning in science (clis) meningkatkan penguasaan konsep ipa hubungan antara iklim keselamatan kerja keterikatan kerja intensi turnover karyawan divisi produksi pt polytama propindo pemanfaatan arcgis memetakan sungai kota bandung pengaruh likuiditas kecukupan modal pt bank syariah mandiri pembelajaran menulis karangan argumentasi melalui pemanfaatan tayangan editorial media indonesia metro tv penelitian eksperimen semu siswa kelas x sman 2 bandung 2012/2013 kemampuan representasi siswa sma berdasarkan gaya belajar (vark) hubungannya penguasaan konsep materi pertumbuhan perkembangan tumbuhan pengaruh metode latihan stabilisasi kekuatan otot lengan kekuatan otot tungkai perenang gaya kupu-kupu efektivitas media bande-annonce des contes meningkatkan keterampilan berbicara efektivitas model pembelajaran kooperatif tipe investigasi kelompok prestasi belajar siswa penerapan metode simulasi meningkatkan keaktifan belajar siswa konsep cahayaptk kelas v sd negeri tamanbaru i kec.citangkil kota cilegon analisis faktor – faktor berpengaruh kepuasan konsumen menu unpopular unprofitable restoran lokomotif kuliner bandung implementasi permainan arisan kata tk baiturrahman pusdikku tni ad-bandungstudi deskriftif kelompok a tk baiturahman pusdikku tni ad,kota bandung, tahun pelajaran 2012-2013 aplikasi fuzzy quantification theory ii membandingkan kepuasan pelanggan program listrik pascabayar program listrik prabayar efektivitas teknik manajemen diri mengurangi kecanduan online game penelitian eksperimen kuasi siswa kelas ix smpn 40 bandung 2012/2013 pengamanan pesan rahasia menggunakan algoritma kriptografi rivest shamir adleman (rsa) analisis perbandingan metode dekonvolusispiking dekonvolusi prediktif meningkatkan rasio s/n data seismik 2d multichannel laut flores dinamika multikulturalisme kanada (1968-2006) analisis metode surface related multiple elimination (srme) transformasi radon penekanan multiple data seismik 2d marine perairan utara papua code switching in indonesian idol 2012 program a case study of the judges’ comments and the viewers’ attitude penanda waktu bahasa sunda kecamatan kasomalang,kabupaten subang pembelajaran keterampilan seni tari kreasi siswa tunarungu tingkat menengah slb b-c pambudi dharma 2 kota cimahi kajian tentang budaya demokrasi pesantren mengembangkan civic disposition santri studi deskriptif pesantren al-basyariah bandung penerapan startegi literasi pembelajaran bertema alat ukur gerak kendaraan bermotor meningkatkan literasi fisika smp program bimbingan karir berdasarkan profil kompetensi karir penelitian deskriptif peserta didik kelas x smk profita bandung 2012/2013 peranan mahathir mohamad sebagai bapak modernisasi malaysia tahun 1981-2003 meningkatkan kemampuan memahami konsep pengukuran berat anak taman kanak-kanak melalui metode pembelajaran penemuan terbimbing penelitian tindakan kelas kelompok b tk nanda ceria kecamatan losarang kabupaten indramayu pembelajaran tari anak usia dini sanggar sekar panggung metro mall bandung pengaruh disiplin belajar perhatian orang tua hasil belajar siswa mata pelajaran ekonomi suatu kasus siswa kelas xi ips sma negeri 23 bandung penerapan model pembelajaran inquiry based science plus reading (isr) meningkatkan hasil belajar ranah kognitif siswa smp mata pelajaran fisika pengaruh penggunaan model pembelajaran kooperatifteknik make a matchterhadap peningkatan hasil belajar siswa ranah psikomotor mata pelajaran teknologi informasi komunikasi studi kuasi eksperimen siswa kelas viii smp negeri 43 bandung mata pelajaran teknologi informasi komunikasi pengaruh perkembangan wisata budaya kondisi sosial ekonomi menurut persepsi masyarakatdi desa cireundeu pengaruh model problem based learning hasil belajar akuntansi siswa kelas xi ips sma laboratorium upi 2012/2013 pokok bahasan ayat jurnal penyesuaian evaluasi event marketing csr “camejasa” citra taman lalu lintas kota bandung penerapan metode jigsaw ii pembelajaran membaca teks biografi penelitian eksperimen semu siswa kelas xi sma pasundan 2 bandung 2012/2013 pengaruh pembelajaran bola voli modifikasi keberanian kebugaran jasmani siswa tunagrahita studi eksperimen slb-c angkasa kab. bandung pelaksanaan pembelajaran mendengarkan cerita melalui digital talking book player bagi anak tunanetra slb budi nurani kota sukabumi penerapan metode pembiasaan menumbuhkan karakter kemandirian anak usia dini 5-6 tahun lingkungan keluarga studi tiga keluarga lingkup kelompok bermain tunas bangsa pengaruh kualitas pelayanan perilaku purna pembelian produk meeting package ciater spa resort kabupaten subang pengaruh model sains teknologi mayarakat (stm) hasil belajar siswa sd kelas iv materi perubahan lingkungan (penelitian true eksperiment kelas iv sdn sindanghaji i sdn tarikolot i kecamatan palasah kabupaten majalengka) campur kode basa panganteur dina prosés pangajaran basa jeung sastra sunda smp negeri 1 purwadadi kecamatan purwadadi kabupaten ciamis taun ajaran 2012/2013 pengaruh direct mail telemarketing keputusan pembelian paket umrah raka tours and travel survei pengguna paket umrah raka tours and travel modél debate pikeun ngaronjatkeun pangaweruh jeung kamampuh maké undak usuk basa sunda dina nyarita studi kuasi ékspérimén ka siswa kelas viii b smpn 1 cingambul-majalengka taun ajar 2012/2013 penerapan model pembelajaran make a match meningkatkan motivasi belajar siswa pembelajaran pendidikan kewarganegaraan studi deskriptif siswa kelas vii smp negeri 1 tanjungsari studi konsentrasi tepung tape ketan brownies tape ketan & variansnya daya terima konsumen kota kuningan pengaruh penerapan e-government pelaksanaan tata kelola pemerintah pemerintah kabupaten cianjur pengaruh packaging proses keputusan pembelian paket wisata olahraga rafting arus liar survei wisatawan menggunakan paket wisata olahraga rafting arus liar representasi oedipus kompleks novel cerita cinta enrico karya ayu utami (kajian psikoanalisis) pengaruh pembelajaran pendekatan pemecahan masalah peningkatan kemampuan analisis sintesis matematis siswa smk profil perilaku merokok siswa kelas xi ips sma pasundan 8 bandung 2012/2013rancangan strategi pengelolaan diri mereduksi perilaku merokok siswa pendekatan “pakem” pembelajaran kawih siswa kelas vii smpn 29 bandung implementasi nilai-nilai patriotisme siswa melalui kajian biografi raden haji prawatasari pembelajaran sejarah penelitian naturalistik inkuiri sman 1 cianjur gambaran pengetahuan warga tentang hipertensi rw 02 sukarasa kecamatan sukasari persepsi mahasiswa tentang implementasi pancasila kehidupan berbangsa bernegara indonesia pengaruh implementasi capacity building pemberdayaan sumber daya manusia motivasi kerja pegawai balai pelatihan manajerial pt. kereta api indonesia (persero) bandung program bimbingan pribadi sosial mengembangkan hubungan interpersonal peserta didik studi pra eksperimen peserta didik kelas xi sma negeri 11 bandung ajaran 2013/2014 pengaruh citra destinasi pariwisata kabupaten belitung perilaku pasca berkunjung wisatawan nusantara pengaruh iklim sekolah kreativitas guru mengelola pembelajaran hasil belajar siswa mata pelajaran ekonomi program bimbingan menggunakan teknik finger painting mengembangkan kreativitas anak usia dini studi eksperimen kuasi siswa kelas b paud nurrahman tanjung barat jakarta selatan 2012-2013 strategi pemberdayaan fungsi perencanaan pendidikan kantor dinas pendidikan tingkat kabupaten rangka pelaksanaan otonomi daerah rekonstruksi desain pembelajaran elektrokimia menggunakan konteks keris melalui analisis metapedadidaktik faktor-faktor mempengaruhi keberhasilan mahasiswa mata kuliah konstruksi bangunan i program studi pendidikan teknik bangunan jpts fptk upi pengaruh motivasi kinerja pegawai upt. bbpttg-lipi subang pengaruh penggunaan metode pembelajaran diskusi kemampuan pemahaman konsep siswa efektivitas teknik psikodrama meningkatkan penerimaan diri peserta didik penerapan multimedia interaktif model tutorial peningkatan pemahaman konsep siswa mata pelajaran teknologi informasi komunikasi pengaruh pendidikan dasar pecinta alam peningkatan sikap cinta tanah air siswa kota cirebon pengaruh pembelajaran kooperatif melalui aktivitas menulis matematika pembelajaran langsung kemampuan komunikasi matematis siswa smp pengaruh kompensasi disiplin kerjaterhadap kinerja mengajar guru sekolah menengah pertama swasta terakreditasi a kota bandung penggunaan buchstabensalat sebagai media pembelajaran kata sifat sma kartika xix-2 bandung pengaruh kualitas pembelajaran praktikum efektivitas praktek kerja industri tingkat kompetensi kejuruan akuntansi survey siswa smk kompetensi keahlian akuntansi kabupaten cianjur implementasi konsep pendidikan politik pendidikan pancasila kewarganegaraan sebagai pendidikan umum smu studi naturalistik pendidikan nilai moral smun 1 sumedang pengaruh sistem upah kerja kinerja karyawan bagian produksi pt. garuda mas semesta (gamatex) cimahi pengaruh kinerja keuangan harga saham teachers’ perceptions towards the use of english textbook in efl classrooms an analysis on students’ ability and difficulty in writing narrative text a research study concerning on writing skill of eleventh grade student pengaruh investment opportunity set (ios), komisaris independen, kepemilikan manajerial, kepemilikan institusional kualitas laba studi perusahaan manufaktur terdaftar bursa efek indonesia keefektifan strategi pembelajaran bersafari berminat, sangat menguasai, fakta, rabuk pancaindra, diksi pembelajaran menulis cerpen penerapan pendekatan differentiated instruction peningkatan kemampuan pemecahan masalah penalaran matematis siswa sma pengaruh kompetensi kepuasan kerja kinerja karyawan perubahan sosial budaya masyarakat betawi jakarta masa kepemimpinan gubernur ali sadikin 1966-1977 studi komparasi antara penggunaan media interaktif media handout materi toleransi suaian mata pelajaran gambar teknik pengembangan model pembelajaran investigasi menggunakan modul mata pelajaran ipa sekolah dasar penggunaan media sumpit sambung meningkatkan kemampuan mengenal bentuk bangun datar sederhana bagi anak tunagrahita ringan kelas ii sdlb c slb b/c tut wuri handayani studi pengembangan panduan belajar komputer microsoft office 2007 bagi guru mengajar peserta didik tunanetra smplb smalb pendayagunaan dosen tetap bantuan pemerintah perguruan tinggi swasta kopertis wilayah iv jawa barat pergeseran fungsi tari ja’i dari ritual ke profan kota kupang sistem pembinaan kemampuan profesional guru melalui kegiatan gugus sekolah gugus 03 tentang pelaksanaan pembinaan kemampuan profesional guru melalui kegiatan gugus sekolah lingkungan cabang dinas pendidikan kecamatan sukasari kota bandung efektivitas pelaksanaan pelatihan tenaga perawat rumah sakit tentang pelaksanaan pelatihan tenaga perawat rsup dr hasan sadikin bandung pembelajaran berbasis tik model stad meningkatkan penguasaan konsep retensi pengetahuan materi sistem pencernaan makanan penampilan guru pmp proses belajar mengajar rangka membina nilai-moral pancasila sma negeri kota madia bengkulu studi kualitatif pembinaan moral pancasila penerapan pendekatan konstruktivis konsep ciri – ciri makhluk hidup meningkatkan hasil belajar siswa pembelajaran ipa penerapan pendekatan konstruktivis meningkatkan hasil belajar siswa pembelajaran ipa meningkatkan kemampuan membaca dini melalui penggunaan media flipchart penerapan model stm meningkatkan hasil belajar siswa konsep perkembangan teknologi transportasi pembelajaran ips sd kelas iv sdn cisereh 1 kecamatan tigaraksa kabupaten tangerang pergeseran nilai-nilai multikultural hubungan sosial antar etnik tiga komunitas kota ternate pasca konflik. program studi pendidikan ilmu pengetahuan sosial (pips) sekolah pascasarjana universitas pendidikan indonesia studi analisis pelaksanaan supervisi pendidikan sekolah - sekolah dasar kota madya ambon penampilan guru pmp proses belajar mengajar rangka membina nilai-moral pancasila sma negeri kota madia bengkulu studi kualitatif pembinaan moral pancasila asesmen aspek emosi mengetahui hambatan perkembangan emosi anak prasekolah penerapan model pembelajaran kooperatif tipe group investigation meningkatkan hasil belajar siswa mata pelajaran ilmu bahan bangunan program bimbingan akademik meningkatkan motivasi belajar siswa studi quasi eksperimen siswa kelas x sma negeri 5 bandung 2012/2013 pembelajaran membaca kwl (what i know – what i want to learn - what i learned) meningkatkan kemampuan membaca pemahaman berbicara siswa kelas v sd penggunaan metode peta pikiran (mind mapping) meningkatkan kemampuan menulis narasi pembelajaran bahasa indonesia penggunaan media kartu huruf meningkatkan kemampuan menulis permulaan penelitian tindakan kelas kelas i sdn sumbersari 01 kecamatan pebayuran kabupaten bekasi pengendalian motor tiga fase melalui jaringan internet implementasi media gambar seri peningkatan kemampuan menulis karangan deskripsi siswa kelas v sdn kelanggaran unyur kota serang penerapan pendekatan inkuiri meningkatkan hasil belajar siswa mata pelajaran ipa materi pengaruh perubahan lingkungan fisik daratan kelas iv semester ii sdn 2 langensari kabupaten bandung barat pengaruh pelatihan, kepuasan kerja, motivasi komitmen organisasi kualitas pelayanan pendidikan sekolah-sekolah yayasan salib suci wilayah bandung pertumbuhan vegetatif kandungan klorofil capsicum annuum l. lycopersicon esculentum m. terpapar sipermetrin perbandingan penggunaan model guided inquiry (inkuiri terbimbing) model guided discovery learning meningkatkan prestasi belajar siswa pembelajaran fisika penerapan metode kolaborasi pembelajaran menulis paragraf naratif ekspositoris penelitian eksperimen semu siswa kelas x sma angkasa lanud husein sastranegara bandung 2012/2013 pengaruh hasil penyuluhan asi eksklusif kemampuan penyusunan menu ibu laktasi perbedaan minat menonton program tayangan televisi ditinjau dari tipe kepribadian the big five studi deskriptif komparatif mahasiswa universitas pendidikan indonesia peran kader bina keluarga balita (bkb) optimalisasi fungsi edukasi keluarga orang tua bkb studi deskriptif bkb amarilis mengenai penyuluhan pola asuh keluarga dusun tegal mantri kelurahan lembang kabupaten bandung barat keefektifan metode pembelajaran bahasa komunitas berorientasi kecakapan hidup bagi peningkatan kemampuan membaca pemahaman penelitian subjek tunggal peserta kelompok belajar pendidikan keaksaraan nagari salayo kecamatan kubung kabupaten solok pengelolaan sistem pendidikan pelatihan badan pendidikan pelatihan daerah provinsi jawa barat the use of mind map technique in improving students’ reading comprehension identifikasi protozoa usus rayap (macrotermes gilvus hagen) daerah cihanjuang bandung pengaruh kapasitas sumber daya manusia, pemanfaatan teknologi informasi, komitmen organisasi kualitas informasi laporan keuangan pemerintah daerah kota bandung peranan k.h.e yasin bidang pendidikan menes pandeglang banten tahun 1916-1938 perbandingan penerapan model collaborative learning model student teams achievement division peningkatan hasil belajar siswa mata pelajaran teknologi informasi komunikasi kuasi eksperimen siswa kelas viii smpn 40 kota bandung keefektifan model arcs (attention, relevance, confidence, satisfaction ) mengungkapkan kritik pembelajaran berbicara penelitian eksperimen semu kelas xi sma negeri 5 bandung 2012/2013 penerapan permainan kartu kata meningkatkan kemampuan menulis puisi siswa kelas v sdn 1 beber kecamatan beber kabupaten cirebon pengaruh model learning cycle peningkatan kemampuan penalaran induktif siswa smp mplementasi redesain buku ajar kimia menggunakan batik sebagai konteks pembelajaran menigkatkan literasi sains siswa sma to be enchanted or enchanting? a fairytale reproduced application de la méthode word square dans l’apprentissage du vocabulaire français pour augmenter la competénce de la production écrite pengembangan bahan ajar berbasis web topik teori atom mekanika kuantum pengaruh kelengkapan peralatan kerja kayu efektivitas pembelajaran praktikum pelaksanaan konstruksi kayu smk negeri 1 kota sukabumi hubungan kinerja prestasi belajar siswa siswa smk pembelajaran elastisitas ajen estetika dina seni raja dogar kacamatan cibatu kabupaten garut pikeun bahan pangajaran maca kelas xii madame mao the white bone demon penerapan model cooperative learning tipe nht (numbered heads togethers) topik alat indra manusia meningkatkan hasil belajar siswa mata pelajaran ipa penelitian tindakan kelas sd negeri pagadean kelas iv semester i tahun pelajaran 2012/2013 kecamatan subang kabupaten subang penerapan metode inkuiri meningkatkan hasil belajar siswa mata pelajaran ipa tentang bagian-bagian tumbuhan fungsinya kelas iv sekolah dasar penelitian tindakan kelas sekolah dasar negeri cibeureum hilir 1 kecamatan cibeureum kota sukabumi analisis penerapan psak 107 tentang akuntansi ijarah pembiayaan perbankan syariah penerapan model cooperative learning tipe nht (numbered heads togethers) topik alat indra manusia meningkatkan hasil belajar siswa mata pelajaran ipa pengaruh sikap konsumen proses keputusan pembelian notebook asus a series survei kepada pemilik notebook asus a series grup facebook asus a/k/x/n series community indonesia kemampuan guru sd melaksanakan tugas bagi telah mengikuti tugas belajar program s-1 lingkungan dinas p k dati i propinsi riau penerapan strategi rave ccc meningkatkan kemampuan pemecahan masalah berpikir logis matematis siswa sekolah menengah pertama pengaruh kinerja mengajar guru pemanfaatan fasilitas belajar mutu layanan akademik sekolah menengah pertama se-bandung utara analisis faktor-faktor mempengaruhi permintaan murabahah kpr survey bank umum syariah indonesia penerapan strategi lightening the learning climate pembelajaran seni tari meningkatkan motivasi siswa kelas vii smpn 19 bandung efektivitas penerapan model pembelajaran cooperative learning metode diskusi teknik numbered heads together (nht) peningkatan hasil belajar siswa mata pelajaran ekonomi studi eksperimen kelas x ma yasyfiy bandung studi kebutuhanruang parkirrumah sakit al islam bandung pengaruh penggunaan model pembelajaran advance organizer kemampuan penguasaan konsep studi kuasi eksperimen kompetensi dasar mengidentifikasi dokumen kantor kelas x program keahlian administrasi perkantoran smk negeri 11 bandung 2013/2014 pengaruh persepsi orangtua tentang anak usia pernikahan pola asuh anak studi keluarga menikah usia muda wilayah rw 17 desa cigugur girang kecamatan parongpong kabupaten bandung barat pengaruh biaya pendidikan kinerja guru prestasi belajar siswa studi deskriptif analitis sma negeri kabupaten purwakarta penerapan metode diskusi kelompok menumbuhkan aktivitas belajar siswa pembelajaran sejarah penelitian tindakan kelas dikelas xi ips 3 sma pasundan 1 cianjur pembelajaran inkuiri terbimbing meningkatkan literasi sains kepercayaan diri siswa konsep larutan asam basa pengaruh model project based learning (pjbl) berbantu multimedia interaktif peningkatan kemampuan pemahaman konsep siswa mata pelajaran tik penerapan model picture and picture pembelajaran ipa materi perubahan lingkungan pengaruhnya meningkatkan hasil belajar siswa penelitian tindakan kelas siswa kelas iv sdn 4 cibodas kecamatan lembang kabupaten bandung barat 2012-2013 profil miskonsepsi siswa kelas xi smk materi gelombang bunyi berdasarkan hasil three-tier test penerapan hasil belajar “menggambar ornamen” pembuatan desain motif batik kontemporer pengaruh kompensasi motivasi implikasinya kinerja karyawan bagian produksi pt primarindo asia infrastructure, tbk bandung penerapan cooperative learning tipe student team achievement devision (stad) konsep energi panas meningkatkan hasil belajar siswa pembelajaran gerak manusia berbasis nilai tipe teams games tournament penguasaan konsep komunikasi siswa multimedia pembelajaran sel volta bermuatan sains teknologi nano konteks sel surya meningkatkan literasi sains siswa penerapan microteaching berbasis pembelajaran pkn kontekstual pembangunan kompetensi mengajar (pedagogik) mahasiswa (studi eksperimen kuasi mahasiswa pkn fkip unlam banjarmasin the preparation, administration and scoring of english speaking tests at tertiary education levels pengembangan desain kurikulum pendidikan pelatihan meningkatkan kemampuan guru pengembangan media pembelajaran berbasis tik komitmen pemerintah daerah pembangunan bidang pendidikan era otonomi daerah kebijakan publik kabupaten kota bekasi studi tentang pengajaran membaca permulaan tulisan al-qur'an menggunakan metode iqro t.k. al-qur'an kodya bandung pengaruh kompensasi tidak langsung disiplin kerja pegawai lingkungan kantor bidang pendidikan menengah tinggi dinas pendidikan provinsi jawa barat efektivitas penggunaan media pembelajaran interaktif flash card meningkatkan pemahaman siswa hukum tajwīd studi eksperimen sub bahasan hukum bacaan madd waqaf smp negeri 51 bandung semester genap tahun pelajaran 2012/2013 pengaruh model sains teknologi masyarakat (stm) kemampuan berpikir kritis siswa kelas v materi peristiwa alam indonesia (penelitian eksperimen kelas v sdn bongas wetan iii sdn bongas wetan iv kecamatan sumberjaya kabupaten majalengka) sistem informasi manajemen kanwil depdikbud propinsi sumatera barat studi deskriptif-analitik bidang garapan kesiswaan penerapan metode demonstrasi pembelajaran membaca puisi mata pelajaran bahasa indonesia sekolah dasar penelitian tindakan kelas kelas v sdn sekarwangi ii kecamatan rawamerta kabupaten karawang tahun pelajaran 2012/2013 pengaruh penggunaan simulator sebagai media pembelajaran meningkatkan aktivitas hasil belajar peserta didik kompetensi sistem starter peserta didik smk vijaya kusuma kelas xi tkr 2 penerapan model cooperative picture and picture pembelajaran matematika pokok bahasan penjumlahan pengurangan pecahan meningkatkan hasil belajar siswa pengaruh profitabilitas harga saham pt. mandom indonesia tbk periode 2001-2010 pengaruh pendapatan gaya hidup perilaku konsumsi masyarakat pengenalan keterampilan analisis data anak tk melalui penggunaan media grafik penelitian tindakan kelas anak kelompok b tk al-kahfi komplek bandung indah raya blok c.13 no. 22 kecamatan rancasari kota bandung 2012-2013 pelaksanaan pengawasan dprd kebijakan perda no. 20 tahun 2002 tentang penyelenggaraan pendidikan studi deskriptif dprd kota bandung mengenai pelanggaran pungutan liar sekolah teachers’ strategies in teaching listening comprehension a descriptive study at an english department in one of state universities in bandung pendekatan lingkungan meningkatkan hasil belajar pembelajaran ipa tentang bagian-bagian tumbuhan penerapan pendekatan lingkungan meningkatkan hasil belajar siswakelas iv pembelajaran ipa tentang bagian-bagian tumbuhan analisis faktor-faktor mempengaruhi produktivitas tenaga kerja profil motivasi berprestasi peserta didik implikasinya bimbingan konseling studi deskriptif siswa kelas x sekolah menengah atas negeri 1 majalengka 2012/2013 penggunaan model advance organizer meningkatkan kemampuan koneksi matematik motivasi belajar siswa smp pengembangan program pelatihan kemampuan inkuiri membelajarkan sains berbasis inkuiri pemodelan bagi guru-guru sekolah dasar evaluasi alat penilaian ujian kenaikan kelas mata pelajaran produktif smkn 1 karangtengah cianjur keterlibatan stakeholder strategi perencanaan pendidikan perguruan tinggi swasta pengembangan universitas tirtayasa banten / persiapan universitas negeri sultan ageng tirtayasa keppres no. 130/1999 stia maulana yusuf banten kabupaten serang perkembangan politik kawasan tanduk afrika perjuangan eritrea menuntut kemerdekaan 1962-1993 pengaruh pembelajaran permainan bola kecil (permainan bola bakar) nilai disiplin siswa mata pelajaran pasca pendidikan jasmani meningkatkan kreativitas melalui kegiatan mencipta bentuk kreatif dari barang bekas piring styrofoam penelitian tindakan kelas tk tunas harapan kelompok b.1 kec. kotabaru, kab. karawang 2013-2014 penerapan pendekatan brain based learning meningkatkan hasil belajar fisika siswa smp strategi peningkatan mutu pendidikan program studi langka peminat ptain studi program studi aqidah filsafat uin sunan kalijaga yogyakarta, iain walisongo semarang stain surakarta peningkatan kemampuan berpikir kritis matematis siswa smp melalui pembelajaran metode inkuiri implementasi program pendidikan lingkungan hidup taman kanak-kanak studi deskriptif tk negeri centeh kota bandung pembelajaran inkuiri topik larutan penyangga meningkatkan penguasaan konsep keterampilan proses sains siswa sma upaya meningkatkan hasil belajar matematika tentang penjumlahan bilangan bulat melalui pendekatan realistik penelitian tindakan kelas pembelajaran matematika kelas ii sdn 1 parungtanjung kecamatan gunungputri – kabupaten bogor media flash card pikeun ngaronjatkeun kamampuh nulis aksara sunda panalungtikan tindakan kelas siswa kelas x-1 semester 1 sman 1 majalaya taun ajaran 2012/2013 pengaruh pembelajaran interactive demonstration peningkatan kemampuan literasi sains sikap ilmiah siswa smp materi ekosistem penerapan pendekatan contextual teaching and learning (ctl) meningkatkan hasil belajar ipa tentang perubahan kenampakan bumi penelitian tindakan kelas kelas iv sdn cikarang kecamatan cidolog kabupaten sukabumi tahun pelajaran 2012/2013 program bimbingan pribadi-sosial meningkatkan kemampuan penyesuaian diri peserta didik smp studideskriptifterhadap peserta didikkelas vii smp negeri 5 bandung 2012/2013 perlindungan hukum pejalan kaki jalan-jalan protokol kajian pendidikan kewarganegaraan kota bandung upaya meningkatkan hasil belajar siswa pembelajaran ipa tentang daur hidup hewan menggunakan media audio visual kelas iv sdn cisalak 2 cimanggis depok penerapan metode eksperimen upaya meningkatkan hasil belajar siswa mata pelajaran ipa materi sifat-sifat cahaya kelas v sdn sukahegar desain didaktis konsep luas daerah jajargenjang pembelajaran matematika sekolah menengah pertama (smp) penerapan pembelajaran problem solving (pemecahan masalah) berbantu multimedia interaktif meningkatkan kemampuan metakognitif siswa mata pelajaran perakitan personal computer mengatasi kesulitan siswa kelas i sdnegeri kubang pembelajaran membaca permulaan metode global upaya mengembangkan kemampuan berbicara menggunakan media audio visual siswa kelas i sd negeri cigobang kecamatan ganeas kabupaten sumedang pengaruh metode pemetaan pikiran(mind mapping) keterampilan pemecahan masalah problem solving skill)anak taman kanak-kanak penelitiankuasieksperimen ra baitul huda kelas b kec.baleendah kab. bandungtahunpelajaran2012-2013 pengambilan keputusan memilih pasangan menikah perempuan keturunan arab implementasi playdough menstimulasi kemampuan motorik halus penelitian tindakan kelas kelompok a tk artha kencana, kota serang banten 2012-2013 éféktivitas média gambar jeung kartu kata pikeun ngaronjatkeun kamampuh siswa nulis karangan éksposisi kelas vii smp negeri 1 sukawening garut taun ajaran 2012/2013 textual meaning in song lyrics hubungan kecemasan (anxiety) hasil bertanding olahraga woodball efektivitas pembelajaran menggunakan media berbasis teknologi informasi dilihat dari respon hasil belajar siswa efektivitas permainan sprachbaukasten meningkatkan pemahaman penggunaan artikel bahasa jerman aspék humor dina kumpulan carpon ki merebot karangan ahmad bakri pikeun bahan pangajaran maca carpon smp kelas vii peningkatan daya dukung tanah lempung ekspansif fly-ash sebagai subgrade ruas jalan cibarusah cikarang jawa barat perbedaan tingkat profesionalisme guru kualitas proses pembelajaran berdasarkan latar belakang pendidikan guru smk program studi keahlian teknik elektronika ketenagalistrikan wilayah priangan timur pemanfaatan citra quickbird evaluasi kesesuaian antara lokasi industri rencana tata ruang wilayah tegallega strategi pengembangan fasilitas akomodasi sebagai fasilitas pendukung kampung seni wisata mangalayang desa cinunuk kecamatan cileunyi kabupaten bandung manfaat hasil belajar busana pengantin sebagai kesiapan membuka usaha busana pengantin pengaruh kompetensi sumber daya manusia pengelola keuangan pengendalian internal kualitas laporan keuangan survey lembaga dana pensiun kota bandung meningkatkan gerak dasar passing bawah bola voli melalui modifikasi ketinggian net siswa kelas v sdn sukamanah kecamatan cisalak kabupaten subang peranan tari kesenian koromong upacara panen di dusun cikubang representasi ketidakadilan gender naskah pertja karya benny yohanes kajian feminisme pengaruh implementasi experiential marketing loyalitas tamu padma hotel bandung survei tamu reguler menginap padma hotel bandung efektivitas penggunaan media ludo meningkatkan kemampuan siswa konjugasi verba pengaruh pendekatan problem solving kemampuan pemahaman koneksi matematis siswa materi pecahan (penelitian eksperimen siswa kelas v sdn liangjulang iii liangjulang vi kecamatan kadipaten kabupaten majalengka) manfaat hasil belajar makanan oriental 1 kesiapan usaha restoran oriental kajian nilai budaya pesta laut nadran masyarakat pesisir sebagai sumber pembelajaran pendidikan kewarganegaraan studi deskriptif analitis tradisi upacara nadran desa waru duwur kecamatan mundu kabupaten cirebon analisis ungkapan sambung –nagara, -tsutsu, -kuseni sebagai pengungkap makna pertentangan novel sannenme no irisu karya genchi akira pemetaan jaringan jalan kabupaten sumedang gerakan partai komunis indonesia strategi partai mencapai kekuasaan politik indonesia (1920-1966) pengaruh pemberian layanan bimbingan belajar motivasi belajar siswa kelas x jurusan teknik bangunan smkn 6 bandung 2012/2013 perbedaan tingkat pencahayaan alami buatan ruang laboratorium komputer kenyamanan siswa proses belajar mengajar pengaruh permainan kimbum polkadot meningkatkan kemampuan pemahaman siswa sekolah dasar materi penjumlahan pengurangan bilangan bulat suatu penelitian eksperimen siswa kelas iv sdn cibodas i sdn kadujajar i dikecamatantanjungkerta kabupaten sumedang efektivitas permainan kelompok mengembangkan penyesuaian sosial siswa program bimbingan melalui pemanfaatan media twitter meningkatkan kemampuan perencanaan karier peserta didik implementasi pendidikan nilai keimanan berbasis tasawuf sebagai upaya membentuk karakter manusia arifun billah sma pondok modern sumber daya at-taqwa (pomosda) pengaruh penambahan serat tumbuhan sisal (agave sisalana) sifat mekanis mortar the effectiveness of suggestopedia in teaching reading comprehension of narrative text budaya politik masyarakat adat kampung naga ( masyarakat adat kampung naga kabupaten tasikmalaya pemilihan gubernur jawa barat tahun 2013) pengaruh permainan tradisional gerak dasar siswa sd negeri 2 kayuambon analisis bentuk ungkapan menyatakan alasan terdapat buku ajar bahasa jepang jpbj fpbs upi pengaruh kompetensi pedagogik guru motivasi belajar siswa kelas x administrasi perkantoran mata pelajaran produktif smk pasundan 3 bandung studi tentang persepsi siswa guru pbm pengaruh kepemimpinan visioner kepala sekolah motivasi kerja guru kinerja mengajar guru smp muhammadiyah se-kotamadya bandung implementasi aktivitas pembelajaran permainan tradisional upaya meningkatkan waktu aktif belajar siswa analisis faktor-faktor mempengaruhi pendapatan pengusaha tas dompet desa cibolerang blok ransel babakan mulya pengembangan multimedia pembelajaran interaktif berbasis problem solving pembelajaran hyper text markup language (html) peran musik peningkatan kemampuan motorik kasar kegiatan olahraga bagi siswa kelas a raudatul athfal al-royan andir bandung sistem pendukung keputusan perekrutan pemain sepakbola menggunakan metode electre promethee seni pertunjukan reog ponorogo paguyuban singo lodoyo cilokotot desa margahayu kabupaten bandung coming of age an analysis of a young adult character development in ellen hopkins’ young adult novel crank penerapan asesmen kinerja sebagai upaya meningkatkan kemampuan berpikir kritis siswa pembelajaran sejarah penelitian tindakan kelas kelas xi ips 2 sman 22 bandung teknik konseling assertive training meningkatkan tanggung jawab pribadi siswa smp negeri 1 batujajar studi quasi eksperimen 2012/2013 model pembelajaran take and give pembelajaran bahasa jepang penelitian eksperimental siswa kelas x sma negeri 10 bandung 2012/2013 upaya meningkatkan hasil belajar siswa mata pelajaran ilmu pengetahuan alam tentang benda sifatnya melalui penerapan metode demonstrasi upaya meningkatkan hasil belajar siswa mata pelajaran ilmu pengetahuan alam tentang benda sifatnya melalui penerapan metode demonstrasi penelitian tindakan kelas dilakukan semester i kelas iii 2012 – 2013 sdn tugu 9 kecamatan cimanggis kota depok penggunaan media kartu kata bergradasi meningkatkan kemampuan menulis permulaan anak tunagrahita ringan slb “sabilulungan” pengaruh genius learning method pemahaman konsep geografi gambaran social well being homoseksual dewasa muda melakukan coming out studi fenomenologi 2 homoseksual dewasa muda bandung pengaruh metode discovery-inquiry penguasaan konsep siswa pembelajaran faktor-faktor mempengaruhi kelarutan penentuan aktivitas antioksidan kulit buah naga super merah (hylocereus costaricensis) produk olahannya berupa permen jelly pengaruh jumlah wisatawan, lama tinggal, pengeluarannya produk domestik regional bruto sektor pariwisata jawa tengah pengaruh media pembelajaran berbasis teknologi informasi komunikasi motivasi belajar pemahaman konsep profil kecerdasan emosional siswa berdasarkan pola asuh orang tua studi deskriptif siswa kelas xi sma negeri 14 bandung 2012/2013 efektivitas bimbingan kelompok melalui teknik modeling meningkatkan harga diri peserta didik penelitian eksperimen kuasi peserta didik kelas x smk negeri 3 cimahi 2013/2014 efektivitas penggunaan media e-comic peningkatan hasil belajar siswa mata pelajaran teknologi informasi komunikasi kuasi eksperimen siswa kelas vii smp negeri 12 bandung perkembangan kelembagaan pendidikan pondok pesantren baitul arqom al-islam pengaruh promosi jabatan disiplin kerja pegawai sekretariat dewan perwakilan rakyat daerah (dprd) kota cimahi peningkatan kemampuan memahami paragraf wacana bahasa indonesia melalui pendekatan pembelajaran kontekstual bagi siswa kelas vi a sdn jatayu bandung hubungan antara persepsi peserta diklat mengenai kemampuan pengelolaan pembelajaran widyaiswara hasil belajarnya studi deskriptif korelasional upt balai pengembangan instrumentasi lipi bandung pengaruh fasilitas potensi alam tingkat kunjungan wisatawan ke kebun raya cibodas kabupaten cianjur hubungan kecerdasan emosional kemampuan tembakan hukuman permainan bolabasket pelestarian kesenian bambu saung angklung udjo interaksi sosial siswa tunanetra lingkungan madrasah aliyah negeri kota sukabumi pengembangan metode ibraħ mauiẓah pembelajaran pendidikan agama islam penelitian tindakan kelas kelas xi pokok bahasan “menghindari perilaku dosa besar” sekolah menengah kejuruan negeri 9 bandung perbandingan model pendekatan taktis model pembelajaran kooperatif jumlah waktu aktif belajar (jwab) pembelajaran permainan bolabasket upaya meningkatkan hasil belajar siswa melalui media gambar materi strukur fungsi bagian tumbuhan penerapan pendekatan pemecahan masalah meningkatkan hasil belajar matematika siswa tentang faktor kelipatan no panggil s pgsd far p-2013 penerapan pendekatan pemecahan masalah meningkatkan hasil belajar matematika siswa tentang faktor kelipatan penelitian tindakan kelas siswa kelas iv sdn cisabuk kecamatan rancabali kabupaten bandung upaya meningkatkan hasil belajar siswa melalui media gambar materi struktur fungsi bagian tumbuhan konsep dasar pendidikan umum mata kuliah dasar umum (mkdu) serta kedudukan mkdu pengembangan program pendidikan umum perguruan tinggi penelitian kualitatif tentang pendapat pakar pendidikan meningkatkan gerak dasarlari sprint melalui permainan akselerasi balance coordination (abc) siswa kelas iv sdn 1 panembahan kecamatan plered kabupaten cirebon kontribusi kompetensi kerja guru kepemimpinan pembelajaran (instructional leadership) kepala tk kinerja mengajar guru tk kota bandung penyelenggaraan sistem pendidikan luar sekolah upaya pengembangan keterampilan anak tentang keberhasilan anak putus sekolah terlantar panti penyantunan anak (ppa) "budi utama" lubuk alung sumatera barat pengembangan bahan ajar membaca pembelajar bahasa indonesia bagi penutur asing tingkat dasar metode penelitian research and development pengaruh inovasi kreativitas pengusaha keberhasilan usaha survey para pengusaha industri rajut binong jati bandung meningkatkan kemampuan pemecahan masalah matematis self-regulated learning siswa mts melalui pendekatan keterampilan proses peta konsep analisis penguasaan konsep kemampuan pemecahan masalah siswa melalui strategi pembelajaran problem solving berbasis lingkungan analisis kelayakan multimedia interaktif materi ekosistem sekolah menengah pertama (smp) kelas vii hubungan kemampuan baca tulis al-qur’an prestasi belajar bahasa arab pengaruh bimbingan pengasuhan jasmani menggunakan metode (pdlt) berbeban tanpa beban perwira siswa secapaad berdaya juang kesegaran jasmani penerapan model pembelajaran terpadu bentuk jaring laba-laba (webbed) meningkatkan hasil belajar siswa tentang tema lingkungan penerapan model pembelajaran kooperatif tipe three-step interview meningkatkan kemampuan komunikasi matematis siswa smp the implementation of theme-based teaching to improve young learners’ english vocabulary pengaruh kualitas produk kemasan keputusan pembelian survey perusahaan home industry goreng sale pisang ambon fajar endah kota banjar pengaruh pembelajaran kewirausahaan minat berwirausaha siswa kelas xi jurusan akuntansi smk negeri 1 bandung 2012/2013 pengaruh profitabilitas nilai pasar return saham perusahaan subsektor makanan minuman bursa efek indonesia pengembangan model pembelajaran problem solving meningkatkan kemampuan pemecahan masalah siswa smk materi termokimia pembelajaran keterampilan batik cap peserta didik tunarungu slb b negeri cicendo bandung efektifitas penggunaan media audiovisual pembelajaran kosakata bahasa arab ajén falsafah upacara sidekah tutulak désa karangtawang kecamatan kuningan kabupatén kuningan pikeun bahan pangajaran maca sma pengaruh metode pemetaan pikiran mind mapping keterampilan pemecahan masalah problem solving skill anak taman kanak-kanak pengambilan keputusan memilih pasangan menikah perempuan keturunan arab peranan teks perubahan konseptual pemahaman konsep level sub mikroskopik siswa sma kelas xi materi hidrolisis garam pengaruh karakteristik perusahaan tingkat pengungkapan modal intelektual studi perusahaan go public tergabung indeks lq45 tahun 2012 bursa efek indonesia nilai budaya adat ngarot kaitannya “civic culture” sebagai wujud pelestarian kebudayaan indonesia masyarakat lelea desa lelea kecamatan lelea kabupaten indramayu pengaruh model cooperative learning tipe jigsaw meningkatkan keterampilan membaca kritis siswa penelitian quasi eksperimen mata pelajaran bahasa indonesia kelas iv sdn i karangwangi kecamatan depok kabupaten cirebon 2012/2013 peranan kegiatan ekstrakurikuler palang merah remaja (pmr) upaya meningkatkan sikap kemanusiaan siswa penerapan metode eksperimen konsep energi panas meningkatkan hasil belajar siswa upaya meningkatkan kualitas kemampuan membaca permulaan mata pelajaran bahasa indonesia melalui media cerita bergambar sekolah dasar penelitian tindakan kelas siswa kelas i sd negeri cibatu kecamatan cibatu kabupaten purwakarta tahun pelajaran 2012/2013 implementasi playdough menstimulasi kemampuan motorik halus penelitian tindakan kelas kelompok a tk artha kencana, kota serang banten 2012-2013 penerapan model pembelajaran kooperatif melalui metode circ meningkatkan kemampuanmembaca memindai siswa kelas v sd negeri paseh 2kecamatan paseh kabupaten sumedang analisis kualitas produk kuallitas pelayanan keputusan pembelian lisung the dago boutique resto bandung reconstructing humor an analysis of humor in two selected short stories penerapan teknik story telling melalui media kotak musik meningkatkan kemampuan berbicara siswa kelas ii madrasah ibtidaiyah negeri (min) gunungmanik kecamatan talaga kabupaten majalengka a study on the nominalisations in polytechnic students’ texts meningkatkan hasil belajar siswa menggunakan model contextual teaching and learning (ctl) konsep energi kelas iv sekolah dasarptk kelas iv sdn 3 cisampang kecamatan gunungkencana kabupaten lebak ketidaksesuaian antara anggaran diusulkan anggaran disetujui program peningkatan mutu pendidikan sekolah menengah atas ( sma ) jawa barat penelitian evaluatif perencanaan proyek pcningkatan sma kantor wilayah departemen pendidikan kebudayaan propinsi jawa barat analisis metafora metonimi bahasa jepang terdapat novel umibe no kafuka karya murakami haruki dilihat dari tinjauan linguistik kognitif penerapan model inkuiri menggunakan bingkai kayu meningkatkan hasil belajar siswa menghitung keliling persegipanjang (penelitian tindakan kelas kelas iii sdn 2 cikeusal kecamatan gempol kabupaten cirebon) pengaruh kohesivitas kelompok motivasi kerja pegawai pengaruh aktivitas bermain aktivitas ritmik peningkatan kebugaran jasmani siswa sekolah dasar pengaruh konversi lahan nilai lahan perubahan struktur mata pencaharian penduduk kecamatan jatinangor kabupaten sumedang penerapan metode experiential learning oleh widyaiswara pelatihan fungsional dasar penyuluh pertanian ahli balai besar pelatihan pertanian lembang desain uji keterbacaan buku ajar kimia materi senyawa benzena turunannya serta makromolekul lipid melalui konteks batik pengaruh ukuran perusahaan, profitabilitas financial leverage tindakan perataan laba (income smoothing) perusahaan perbankan suatukasuspada perusahaan perbankan bursa efek indonesia pembelajaran nilai patriotisme melalui materi sejarah lokal geger cilegon 1888 penelitian naturalistik inkuiri sman 2 kota serang hubungan mengikuti kegiatan ekstrakulikuler futsal hasil pembelajaran penjas sepak bola sma n 10 bandung perbandingan antara siswa rsbi reguler ditinjau dari aspek motivasi keterampilan motorik pembelajaran penjas study deskriptif sma pasundan 8 bandung penggunaan media software powerpoint meningkatkan hasil belajar siswa kelas ix smpn 1 pedes mata pelajaran tik pengaruh penerapan strategi belajar imajeri intruksional hasil belajar keterampilan dasar lob bertahan servis tinggi pengaruh penerapan model pembelajaran kolaboratif pembelajaran matematika peningkatan kemampuan berpikir kritis matematis siswa smp implementasi pendekatan taktis upaya meningkatkanwaktu aktif belajar siswa pembelajaran permainan futsal penelitian tindakan kelas siswa sman 6 garut kabupaten garut pengaruh mata pelajaran mahfudzhat penguasaan kosakata bahasa arab peranan syeikh kh. asnawi menyebarkan agama islam caringin-banten tahun 1865-1937 respon petani implementasi kebijakan alih komoditas sayuran menjadi kopi lahan kehutanan kecamatan pangalengan kabupaten bandung pengaruh dana pihak ketiga, penyaluran kredit kualitas kredit profitabilitas bank survey bank jabar banten penggunaan metode simulasi meningkatkan prestasibelajar siswa ranah psikomotor studi kuasi eksperimen kompetensi dasar melakukan penggandaan dokumen kelas x program keahlian administrasi perkantoran smk pasundan 1 cimahi 2013/2014 pemetaan profil risiko spekulatif pdam tirta raharja kabupaten bandung fauzia, sarah noor judul pengaruh faktor-faktor bauran pemasaran keputusan pembelian rumah makan ibu haji cijantung purwakarta cabang kota bandung pengaruh faktor-faktor bauran pemasaran keputusan pembelian rumah makan ibu haji cijantung purwakarta cabang kota bandung wacana pencitraan kinerja anggota dpr surat kabar pikiran rakyat analisis wacana kritis pengaruh kredit bermasalah profitabilitas bank perkreditan rakyat konvensional kota bandung tahun 2012 efektivitas model pembelajaran tutor sebaya meningkatkan kemampuan membaca al-qur`ān siswa kelas xi analisis fungsi produksi penggunaan faktor-faktor produksi industri tahu cibuntu kota bandung survey sentra industri tahu cibuntu kecamatan bandung kulon kota bandung pengaruh program bina kader (binder) aktifitas keagamaan mahasiswa universitas pendidikan indonesia (upi) studi deskriptif peserta binder semester ganjil periode 2012/2013 pembangunan program identifikasi bentuk struktur tense kalimat berbahasa inggris menggunakan fungsi regular expressions penerapan pembelajaran tematik polusi cahaya meningkatkan hasil belajar penanaman karakter siswa smp pengembangan instrumen tes diagnostik two-tier mengidentifikasi miskonsepsi siswa kelas xi memahami materi larutan penyangga pengaruh diferensiasi produk modal kerja laba home industry simping kaum kabupaten purwakarta survey sentra industry simping kaum kelurahan cipaisan kecamatan purwakarta kabupaten purwakarta gambaran kualitas tidur wanita lanjut usia (lansia) panti sosial tresna wredha (pstw) budi pertiwi bandung pendekatan saintifik pembelajaran elektronika dasar melalui model pembelajaran berbasis masalah pengaruh kepemimpinan kepala sekolah kinerja guru mata pelajaran produktif program studi adminstrasi perkantoran sekolah menengah kejuruan (smk) se-kota sukabumi implementasi pendekatan somatic auditory visual intellectual (savi) meningkatkan pemahaman siswa konsep gayaptk kelas iv sdn sinarjaya 3 kec. mandalawangi kab. pandeglang pengaruh penggunaan media video kekayaan alam peningkatan kemampuan menulis puisi siswa penerapan pendekatan sains teknologi masyarakat pembelajaran ipa tentang sumber daya alam meningkatkan hasil belajar siswa pemakaian istilah asing bidang fashion kalangan sosialita kota bandung pengaruh model pembelajaran sains teknologi masyarakat keterampilan berpikir kritis studi eksperimen kelas xi sman 1 dukupuntang kabupaten cirebon pengaruh disiplin kerja kinerja karyawan survei karyawan direktorat surat paket pt. pos indonesia (persero) bandung pengembangan model pembelajaran pemrosesan iinformasi gaya program acara suara anda berbasis komunikasi interaksional pembelajaran berbicara pengaruh penerapan metode pembelajaran tutor sebaya hasil belajar siswa mata pelajaran akuntansi siswa kelas xi ips 1 sman 13 bandung tahunajaran 2012-2013 pokok bahasan jurnal penyesuaian peningkatan kemampuan bercerita melalui metode role-playing kelas iv sdn panancangan 5 kota serang pengembangan multimedia interaktif berbasis kecerdasan jamak pembelajaran inkuiri meningkatkan kemampuan menulis cerita pendek sma daarul quran bandung efektivitas penerapan model pembelajaran kooperatif tipe make a match meningkatkan penguasaan kosakata bahasa jerman efektivitas teknik permainan the clues meningkatkan penguasaan kosakata bahasa jepang studi eksperimen siswa kelas xi smk negeri 1 cimahi 2012/2013 hubungan antara penguasaan tata bahasa kemampuan membaca pemahaman pengaruh efisiensi biaya produksi laba kotor pt pindad (persero) divisi tempa cor analisis kinerja customer relationship management (crm) loyalitas pelanggan penerapan metode cooperative learning tipe student team achievement division (stad) berbantuan multimedia meningkatkan hasil belajar siswa mata pelajaran tik materi pengoperasian software pengolah gambar digital reformasi shinto masa tokugawa (1603-1868) sistem pendukung keputusan pemilihan rumah menggunakan metode weighted product (wp) pengaruh efektivitas implementasi sistem manajemen mutu iso 90012008 kepuasan peserta pendidikan pelatihan pppptk tk plb bandung manfaat hasil belajar "membuat busana anak" sebagai kesiapan uji level busana anak manfaat hasil belajar membuat busana anak sebagai kesiapan uji level busana anak pengaruh motivasi kewirausahaan tingkat partisipasi berwirausaha survei peserta mahasiswi program mahasiswa wirausaha universitas pendidikan indonesia pengembangan media interaktif pembelajaran membaca permulaan anak tunagrahita ringan pengaruh co-creationterhadap kepuasan pelanggan sepeda motor harley-davidson survey pelanggan harley-davidson komunitas harley owners group (hog) jakarta chapter penerapan model pembelajaran kooperatif tipe numbered heads together (nht) pokok bahasan bilangan pecahan meningkatkan hasil belajar siswa pengaruh gaya belajar siswa prestasi belajar siswa mata pelajaran ekonomi pengaruh gaya belajar siswa prestasi belajar siswa mata pelajaran ekonomi pengaruh pelaksanaan sistem kearsipan efektivitas kerja pegawai badan pertanahan nasional (bpn) kantor pertanahan kabupaten cianjur penggunaan multimedia model tutorial meningkatkan hasil belajar siswa kompetensi dasar pengenalan program inventor mata pelajaran cad tutunggulan sebagai media pembelajaran meningkatkan kreativitas gerak pembelajaran tari kelas iv a sdn lokasari kabupaten cianjur analisis busana tari wayang karakter putra gagah karya raden ono lesmana kartadikusumah sanggar dangiang kutamaya museum prabu geusan ulun kabupaten sumedang pengaruh penerapan sistem penghargaan motivasi berprestasi karyawan bagian marketing pt. luxindo raya cabang bandung intimacy pasangan menikah melalui proses ta’aruf dua pasangan menikah fase dewasa awal kota bandung analisis faktor-faktor mempengaruhi pengungkapan enterprise risk management perusahaan sektor keuangan terdaftar bursa efek indonesia tradisi seba masyarakat adat baduy sebagai perwujudan warga negara baik masyarakat adat baduy desa kanekes kecamatan leuwidamar kabupaten lebak efektivitas penggunaan metode pembelajaran cooperative learning tipe snowball throwing pemahaman gramatika bahasa arab perkembangan emosional anak tunagrahita sedang kelas ix smplb slb purnama asih bandung pengaruh augmented product golden flower hotel upaya menciptakan keputusan menggunakan meeting packages survey tamu bisnis menggunakan meeting packages golden flower hotel efektivitas teknik serangan pukulan teknik serangan tendangan perolehan poin pertandingan kumite cabang olahraga karate analisis kesesuaian materi instrumen evaluasi hasil belajar biologi tuntutan kompetensi dasar sma kota bandung pengaruh metode kooperatif team assisted individualization dipadukan praktikum prestasi belajar teknologi informasi komunikasi penggunaan filler abu sekam padi ac-wc halus spesifikasi jalan bina marga 2010 upaya meningkatkan kemampuan menulis karangan argumentasi menggunakan media iklan animasi layanan masyarakat penerapan model pembelajaran osborn meningkatkan kemampuan berpikir kreatif matematis siswa smp gambaran sikap remaja kelas x xi tentang bahaya merokok sekolah menengah kejuruan pakuan lembang pengaruh pembelajaran berbasis hakikat sains penguasaan konsep persepsi siswa tentang hakikat sains pertumbuhan produksi umbi tanaman kentang (solanum tuberosum l.) varietas granola dari bibit g0 diberi zat pengatur tumbuh sistem pendukung keputusan seleksi pelamar berdasarkan psikogram metode profile matching pt. cipaganti citra graha pengaruh pembiayaan bermasalah profitabilitas pt bank mega syariah tari walijamaliha sanggar bina seni tari raksa budaya kota serang provinsi banten kecerdasan buatan automation bot multiplayer game finite-state machine fuzzy logic perilaku sosial anak tunarungu tingkat smp slb b-c pambudi dharma ii kota cimahi studi deskriptif kualitatif siswa tunarungu smplb slb b - c pambudi dharma ii - cimahi dynamics of students’ self-regulated learning within ecological multi-user virtual-environment dinamika psikologis waria proses penerimaan diri presentasi diri waria ‘sani’ desa tanjung ratu ilir, kabupaten lampung tengah, provinsi lampung implementasi pendidikan agama islām sekolah alam peranan metode problem based learning melalui pendekatan konstruktivis keterampilan berpikir kritis peserta didik pembelajaran geografi smp negeri 4 sungailiat bangka penggunaan model induktif kata bergambar melalui permainan edukatif sebagai upaya peningkatan kemampuan membaca sekolah dasar perbandingan pendekatan taktis teknis partisipasi belajar gerak siswa sman 1 garut pengaruh lingkungan sosio-ekonomi keluarga lingkungan sekolah prestasi belajar siswa mata pelajaran ekonomi survei siswa kelas xi ips sma negeri wilayah iii kab. bandung aplikasi metode monte carlo penentuan harga opsi eropa perbedaan tingkat kecanduan situs jejaring sosial facebook mahasiswa tipe kepribadian introvert ekstravert studi komparatif deskriptif mahasiswa universitas pendidikan indonesia efektifitas media tali pas meningkatkan kemampuan kosakata bahasa jepang siswa kelas ekstrakulikuler japanese club sma labschool upi bandung implementasi movement problem based learning sma se-kecamatan padalarang kabupaten bandung barat sikap konservasi siswa kampung tradisional cikupa kampung adat sinar resmi kecamatan cisolok kabupaten sukabumi hubungan goal setting performa atlet cabang olahraga bola voli klub alko bandung efektifitas media tali pas meningkatkan kemampuan kosakata bahasa jepang siswa kelas ekstrakulikuler japanese club sma labschool upi bandung pembinaan karakter santri melalui keteladanan kyai lingkungan pesantren studi deskriptif kualitatif pondok pesantren as syafi’iyah sukabumi tahun 2012 program konseling kelompok teknik latihan asertif meningkatkan keterampilan interpersonal siswa peningkatan hasil belajar siswa materi proses polinasi tanaman melalui metode demonstrasi penelitian tindakan kelas siswa kelas xsekolah menengah kejuruan pertanian pembangunan negeri cianjur model pembelajaran experiential learning berbantuan website topik fluida dinamis meningkatkan keterampilan proses sains pemahaman konsep pengaruh pendekatan bermain aktivitas pembelajaran aqutik hasil belajar aquatik penelitian eksperimen siswa kelas viii smpn 29 bandung tahun pelajaran 2013-2014 pengembangan pembelajaran permainan tradisional upaya meningkatkan gerak dasar siswa pengelolaan hutan berbasis masyarakat (phbm) kawasan hutan lindung desa mandalamekar kecamatan jatiwaras kabupaten tasikmalaya penggunaan magic book meningkatkan hasil belajar siswa ranah kognitif kuasi eksperimen mata pelajaran teknologi informasi komunikasi kelas xi madrasah aliyah negeri 1 bandung puisi sawér turun tanah kecamatan rajadesa kabupaten ciamis analisis struktur, proses penciptaan, konteks penuturan, fungsi, makna implementasi jaringan syaraf tiruan mengidentifikasi telapak tangan menggunakan metode learning vector quantization pengaruh penggunaan program aplikasi articulate engage 09 hasil belajar siswa mata pelajaran keterampilan komputer pengelolaan informasi kuasi eksperimen siswa kelas xi smk pasundan 1 kota bandung tantanganpenguatan komitmen kebangsaan membangun karakter warga negara masyarakat perbatasan pengaruh penggunaan pendekatan bimbingan kelompok kemampuan interaksi sosial anak autistik naskah longsér karya h. r. hidayat suryalaga pikeun bahan pangajaran sma/ma/smk ulikan struktural-sémiotik simulasi pintu pagar berbasis mikrokontroler arduino peranan kinerja mgmp pkn meningkatkan profesionalisme guru smp guru smp kabupaten kuningan keanekaragaman kelimpahan collembolla kebun botani upi aspek-aspek kecerdasan spiritual konsep pendidikan islam studi tematis tentang surat luqman ayat 12 – 19 pengaruh metode inquiry peningkatan kemampuan penguasaan kosakata bahasa arab studi eksperimen kuasi siswa kelas x ma al- inayah bandung 2012/2013 implementasi model pembelajaran quantum teaching meningkatkan proses belajar ips tentang sumber daya alam sekolah da penelitiantindakan kelas siswakelas iv sd negeri 3 mekarsari kecamatan tambaksari kabupaten ciamis students’ test anxiety and its correlation with their academic performance a study of undergraduate students at a private higher education institution in bandung speaking activities in young learners classroom the implementation of project-based learning approach pengaruh model cooperative learning tipe jigsaw kemampuan membaca pemahaman siswa sekolah dasar penelitian eksperimen kuasi siswa kelas iv sd negeri sindangsari kecamatan plered kabupaten purwakarta 2012/2013 hubungan kepribadian ekstraversi kemampuan komunikasi interpersonal prestasi kerja agen ajb bumiputera 1912 cabang supratman bandung perbandingan pengaruh penetapan tujuan proses penetapan tujuan dinamik hasil belajar keterampilan dasar lob bertahan motivasi olahraga pengaruh permainan aquatik keterampilan sosial anak usia 10-12 penerapan pendekatan ctl (contextual teaching and learning) mata pelajaran matematika materi bangun ruang meningkatkan hasil belajar siswa penelitian tindakan kelas kelas iv sdn i kalianyar kecamatan panguragan kabupaten cirebon 2012/2013 efektivitas remedial teaching pendidikan agama islam (pai) meningkatkan hasil belajar siswa studi kuasi eksperimen bahasan salat siswa kelas viii smp negeri 3 lembang 2012/2013 penerapan pendekatan matematika realistik meningkatkan aktivitas pemahaman siswa tentang konsep pembagian sd penelitian tindakan kelas siswa kelas ii, sdn sumbersari indah 3 kecamatan babakan ciparay kota bandung penggunaan model pembelajaran kontekstual meningkatkan kemampuan siswa tunarungu pelajaran matematika materi penjumlahan pecahan penelitian tindakan kelas kelas v slb bc x kabupaten bandung ajén moral dina naskah drama pundén-pundén nu rarempag karya r. hidayat suryalaga dinamika partai masyumi jawa barat periode tahun 1950-1960 program bimbingan berbantuan web meningkatkan kemampuan membuat keputusan karir peserta didik penelitian eksperimen kuasi peserta didik kelas xi smk pasundan 1 bandung 2012/2013 meningkatkan hasil belajar siswa mata pelajaran ipa mealui penggunaan media lingkungan konsep struktur tumbuhan fungsinya meningkatkan hasil belajar siswa mata pelajaran ipa melalui penggunaan media lingkungan konsep struktur tumbuhan fungsinya pengaruh pemahaman kompetensi guru keberhasilan program latihan profesi (plp) mahasiswa program studi pendidikan manajemen perkantoran smk se-kota bandung efektivitas penggunaan metode pembelajaran jigsaw penguasaan ilmu nahwu studi eksperimen kuasi siswa kelas i’dad lughawi smk daarut tauhid bandung pengaruh pembelajaran kooperatif tipe stad kemampuan pemahaman komunikasi matematis siswa sekolah dasar analisis kelajuan muka gelombang kejut peristiwa semburan radio matahari tipe ii peran kepolisian mencegah menanggulangi tindak kekerasan geng motor kota cirebon peningkatan hasil belajar siswa melalui pendekatan matematika realistik pokok bahasan perbandingan skala pembelajaran matematika melalui pendekatan kontekstual meningkatkan kemampuan koneksi matematis siswa smp penggunaan media scrapbook (buku tempel) meningkatkan pemahaman siswa pembelajaran membaca novel remaja penelitian eksperimen siswa kelas viii.6 smpn 16 bandung 2012/2013 perbandingan antara kinerja guru pendidikan jasmani smp negeri smp swasta kecamatan sukasari pengaruh penerapan model pembelajaran kooperatif tipe jigsaw prestasi belajar siswa mata pelajaran akuntansi studi quasi eksperimen kelas xi smk pasundan 1 bandung pengaruh kompetensi sumber daya manusia kualitas penyajian laporan keuangan implikasinya akuntabilitas keuangan pemerintah daerah kota sukabumi meningkatkan keterampilan sosial anak taman kanak-kanak melalui perilaku guru membangun hubungan positif anak penelitian pre eksperimen kelompok a tk tunas bangsa kecamatan cibiru kota bandung pelayanan package tour kepada wisatawan wana wisata kawah putih penggunaan teknik sosiodrama mengembangkan kekohesifan kelompok belajar peserta didik penelitian pra eksperimen peserta didik kelas xi man 1 bandung 2013-2014 penerapan model cooperative learning mata pelajaran matematika materi operasi hitung pecahan meningkatkan hasil belajar siswa perubahan orientasi mata pencaharian nelayan kecamatan sungailiat kabupaten bangka pengaruh likuiditas profitabilitas pt. sumi indo kabel tbk tahun 2006-2011 persepsi mahasiswa program studi kependidikan universitas pendidikan indonesia program sarjana mendidik daerah terdepan, terluar tertinggal pengaruh disiplin siswa kelas prestasi belajar siswa studi perbandingan antara siswa prestasi belajar tinggi siswa prestasi belajar rendah mata pelajaran ekonomi/ akuntansi xi ips sma kartika xix-2 bandung efektivitas program bimbingan kelompok mengembangkan konsep diri siswa studi kuasi eksperimen siswa smp terbuka kota serang penerapan metode role playing pembelajaran berbicara eksperimen semu smk bina perstasi bangsa 2012/2013 pembelajaran partikel dasar bahasa jepang menggunakan multimedia sman 24 bandung efektivitas penggunaan pembelajaran berbasis komputer model tutorial peningkatan hasil belajar siswa mata pelajaran ilmu pengetahuan alam kuasi eksperimen siswa kelas v sd negeri gegerkalong kpad bandung tradisi melukis kulit kayu khombouw mengembangkan kesadaran sejarah bersumber kearifan lokal studi etnopaedagogi kalangan siswa kelas x sman iii sentani kabupaten jayapura penggunaan model pembelajaran kooperatif tipe cooperative integrated reading and composition meningkatkan kemampuan representasi pemecahan masalah matematis siswa animasi 3 dimensi meningkatkan pemahaman materi sistem fungsi organ pernapasan manusia anak tunarungu kelas v sdlb kemampuan berpikir kreatif siswa smp materi dampak kepadatan penduduk lingkungan melalui pembelajaran berbasis proyek pembelajaran advance organizer berbantuan peta konsep meningkatkan pemahaman konsep teori kinetik gas siswa sma telaah pendidikan luar sekolah mengenai upaya pemberdayaan masyarakat petani peserta pir-bun kabupaten dt. ii lebak penerapan pendekatan inspiratif direct experience meningkatkan kemampuan peserta didik menggambar ekspresif penelitian tindakan kelas sd mathlaul khaeriyah kelas iv eksistensi home industri tape ketan desa tarikolot kecamatan cibeureum kabupaten kuningan hubungan pengelolaan dana bantuan operasional sekolah (bos) prestasi sekolah sd kecamatan cidadap coblong kota bandung pengaruh penggunaan media pembelajaran partisipasi siswa pembelajaran hasil belajar siswa mata pelajaran akuntansi sma yayasan atikan sunda (yas) bandung profil keterampilan berpikir kritis siswa pembelajaran faktor-faktor mempengaruhi kelarutan metode discovery-inquiry hubungan antara dukungan sosial orang tua efikasi diri remaja pemilihan jurusan studi korelasional siswa kelas x sekolah menengah atas negeri 6 bandung hubungan antara dukungan sosial orang tua efikasi diri remaja pemilihan jurusan pembelajaran geometri berbantuan wingeom melalui model kooperatif tipe stad meningkatkan kemampuan spasial disposisi matematis siswa pengembangan keterampilan proses sains siswa sekolah dasar kelas v melalui pembelajaran inkuiri materi gaya gesek (penelitian mixed method siswa kelas v sd negeri cigentur sd negeri cimuncang kecamatan tanjungkerta kabupaten sumedang) halaqah sebagai model bimbingan kelompok mengembangkan kepribadian muslim studi etnografis komunitas jama’ah tarbiyah kota purwokerto efektifitas strategi pembelajaran active knowledge sharing peningkatan kemampuan kosakata mengembangkan kecerdasan spiritual anak usia dini melalui pembelajaran metode cerita islami penggunaan model pembelajaran langsung (explicit instruction) meningkatkan kemampuan mengenal lambang bilangan penjumlahan siswa tunagrahita ringan penelitiantindakan kelas kelas iii slb c budi nurani kota sukabumi hubungan daya ingat penguasaan artikel pendapat peserta didik tentang pelaksanaan praktek room section pendekatan pelatihan berbasis kompetensi smk proses penanaman nilai-nilai budaya karakter bangsa upacara adat seren taun masyarakat kecamatan cigugur kuningan pemanfaatan model blended learning berbasis online meningkatkan hasil belajar mahasiswa mata kuliah kurikulum pembelajaran studi kuasi eksperimen mata kuliah kurikulum pembelajaran program studi pgsd upi a semiotic analysis of djarum 76 television advertisements penggunaan media wayang jawa tokoh punakawan meningkatkan penguasaan kosa kata bahasa indonesia anak usia dini efektivitas pembelajaran menggunakan media berbasis teknologi informasi dilihat dari respon hasil belajar siswa studi siswa kelas x tgb mata pelajaran ilmu bahan bangunan smk negeri 1 cilaku cianjur penerapan pendekatan matematika realistik meningkatkan kemampuan penalaran representasi matematis kelas v materi bangun datar (penelitian eksperimen kelas v kecamatan jatinangor kabupaten sumedang) correlation between students’ vocabulary mastery and their reading comprehension a study in second grade of junior high school correlation between students’ vocabulary mastery and their reading comprehension a study in second grade of junior high school becoming hybrid the portrayal of an indo character in siti rayati by moh. sanoesi pengembangan tes tertulis indo-cambridge kelas xi materi pokok sistem endokrin pengaruh gaya kepemimpinan demokratis motivasi kerja karyawan front office sheraton bandung hotel & towers keterkaitan antara persepsi siswa tentang perpustakaan pemanfaatan bahan pustaka perpustakaan sma negeri 3 bandung profil kondisi fisik atlet sepak bola sma negeri 3 cimahi prestasi belajar siswa homeschooling sekolah formal jenjang smp mata pelajaran bahasa indonesia studi deskriptif homeschooling kak seto bandung smp negeri 5 bandung faktor-faktor mempengaruhi perilaku menabung studi kalangan mahasiswa fakultas pendidikan ekonomi bisnis universitas pendidikan indonesia pengaruh penggunaan media buku wwp (widya wiyata pertama) kemampuan menyimak anak tk penelitian pre eksperimen kelompok tk b laboratorium percontohan upi 2012/2013 peningkatan kemampuan kompetensi strategis matematis serta kemandirian belajar siswa melalui pendekatan savi (somatis, auditori, visual, intelektual) fraud risk assessment skeptisme profesional auditor implikasinya prosedur audit efektif berbasis risiko studi pelaksanaan unit produksi pemijahan ikan mas meningkatkan keterampilan siswa kelas mandiri program studi agribisnis produksi perikanan smk negeri 2 subang implementasi kebijakan pemerintah kota upaya pemeliharaan ruang terbuka hijau kota bandung pengaruh latihan menggunakan tahanan karet alat bantu pemberat kaki kecepatan tendangan dollyo chagi cabang olah raga taekwondo analisis kesalahan terjemahan bahasa jepang terdapat laporan bulanan perusahaan jepang pengaruh efisiensi modal kerja profitabilitas perusahaan industri makanan minuman terdaftar bursa efek indonesia pemberdayaan unit produksi smk sebagai alternatif masukan sumber dana kelancaran proses belajar mengajar smk negeri 1 mundu kabupaten cirebon manajemen pembelajaran diklat adum pai pusdiklat pegawai depdiknas sawangan bogor perbedaan kegiatan manajemen pembelajaran dilakukan widyaiswara berlatar belakang pendidikan kependidikan non kependidikan perbandingan antara model pembelajaran langsung model pembelajaran kooperatif penguasaan gerak lompat jauh kelas vii smp karya pembangunan baros kabupaten bandung the implementation of total physical response storytelling (tprs) method in teaching vocabulary to young learners a descriptive qualitative study of teacher’s techniques and students’ responses in one elementary school in cianjur peningkatan kemampuan pemahaman siswa mata pelajaran tik menggunakan metode pembelajaran improve berbantu multimedia pendidikan karakter pembelajaran seni tari siswa kelas vi sdpn setiabudhi bandung hubungan antara self control tingkat kepercayaan diri atlet putri ukm bola voli upi peningkatan kemampuan pemahaman komunikasi matematis siswa smk melalui pembelajaran konstruktivisme model needham penerapan strategi pembelajaran problem solving reading infusion meningkatkan prestasi belajar siswa smp pembelajaran kooperatif tipe nht metode demonstrasi interaktif meningkatkan kemampuan kognitif keterampilan proses sains siswa kelas viii materi energi kegiatan meronce manik-manik meningkatkan kemampuan motorik halus anak tunagrahita sedang slb az-zakiyah métode démonstrasi pikeun ngaronjatkeun kamampuh siswa dina ngadongéng pengaruh strategi pembelajaran eksploratif peningkatan kemampuan visualisasi, pemahaman konsep geometri, karakter siswa penerapan pendekatan contextual teaching and learning (ctl) berbantu multimedia interaktif meningkatkan kemampuan berpikir kreatif siswa mata pelajaran tik peningkatan kemampuan menulis teks berita metode investigasi kelompok penelitian tindakan kelas siswa kelas viii smp negeri 26 bandung pembelajaran mengintegrasikan nilai-nilai keimanan ketaqwaan (imtaq) mata pelajaran ipa bagisiswa sekolah dasar penelitian naturaiistik sekolah dasarassalam ii bandung penerapan pendekatan kontekstual meningkatkan hasil belajar siswa mata pelajaran matematika materi bangun ruang kelas iv semester 2 sdn 2 langensari kecamatan lembang kabupaten bandung barat pengaruh metode inquiry motivasi belajar siswa smpn 1 ngamprah pengembangan karakter rasa ingin tahu pembelajaran ips melalui strategi pembelajaran inkuiri sosial kelas vii e smp pasundan 6 bandung cd interaktif pengenalan sejarah sahabat nabi berbasis games anak-anak pengaruh penggunaan metode pembelajaran kooperatif tipe stad tgt keterampilan sosial peserta didik quasi eksperimen kelas vii semester ii smpn 4 tarogong kidul kabupaten garut hubungan kesiapan psikis wasit c 2 jawa barat pemahaman peraturan permainan pengambilan keputusan pertandingan sepakbola strategi pemasaran olahraga tradisional benjang studi deskriptif tentang upaya pemasaran olahraga tradisional benjang ada kecamatan ujungberung kota bandung pengaruh kepemimpinan pengawasan disiplin kerja karyawan pt. askes (persero) cabang utama bandung efektivitas penggunaan media permainan komputer “wortsuche” meningkatkan penguasaan kosakata perbedaan kompetensi pemanenan antara siswa program mandiri siswa program reguler jurusan budidaya smkn 2 subang efektivitas bimbingan melalui teknik role playing menanggulangi perilaku bullying siswa studi kuasi eksperimen siswa kelas xi sma perguruan kristen methodist indonesia 1 (pkmi 1) medan sumatera utara 2012/2013 pengaruh job descriptionterhadap efektivitas kerjakaryawan divisi pemintalan spinning i pt. indorama synthetics, tbk. kabupaten purwakarta pengaruh strategi penetapan harga keputusan berkunjung kawasan wisata kampung batu malakasari baleendah kabupaten bandung pengaruh kepemimpinan transformasional kepala sekolah kinerja guru mutu sekolah sma swasta kota bandung studi sma swasta terakreditasi a pelaksanaan pelatihan keterampilan tata cara makan minum bagi anak tunanetra disabilitas tambahan studi deskriptif kualitatif anak tunanetra disabilitas tambahan psbn wyata guna kota bandung perbandingan pengaruh bentuk latihan kebugaran jasmani peningkatan derajat kebugaran jasmani percaya diri siswa kelas viii smpn 1 cileunyi perbandingan potensi tanaman air echinodorus palaefolius, pontederia lanceolata zantedeschia aethiopica sebagai agen fitoremediasi limbah rumah tangga efektivitas pre-fabricated vertical drains kombinasi pre-fabricated horizontal drains proses konsolidasi lempung lunak pengembangan model pembelajaran kooperatif mata pelajaran pendidikan agama islam sekolah lanjutan tingkat pertama meningkatkan kekuatan otot tungkai melalui permainan mendayung pembelajaran kebugaran jasmani kelas v sdn pamulihan kecamatan situraja kabupaten sumedang dampak darwinisme sosial perkembangan nazisme jerman tahun 1921-1945 students’ conceptual change and science process skills acquisition on separation of mixture concept through predict-discuss-explain-observe-discuss-explain (pdeode) method pengaruh kompetensi disiplin produktivitas kerja karyawan pt. kereta api indonesia (persero) daop ii bandung aplikasi metode monte carlo penentuan harga opsi amerika pembelajaran mengapresiasi puisi siswa kelas viii smp negeri 2 lembang menggunakan teknik jigsaw studi kelayakan sarana praktik teknik kendaraan ringan smk wirakarya 1 ciparay pengaruh status sosial ekonomi keluarga motivasi berprestasi prestasi belajar peserta didik mata pelajaran produktif kontribusi sistem penilaian angka kredit jabatan fungsional guru motivasi kerja peningkatan mutu kinerjanya deskripsi analitik sltp negeri se-kecamatan sukaraja kabupaten sukabumi penerapan model pembelajaran berbasis masalah meningkatkan pemahaman konsep kalor siswa smp pengelolaan program public speaking melalui model pembelajaran magang meningkatkan motivasi belajar peserta dj arie broadcasting school pengaruh kepemimpinan transformasional kepala sekolah motivasi berprestasi guru kinerja mengajar guru smk negeri wilayah kabupaten bandung barat upaya meningkatkan pembelajaran menulis pantun melalui teknik copy the master penelitian tindakan kelas siswa smp darul falah kelas vii 2012-2013 ajén falsafah dina kasenian wayang golék ruatan pikeun bahan pangajaran ngaregepkeun kelas xi kontribusi pelatihan kewirausahaan motivasi berwirausaha bagi peserta pelatihan persiapan purna bakti lembaga lp2es bandung analisis paket data proses download menggunakan metode per connection queue (pcq) mikrotik router penerapan pembelajaran kooperatif group to group exchange (gge) meningkatkan kemampuan penalaran komunikasi matematis siswa smk penerapan metode survey, question, read, recite, review (sq3r) meningkatkan kemampuan membaca pemahaman siswa mata pelajaran bahasa indonesia penerapan teknik assep luvassa pembelajaran membaca teks buku penelitian eksperimen semu siswa kelas x smanegeri 23 bandung 2012/2013 penerapan model pembelajaran inkuiri kombinasi metode eksperimen nyata-virtual meningkatkan pemahaman konsep keterampilan berpikir kritis penerapan model cooperative learning teknik jigsaw meningkatkan hasil belajar siswa pembelajaran ipa materi peristiwa alam pengaruh penggunaan multimedia flip book minat belajar siswa mata pelajaran teknologi informasidan komunikasi smp negeri 1 bandung peningkatan kemampuan menulis cerita melalui implementasi teknik mind mapping sekolah dasar penelitian tindakan kelas pembelajaran bahasa indonesia kelas iv sdn mangunjaya 02 kecamatan tambun selatan kabupaten bekasi kontribusi pelaksanaan praktek kerja industri kesiapan kerja studi deskriptif siswa program keahlian teknik kendaraan ringan smk negeri 8 bandung penggunaan sumber belajar ketercapaian kompetensi pembelajaran geografi kelas xii semester i sekolah menengah atas hubungan antara kecepatan reaksi fleksibilitas pergelangan tangan hasil service forehand sidespin permainan tenis meja perbandingan metode pembelajaran bagian metode pembelajaran keseluruhan hasil belajar lompat jauh faktor-faktor mempengaruhi preferensi nasabah bank muamalat indonesia cabang kota bandung penerapan model pembelajaran berbasis tugas (task-based learning) bagi peningkatan keterampilan berbicara bahasa inggris studi mahasiswa perguruan tinggi bandung pengaruh strategi pemasaran permintaan lulusan dunia usaha/dunia industri studi smkn program studi rekayasa perangkat lunak di-kota cimahi implementasi manajamen stratejik pengembangan program diklat era otda balai besar pendidikan pelatihan kesejahteraan sosial (bbppks) bandung balai besar pendidikan pelatihan kesejahteraan sosial (bbppks) bandung tahun 2004 hubungan antropometrik keterampilan shooting atlet scorpio basket ball club bandung permainan bola basket faktor mempengaruhi partisipasi olahraga remaja masyarakat paledang rt/rw 04/12 garut pengaruh penetapan harga fitur produk keputusan pembelian survei konsumen pengguna mobil toyota avanza daihatsu xenia melakukan pembelian sistem kredit pt astra credit companies kota bandung pengaruh bauran produk museum keputusan berkunjung wisatawan museum jawa tengah ranggawarsita the implementation of process-genre approach to teaching writing business letter peran persatuan islam (persis) melakukan pendidikan politik warganegara. tesis program studi pendidikan kewarganegaraan, sekolah pascasarjana universitas pendidikan indonesia pengaruh model pembelajaran kooperatif tipe stad meningkatkan kemampuan komunikasi matematis siswa materi pecahan (penelitian eksperimen siswa kelas iv sdn sindangraja sdn panyingkiran iii kecamatan sumedang utara) studi evaluasi kebutuhan lahan parkir atrium pondok gede bekasi. engd thesis, universitas pendidikan indonesia. program bimbingan belajar berbasis pendekatan humanistik meningkatkan kemandirian belajar peserta didik meningkatkan hasil belajar siswatentang perkembangan teknologitransportasi melalui metode teams games tournament (tgt)pada pembelajaran ips sd penelitian tindakan kelas kelas iv sd negeri cintalaksana kecamatan karangnunggal kabupaten tasikmalaya metode discovery learning pembelajaran tari kelompok meningkatkan pemahaman desain pola lantai siswa kelas vii smp negeri 9 bandung pengaruh penggunaan audiovisual peningkatan keterampilan smash permainan bulutangkis siswa kelas xi sma pgii 2 bandung penerapan asesmen berdasarkan kurikulum 2013 pembelajaran respirasi serangga smp kajian tingkat kesadaran hukum pedagang kaki lima menjadi warga negara baik studi deskriptif pedagang kaki lima kabupaten sumedang pengaruh model pembelajaran kooperatif tipe teams games tournament (tgt) prestasi belajar ilmu statika tegangan siswa kelas x smkn 5 bandung hubungan penggunaan lks (lembar kerja siswa) hasil belajar siswa sma mata pelajaran sejarah kota cimahi meningkatkan hasil belajar siswa modelteam games turnamen konsep sumber daya alameksperimen kelas iv sdn limparkecamatan curug kabupaten serang analisis pengaruh value equity brand equity brownies vannisa keputusan pembelian wisatawan domestik kota bandung efektivitas penggunaan informasi proses perencanaan sub bagian bina program dinas pendidikan kabupaten ciamis penilaian academic achievement siswa smp materi tekanan berorientasi multiple intelligences theory invéntarisasi dongéng kacamatan nagrak kabupatén sukabumi pikeun bahan pangajaran ngaregepkeun smp brand image kawasan maribaya sebagai objek wisata berwawasan lingkungan (ekowisata) penerapan model pembelajaran kontekstual berbasis deep dialogue/critical thinking meningkatkan kemampuan komunikasi matematika siswa smp penerapan model pembelajaran sains teknologi masyarakat (stm) meningkatkan hasil belajar siswa materi peristiwa alam terjadi indonesia kelas v sd upaya peningkatan hasil belajar siswa mata pelajaran ipa subbahasan sifat-sifat benda menerapkan metode inkuiri peningkatan hasil belajar siswa kelas v pembelajaran ipa tentang alat pencernaan manusia melalui pendekatan konstruktivisme meningkatkan kreativitas anak usia taman kanak-kanak melalui metode pembelajaran eksperimen penelitian tindakan kelas kelompok b ra al barokah tahun pelajaran 2012/2013 penerapan pendekatan kontekstual meningkatkan kemampuan berpikir kritis matematis motivasi belajar siswa materi benda-benda simetris (penelitian eksperimen siswa kelas iv sd negeri citimun i sd negeri cilimbangan kecamatan cimalaka kabupaten sumedang) the use of video in teaching speaking efektivitas penggunaan metode memory bank system (mbs) upaya meningkatkan penguasaan kosakata keterampilan menulis bahasa perancis studi pra eksperimen siswa kelas xi bahasa sma n 1 cicalengka 2012/2013 perbandingan overhand throw sidehand throw akurasi kecepatan lemparan olahraga softball pengaruh minat belajar motivasi belajar prestasi belajar mata pelajaran ekonomi survey siswa kelas xi ips sma negeri se-kabupaten garut model konseling positive peer culture meningkatkan interaksi sosial siswa tunanetra sekolah inklusif studi pengembangan model konseling bagi siswa tunanetra sekolah inklusif man, daerah istimewa yogyakarta pola penyesuaian diri mahasiswa pindah jurusan universitas pendidikan indonesia pengaruh metode juz’i kemampuan menghafal surat-surat pendek al-qur’an anak tunanetra psbn wyata guna bandung penerapan strategi pembelajaran aktif meningkatkan kemampuan membaca pemahaman siswa peningkatan kemampuan mengenal konsep bilangan melalui kegiatan proyek memasak taman kanak-kanak penelitian tindakan kelas anak kelompok b tk al-istiqoomah kecamatan cimahi utara kota cimahi peran organisasi mahasiswa meningkatkan civic skills mahasiswa mahasiswa pendidikan kewarganegaraan-fakultas pendidikan ilmu pendidikan sosial-universitas pendidikan indonesia kehidupan petani sayur desa cibodas kecamatan lembang tahun 1992-2010 pengaruh kinerja relationship marketing melalui membership program loyalitas pelanggan survey pengguna jasa lapangan futsal menjadi member queen futsal bandung pengaruh iklim organisasi sekolah motivasi kerja kinerja guru sd negeri kota sukabumi penerapan pembelajaran berbasis masalah menggunakan multimedia learning modules (mlms) in hybrid-online meningkatkan keterampilan berpikir kritis penguasaan konsep fisika siswa kelas viii smp (salah satu pondok pesantren modern) studi komparatif penggunaan metode quantum learning teknik peta pikiran teknik pohon konsep meningkatkan hasil belajar studi eksperimen mata pelajaran ekonomi standar kompetensi memamahami konsumsi investasi kelas x sma negeri 9 garut penggunaan media karteritasi meningkatkan hasil belajar siswa materi perkembangan teknologi transportasi (penelitian tindakan kelas siswa kelas iv sdn 2 suci kecamatan mundu kabupaten cirebon) pengaruh kompetensi profesional guru efektivitas praktek kerja industri kompetensi siswa kelas xii smk negeri 1 kota ternate the implementation of cooperative learning method in teaching reading comprehension kajian bandingan wawacan layang syekh abdul qadir jaelani manaqib syeh abdul qadir jaelani pemanfaatannya bagi pendidikan pengembangan model pembelajaran praktik mengajar reflektif (mp2mr) meningkatkan kompetensi pedagogik mahasiswa s1 pendidikan guru sekolah dasar (pgsd) upaya meningkatkan hasil belajar siswa mata pelajaran ipa tentang pokok bahasan struktur fungsi tumbuhan melalui penerapan model pembelajaran interaktif penelitian tindakan kelas sdn bukit mulya kelas iv semester i 2012/2013 kecamatan cianjur kabupaten cianjur upaya meningkatkan hasil belajar siswa mata pelajaran ipa tentang pokok bahasan struktur fungsi tumbuhan melalui penerapan model pembelajaran interaktif model pembelajaran pikat alami namai tunjukkan ulangi nikmati meningkatkan hasil belajar siswa menulis pantun kajian eksperimen siswa kelas vii smpn 2 cipeundeuy upaya menumbuhkan perilaku arif anak lingkungan melalui metode pembelajaran alam studi deskriptif sekolah kandank jurang doank penggunaan lembar kerja siswa (lks) meningkatkan hasil belajar siswa materi gaya magnet kelas v sdn tembong 2 kec. cipocok jaya kota serang pengaruh model pembelajaran matematika knisley peningkatan kemampuan koneksi matematis siswa sma pengaruh modal intelektual nilai perusahaan yahoo!inc laporan keuangan yahoo!inc periode 1996-2011 pengaruh kohesivitas kelompok produktivitas kerja karyawan studi ke arah pengembangan program bimbingan konseling meningkatkan kohesivitas kelompok karyawan pdam tirta raharja cabang soreang kontribusi fleksibilitas pergelangan tangan fleksibilitas pinggang hasil standing shoot permainan bola tangan ), penerapan model pembelajaran kontekstual berbasis deep dialogue/critical thinking meningkatkan kemampuan komunikasi matematika siswa smp penerapan model pembelajaran learning cycle 7e berbantuan komputer meningkatkan penguasaan konsep keterampilan berpikir kritis siswa materi fluida statis penerapan asesmen kinerja meningkatkan kemampuan habits of mind penguasaan konsep biologi siswa kelas xi perbandingan kebugaran jasmani siswa smp masuk pagi masuk siang pengaruh permainan tradisional pola gerak siswa sekolah dasar penerapan prinsip belajar orang dewasa pelatihan desa mandiri pangan bagi aparatur balai besar pelatihan pertanian (bbpp) lembang penerapan metode pembelajaran kooperatif tipe teams games tournament berbasis permainan kuis jeopardy talking stick meningkatkan pemahaman konsep fisika siswa smp pengukuran detail situasi perencanaan jalan tol cisundawu pengembangan sikap kewiraswastaan melalui pelatihan pelatihan santri berdikari upaya pengembangan sikap kewiraswastaan pesantren daarut tauhiid bandung pengaruh metode pembelajaran tutor sebaya berbantuan simulator cisco packet tracerterhadap peningkatan kemampuan pemahaman konsep peserta didik smk mata pelajaran produktif rekayasa perangkat lunak (rpl) pengaruh model pendekatan taktis modifikasi alat hasil belajar bolavoli siswa kelas x madrasah aliyah negeri surade kabupaten sukabumi efektifitas penggunaan strategi pembelajaran aktif card sort kemampuan kosakata bahasa arab siswa studi eksperimen kuasi siswa kelas vii mts sagalaherang subang 2012/2013 pengaruh outbound peningkatan nilai karakter siswa studi eksperimen smp negeri 29 bandung pengaruh kompensasi kinerja ketua prodi smk negeri se-kota bandung teacher’s questioning strategies and students’ responses in young learners’ classroom interaction pengaruh metode tutor sebaya prestasi belajar mata pelajaran menggambar utilitas gedung smk negeri 2 garut analisis faktor – faktor mempengaruhi kinerja guru ekonomi sma negeri kota bandung pengaruh mutu layanan guru biaya pribadi kepuasan siswa smp swasta se-kota tasikmalaya hubungan antara konformitas teman sebaya kenakalan remaja studi korelasional siswa kelas xii sma pgri 2 sindang indramayu penerapan pendekatan kontruktivisme meningkatkan hasil belajar siswa tentang materi penyesuaian diri makhluk hidup lingkungannya mata pelajaran ipa kelas v sdn mande 3 kompetensi pribadi tutor diharapkan oleh tutee tutor program tutorial pai upi penerapan model pembelajaran kooperatif tipe tgt (teams games tournaments)untuk meningkatkan hasil belajar siswa materi proklamasi kemerdekaa indonesia penelitian tindakan kelas kelas v sd negeri 10 serang kota serang pengaruh penggunaan media lagu jepang kemampuan membaca huruf hiragana katakana siswa sman 1 cisarua pendidikan moral berbasis keteladanan cara islami pendidikan anak usia dini studi tentang pendidikan moral pendidikan anak usia dini bandung raya efektivitas program pelatihan mengembangkan locus of control siswa sekolah menengah atas pembelajaran studi eksperimen siswa kelas xi ipa sma negeri 1 kadupandak kabupaten cianjur tahun pelajaran 2012/2013 peranan kyayi membina keimanan ketaqwaan santri penelitian pesantren darul arqam muhammadiyah garut inventarasi data atribut mata air hulu sungai utama citarum kabupaten bandung penerapan model ecirr (elicit- confront-identify-resolve-reinforce) menggunakan kombinasi real laboratory virtual laboratory mereduksi miskonsepsi meningkatkan keterampilan proses sains mahasiswa tentang konsep-konsep rangkaian listrik pengaruh pendekatan taktis waktu aktif belajar pembelajaran pendidikan jasmani studi eksperimen siswa kelas x sma pasundan 1 bandung implementasi model pembelajaran investigasi kelompok meningkatkan kemampuan mengapresiasi motif batik cirebonan siswa kelas viii smp pasundan 3 bandung kajian pelaksanaan pendidikan inklusif bagi anak autisme sdit amalia kabupaten bogo analisis struktural novél tri tangtu bumi karya yoséph iskandar pikeun bahan pangajaran maca kelas xi pengaruh kinerja pustakawan layanan prima centre of information scientific resources and library (cisral) universitas padjadjaran studi deskriptif pemustaka bagian layanan referensi cisral unpad perbedaan hasil tes kemampuan daya tahan cardiovascular menggunakan tes balke (lari 15 menit) tes bleept atlet futsal penerapan metode demonstrasi pembelajaran bahasa indonesia meningkatkan kemampuan menulis kalimat sederhana siswa tunarungu implementasi pembelajaran melukis lilin (candle painting) tk darussalam bandung studi deskriptif kelompok a tk darussalam, kota bandung 2013-2014 penerapan metode storytelling meningkatkan kemampuan menyimak berbicara siswa kelas v sekolah dasar penelitian tindakan kelas akan dilaksanakan mata pelajaran bahasa indonesia kelas v sdn bukanagara pengaruh akuntabilitas manajemen keuangan kinerja mengajar guru sekolah efektif studi deskriptif analitik kepala sekolah smp islam swasta kota bandung tahun pelajaran 2011-2012 penggunaan teknik lotov (latihan olah tubuh olah vokal) pembelajaran dramatisasi puisi penelitian eksperimen semu siswa kelas x sma negeri 8 bandung 2013/2014 hubungan antara pelaksanaan kegiatan pembelajaran sekolah berasrama pengembangan kecerdasan spiritual siswa studi derskriptif korelasional siswa kelas viii smp daarut tauhiid boarding school bandung analisis pelaksanaan program akselerasi dampaknya kecerdasan emosi siswa sma negeri 3 kota sukabumi gambaran perilaku hidup bersih sehat siswa sekolah dasar 2 nanjung penerapan penilaian kinerja berbasis praktikum mengidentifikasi kinerja siswa pembelajaran ipa smp tari topeng klana sukabumi kecamatan cikole kota sukabumi membangun model vektor data tanaman baru blok 5 taman keanekaragaman hayati (kehati) provinsi jawa barat desa sindangkerta jatinangor. engd thesis, universitas pendidikan indonesia. penerapan metode demonstrasi melalui pita garis bilangan dalammeningkatkan hasil belajar tentang konsep perkalian pembagian bilangan bulat negatif (penelitiantindakankelas kelas v sdnegerikusnankecamatankejaksan kota cirebon) analisis kelayakan multimedia interaktif biologi sma materi metabolisme, substansi genetik, sintesis protein, pembelahan sel pengaruh pembelajaran kontekstual kemampuan pemahaman representasi matematis kinerja musyawarah guru mata pelajaran (mgmp) pkn meningkatkan kompetensi guru sekolah using children short stories to enhance students’ reading comprehension penerapan model pembelajaran arias (assurance, relevance, interest, assessment and satisfaction) berbantuan multimedia interaktif peningkatan kemampuan aplikasi mata pelajaran tik sma peningkatan keterampilan berbicara siswa meningkatkan kemampuan siswa menyimak cerita rakyat melalui media audio visual mata pelajaran bahasa indonesiaptk kelas v sdn kebon kota serang, kecamatan kasemen, kota serang pembelajaran berbasis praktikum virtual meningkatkan kemampuan berpikir kritis sikap ilmiah siswa kelas x materi invertebrata pengaruh penggunaan metode audio lingual keterampilan berbicara siswa pembelajaran bahasa inggris penelitian pre eksperimen kelas iv sdn sukamulih kecamatan kadipaten kabupatentasikmalaya analisis program akselerasi bagi siswa cerdas istimewa dilihat dari prestasi akademik, kecerdasan emosional kreativitas siswa penerapan algoritma quest (quick, unbiased, efficient statistical tree) pembentukan pohon klasifikasi minat masyarakat kabupaten purwakarta bank syariah pengembangan personil upaya meningkatkan kinerja dosen universitas islam bandung politeknik industri & niaga bandung meningkatkan hasil belajar matematika siswa kelas ii tentang perkalian pembagian bilangan cacah melalui alat peraga meningkatkan hasil belajar matematika siswa kelas ii tentang perkalian pembagian bilangan cacah melalui alat peraga penelitian tindakan kelas siswa kelas ii sdn wanaherang 03 kecamatan gunung putri kabupaten bogor analisis faktor – faktor bauran pemasaran pengaruhnya keputusan pembelian konsumen surabi la viva café bandung pengaruh pembelajaran berbasis masalah penguasaan konsep kecakapan berpikir siswa kelas xi konsep sistem pencernaan pengembangan strategi pembelajaran materi laju reaksi berdasarkan hasil analisis profil model mental siswa sma penerapan strategi pembelajaran inquiri program parenting meningkatkan pemahaman orang tua tentang pola asuh pengaruh pendapatan perilaku konsumsi dilihat menurut perbedaan tingkat pendidikan analisis karakteristik wisatawan kegiatan wiasata ciater spa resort penerapan model pembelajaran collaborative learninguntuk meningkatkan kemampuan komunikasi matematis siswa sma kelas x penerapan pendekatan matematika realistik meningkatkan hasil belajar siswa materi keliling luas segitiga penelitian tindakan kelas ini dilaksanakan siswa kelas iv a sekolah dasar negeri tegallega 1 kecamatan cipanas kabupaten cianjur analisis daya saing industri jaket kulit sukaregang kabupaten garut aplikasi model advance organizer pembelajaran seni tari meningkatkan kognitif siswa smp negeri 30 bandung pengaruh kualitas layanan loyalitas nasabah pt bank bni kantor cabang syariah unit buah batu bandung pembelajaran membaca permulaan melalui metode analisis glass bagi siswa berkesulitan membaca (reading difficulties) siswa kelas iii sdn cineumbeuy - kuningan tahun akademik 2012/2013 non-observance of maxims in facebook conversation from gender perspective a case study of the ninth semester of english students at one university in bandung pengaruh ekstrak biji korobenguk hasil soxhletasi gejala penyakit parkinson hubungan iklim organisasi kinerja pegawai sentra pendidikan bank rakyat indonesia bandung pengembangan prosedur praktikum lembar kerja siswa (lks) pembelajaran learning cycle 7e subtopik penentuan tetapan kesetimbangan asam penerapan model pembelajaran cooperative script meningkatkan kesadaran siswa sebagai masyarakat global pembelajaran pendidikan kewarganegaraan penelitian tindakan kelas smp negeri 10 depok peningkatan kemampuan berpikir kritis siswa smp melalui pendekatan model-eliciting activities (meas) pembelajaran matematika penelitian kuasi eksperimen siswa smp negeri 9 cimahi kelas vii the use of vocabulary journal in enriching students’ vocabulary mastery and the students’ attitudes toward its use pengaruh keputusan investasi, keputusan pendanaan kebijakan dividen nilai perusahaan studi empiris perusahaan manufaktur listing bursa efek indonesia tahun 2012 pengaruh metode as shaff penguasaan nahwu siswa studi eksperimen siswa kelas 1 (tsanawiyyah) pesantren persatuan islam no.50 lembang kabupaten bandung barat 2012/2013 tingkat penguasaan matematika konten pedagogik (pedagogical content knowledge) calon guru matematika mahasiswa ppl sebuah universitas swasta jawa barat perbandingan metode dekomposisi klasik metode pemulusan eksponensial holt-winter meramalkan tingkat pencemaran udara kota bandung periode 2003-2012 ikon budaya visual persepsi remaja kota bandung penerapan challenge-based learning upaya meningkatkan kemampuan pemahaman konsep penalaran matematis siswa sma analisis kanyouku berhubungan adat kebiasaan adat kebiasaan orang jepang zaman feodal sebagai unsur pembentuknya aspek kreativitas linguistis berbahasa indonesia studi deskriptif-analitis pemakaian kalimat karangan-kreatif siswa kelas iii. a. 2 sma widyanasa medan 1990/1991 pengaruh model pembelajaran inkuiri terbimbing meningkatkan pemahaman siswa materi simetri lipat (suatu penelitian eksperimen siswa kelas v sdn padasuka ii sdn padamulya kabupaten sumedang) penerapan model pembelajaran quantum learning standar kompetensi mengidentifikasi ilmu bangunan gedung smk negeri 1 majalengka problem based learning to enhance students’ critical thinking skills and concept comprehension in pollution concept kontribusi perpustakaan sekolah kebutuhan informasi siswa sma negeri 3 bandung. prodi perpustakaan informasi developing character values in the teaching of narrative texts using genre based approach a case study at a senior high school in bandung pengaruh model pembelajaran contextual teaching and learning (ctl) meningkatkan pemahaman siswa materi kesebangunan (penelitian eksperimen siswa kelas v sd negeri cimara sd negeri 2 paniis kecamatan pasawahan kabupaten kuningan) studi penerapan sistem manajemen keselamatan kesehatan kerja proyek pembangunan apartemen pinewood jatinangor pertumbuhan produksi umbi kentang (solanum tuberosum.l) dari bibit umbi kentang (g0) pemberian paclobutrazol penerapan model pembelajaran kooperatif tipe jigsaw meningkatkan hasil belajar siswa standar kompetensi memahami kandang ternak smk negeri 2 cilaku penerapan keterampilan proses melalui model student teams-achievement divisions meningkatkan hasil belajar siswa mata pelajaran ilmu pengetahuan alam siswa kelas 3 sdn tonjong 2 kota sukabumi pengembangan kualitas sumberdaya pemuda melalui program pelatihan studi kualitatif program pelatihan kader hmi tasikmalaya profil pengelolaan usaha mandiri lulusan pelatihan keterampilan kasus lulusan pelatihan keterampilan menjahit panti rehabilitasi sosial pamardi putra "binangkit" lembang jawa barat studi tentang proses pengembangan profesional kepala sekolah menengah atas dl kotamadya sukabumi implementasi model pembelajaran inkuiri pembelajaran bola besar penelitian tindakan kelas peserta didik kelas v. b sdn gegerkalong girang 1-2 kota bandung penerapan model project based learning (pjbl) meningkatkan penalaran logis siswa konsep pertumbuhan perkembangan rancang bangun alat ukur konduktansi listrik otomatis berbasis mikrokontroler atmega8535 peramalan beban jangka pendek husus hari libur berbasis jaringan syaraf tiruan dgn algoritma back propagation pengintegrasian pendidikan antikorupsi pembelajaran pkn sebagai penguat karakter bangsa studi evaluasi pengembangan perangkat pembelajaran bermodel pakem sekolah menengah pertama tradisi bertani jagung masyarakat muna kajian struktur kegiatan, struktur teks, konteks penuturan, proses penciptaan fungsi mantra serta model pembelajarannya sma penerapan strategi literasi pembelajaran bertema pelangi meningkatkan literasi fisika siswa smp penerimaan asas tunggal pancasila oleh nahdlatul ulama latar belakang proses 1983-1985 penerapan pendekatan contextual teaching and learning (ctl) upaya meningkatkan hasil belajar kognitif siswa mata pelajaran kkpi penelitian eksperimen siswa kelas x smk negeri 2 baleendah 2012/2013 kajian toponimi wilayah kacamatan kersamanah kabupatén garut dumasar kana carita rayat pengaruh model pembelajaran kooperatif metode diskusi menggunakan teknik make a match pemahaman konsep peserta didik studi eksperimen mata pelajaran ekonomi siswa kelas x sma negeri 5 cimahi 2013-2014 peningkatan keterampilan berbicara siswa mendeskripsikan tempat metode field trip mata pelajaran bahasa indonesiaptk kelas iv sdn kebon kecamatan kasemen kota serang keanekaragaman parasitoid drosophila sp. sekitar kecamatan kiaracondong kota bandung tentang family quality of life (fqol) keluarga-keluarga memiliki anak down syndrome lembaga pendidikan x bandung analisis kebutuhan pengembangan tenaga edukatif fakultas kedokteran gigi - universitas padjadjaran model pembinaan estetik pembelajaran matematika menggunakan etnomatematika budaya lokal masyarakat kalimantan barat pengaruh terapi musik klasik penurunan kecemasan atlet sebelum menghadapi pertandingan pengawasan pengelolaan sekolah sd hegeri kabupaten aceh utara penggunaan metode eksperimen meningkatkan hasil belajar siswa pembelajaran ipa materi energi panas kelas verba kalimat bahasa sundakajian role and reference grammar kajian pengaruh pemberian bionutrien caf1 caf2 pertumbuhan hasil panen tanaman padi (oryza sativa l) peranan oda nobunaga proses unifikasi jepang tahun 1567-1582 layanan dasar bimbingan konseling mengembangkan empati siswa sekolah dasar sd negeri nogotirto sleman yogyakarta 2011/2012 penerapan metode bermain kreatif outdoor study meningkatkan kemampuan motorik kasar kreativitas anak penelitian tindakan kelas anak kelompok b tk al-hikmah kec. kiaracondong bandung tari serimpi pertunjukan seni sandiwara kelompok darma saputra kecamatan plumbon kabupaten indramayu pendekatan discovery meningkatkan hasil belajar siswa materi alat indera manusia penerapan model pembelajaran cooperatif learning tipe stad (student teams achievement divisions) meningkatkan hasil belajar siswa pokok bahasan kegiatan ekonomi potensi alam kelas iv sdptk kelas iv sd negeri margasari kec. pulo ampel kab. serang upaya peningkatan hasil belajar siswa mata pelajaran ipa sub bahasan sifat-sifat benda menerapkan metode inkuiri penerapan model search, solve, create, and share pendekatan problem posing meningkatkan kemampuan penalaran komunikasi matematis siswa smp efektivitas penggunaan trainer wireless microphone sebagai media pembelajaran kompetensi dasar menganalisis sistem radio pemancar fm meningkatkan hasil belajar siswa upaya pembina palang meraii remaja (pmr) menanamkan kesetiakawanan sosial anggotanya melalui latihan rutin pmr suatu studi tentang pembinaan kesetiakawanan sosial smk negeri 1 kadipaten kabupaten majalengka pemanfaatan zat warna azo dari limbah industri tekstil sebagai inhibitor korosi proses pencucian logam asam (pickling) penerapan peer assessment menilai poster sebagai produk berpikir kreatif materi sistem saraf realisasi makna interpersonal antara guru bk siswa kegiatan layanan bimbingan konseling penerapan model pembelajaran kooperatif make a match meningkatkan hasil belajar siswa pembelajaran ipa sekolah dasar penelitian tindakan kelas materi mengelompokkan hewan berdasarkan ciri-cirinya kelas iii sdn jati ragas ii kecamatan patokbeusi kabupaten subang 2012/2013 penerapan strategi concept mapping meningkatkan hasil belajar siswa konsep teknologi produksi komunikasi transportasi kelas iv sdn cimanuk 2 kecamatan cimanuk kabupaten pandeglang kesiapan kepala sekolah guru sekolah luar biasa pengembangan peran slb memberikan layanan sebagai resource center pengaruh metode latihan circuit training kekuatan maksimal daya tahan kardiovaskular cabang olahraga dayung studi evaluatif tentang manajemen sistem perencanaan penyusunan program pen6ang6aran (sp4) ikip bandung analisis faktor internal eksternal mengembangkan program bimbingan belajar bagi siswa berbakat studi deskriptif siswa akselerasi smp negeri 1 sumedangtahun 2012/2013 pengaruh perilaku kepemimpinan kepala sekolah kinerja guru sltpn kota bandung preparasi nanopartikel au memanfaatkan ekstrak daun mint (mentha cordifolia opiz) sebagai pendeteksi cemaran melamin efektivitas penggunaan thariqah mubasyirah peningkatan penguasaan kosakata bahasa arab studi kuasi eksperimen siswa kelas xi madrasah aliyah ‘mathlaul anwar’ malingping banten therepresentation of youth inpocari sweat television advertisements meningkatkan hasil belajar siswa konsep pesawat sederhana melalui pendekatan sains teknologi masyarakat (stm)penelitian tindakan kelas kelas v (lima) sdn cipete 2 kecamatan curug kota serang matriks hermitian fungsi monoton operator efektivitas model pembelajaran aktif tipe trading place berorientasi berpikir kritis pembelajaran membaca artikel ilmiah populer studi kuasi eksperimen siswa kelas xi sman i garut 2013-2014 pengaruh likuiditas return saham perusahaan terdaftar jakarta islamic index upaya meningkatkan kebugaran jasmani siswa melalui aktivitas modifikasi permainan bolavoli meningkatkan hasil belajar siswa tentang sifat-sifat cahaya metode demonstrasi sdn cikalongkulon iv cianjur penelitian tindakan kelas siswa kelas v sdn cikalongkulon iv kecamatan cikalongkulon kabupaten cianjur upaya meningkatkan hasil belajar siswa pembelajaran ipa tentang sifat-sifat cahaya metode demonstrasi kelas v sekolah dasar kajian implementasi pembelajaran pemahaman konsep materi sifatnya guru ipa smp peserta program bermutu mgmp sub rayon i tanjungsari peningkatan hasil belajar siswa kelas v pembelajaran ipa tentang alat pencernaan manusia melalui pendekatan konstruktivisme penelitian tindakan kelas sdn bojongsari 2 kecamatan sukaluyu kabupaten cianjur penggunaan media audio visual meningkatkan hasil belajar siswa materi perkembangan teknologi transportasi uji banding brocolli mousse bilik bahan dasar tepung gembili (dioscorea esculenta) tepung terigu pengembangan model pelatihan inkuiri pembelajaran bahasa indonesia sekolah dasar suatu kaji tindak pembelajaran menulis sd sedang v kabupaten purwakarta penerapan peraturan tata guna lahan kota bandung tugas mata kuliah studio perancangan arsitektur 3 persepsi ke6uruan para guru sma lulusan universitas serta institut bukan ke6uruan lulusan ikip dl kotamadya bandung studi perbandingan mengenai pandangan para guru mengajarkan umu-ilmu sosial ilmu-llmu eksakta tentang pelaksanaan tugasnya sebagai guru studi tentang pelaksanaan sistem satuan kredit semester (sks) jenjang program sarjana ikip bandung pemanfaatan curug orok sebagi sumber belajar mata pelajaran geografi sma negeri kabupaten garut potensi curug sigay sebagai sumber energi pembangkit listrik tenaga mikro hidro model pembelajaran kemandirian meningkatkan hasil belajar siswa studi mata pelajaran fiqh madrasah aliyah kabupaten garut pengaruh motivasi keberhasilan usaha pengusaha tanaman hias mawar potong desa cihideung bandung barat penerapan teknik memotong merekatkan (cutting-gluing) mengubah teks wawancara menjadi paragraf narasi kesenian didong grup bayakku acara syukuran munik ni reje redelong kabupaten bener meriah penggunaan model treffinger meningkatkan kemampuan kreativitas matematik siswa smp studi eksperimen siswa kelas viii smp kartika siliwangi xix-2 penerapan pembelajaran terpadu model keterpaduan (integrated model) pembelajaran ips sd tema "kebutuhan keluarga" penelitian tindakan kelas kelas 3 sekolah dasar negeri danau batur kecamatan curug kabupaten tangerang- banten pengaruh customer value meningkatkan kepuasan wisatawan saung angklung udjo survei wisatawan nusantara individu saung angklung udjo penerapan reading task cooperative learning meningkatkan prestasi belajar siswa smp mata pelajaran fisika layanan dasar bimbingan konseling mengembangkan keterampilan belajarpenelitian pra-eksperimen siswa kelas x sma yayasan atikan sunda (yas) bandung 2011/2012 penerapan metode eksperimen meningkatkan hasil belajar siswa pembelajaran ipa tentang pokok bahasan gaya penelitian tindakan kelas sdn pagadean kelas iv semester 2 kecamatan subang kabupaten subang tahun pelajaran 2012/2013 kemampuan pemahaman penalaran matematis pembelajaran inkuiri terbimbing penguatan e-learning berbasis aplikasi moodle pengaruh model pembelajaran kooperatif tipe numbered heads together peningkatan kemampuan penalaran komunikasi matematis siswa smp pelang6aran etis oler siswa alasan menghindarinya studi perbandingan antara siswa madrasah aliyah sekolah menengah atas dl bandar lampung hubungan antara iklim organisasi sekolah kepemimpinan instruksional kepala sekolah prestasi kerja guru sekolah dasar kantor departemen pendidikan kebudayaan kecamatan padalarang kabupaten bandung kemampuan menyimak bahasa jepang mahasiswa tingkat iii tahun akademik 2012/2013 penerapan pendekatan keterampilan proses meningkatkan hasil belajar siswa pembelajaran ipa tentang pokok bahasan pancaindra (pengecap) penerapan pendekatan keterampilan proses meningkatkan hasil belajar siswa pembelajaran ipa tentang pokok bahasan pancaindra (pengecap) penelitian tindakan kelas kelas iv sd negeri tugu 3 cimanggis kota depok propinsi jawa barat daya saing sekolah tinggi ilmu ekonomi studi kapabilitas pimpinan orientasi pasar orientasi pembelajaran dampaknya kinerja daya saing program studi manajemen stie lingkungan kopertis wilayah iv jawa barat banten terakreditasi b peningkatan kemampuan pemahaman berpikir kritis matematis siswa sma menggunakan model pembelajaran kooperatif tipe bidak bantuan individual kelompok pengaruh sikap praktik kewirausahaan minat berwirausaha siswa kelas x smkn 1 sumedang student teams achievement divisions stad) in teaching writing narrative text student teams achievement divisions(stad) in teaching writing narrative text profil kemampuan komunikasi siswa melalui tes pasca praktikum sistem ekskresi penerapan metode inkuiri meningkatkan hasil belajar siswa pokok bahasan struktur fungsi bagian tumbuhan penelitian tindakan kelas siswa kelas iv mi al-huda 1 desa cintamekar kecamatan serangpanjang kabupaten subang tahun pelajaran 2012/2013 model pengembangan kecerdasan emosional karyawan pendekatan konseling perkembangan studi pengembangan kecerdasan emosional karyawan pt semen padang wacana display picture blackberry messenger pengembangan program wisata edukasi wana wisata gunung puntang pengaruh kondisi kerja kepuasan kerja karyawan divisi sumber daya manusia pt kai (persero) bandung meningkatkan hasil belajar siswa konsep cahaya menggunakan pendekatan belajar tuntaspenelitian tindakan kelas kelas v sdn cigeblag kecamatan ciwandan kota cilegon transformasi nilai-nilai kepemimpinan sunda melalui pendidikan ilmu pengetahuan sosial studi fenomenologi sekolah menengah pertama lingkungan yayasan pendidikan dasar menengah pasundan meningkatkan kreativitas anak usia taman kanak-kanak melalui metode pembelajaran eksperimen meningkatkan penguasaan kosakata bahasa arab melalui media flashcard pengaruh program direct marketing keputusan menggunakan meeting package grand hotel lembang pengaruh kegiatan kelompok kerja guru latar belakang pendidikan kinerja guru kajian guru sekolah dasar lingkungan cabang dinas pendidikan kecamatan subang kabupaten subang kajian implementasi pendidikan lingkungan hidup kota bandung smpn 7 kota bandung penerapan metode pembelajaran tutor sebaya meningkatkan keterampilan bermain ornamen suling lubang enam penelitian tindakan kelas smp negeri 4 subang pengaruh sikap siswa mata pelajaran akuntansi hasil belajar siswa sma negeri 7 tasikmalaya (2011/2012) pengetahuan kewirausahaan persepsi mahasiswa tentang kewirausahaan serta pengaruhnya intensi berwirausaha survei mahasiswa fakultas pendidikan ekonomi bisnis universitas pendidikan indonesia lagu bebas sebagai stimulus menumbuhkan kreatifitas gerak anak usia dini paud wisana cidadap bandung karakteristik proses belajar mengajar filsafat pancasila ditinjau dari pendidikan umum suatu sludi dosen filsafat pancasila ikip yogyakarta pengaruh lingkungan belajar minat belajar hasil belajar siswa mata pelajaran ekonomi survey sma swasta kecamatan cicalengka studi farmakologi antiparkinson ekstrak daging biji karabenguk (mucuna pruriens linn var. utilis) mencit (mus muculus) efektivitas media interaktif flash manga pembelajaran kosakata bahasa jepang siswa sma penelitian eksperimen semu siswa kelas x sma laboratorium upi bandung penerapan pendekatan lingkungan meningkatkan hasil belajar siswa mata pelajaran ipa pokok bahasan sumber daya alam lingkungan pemanfaatan hasil pelatihan baby sitter pelaksanaan pengasuhan bayi penyelenggaraan sistem administrasi akademik lingkungan perguruan tinggi negeri studi tentang proses penyelenggaraan sistem administrasi akademik ikip bandung universitas padjadjaran penggunaan strategi contextual teaching and learning mata pelajaran ipa meningkatkan kemampuan mengenal bagian tumbuhan peserta didik tuna grahita ringan pengaruh pendekatan brain based learning kemampuan berpikir kritis siswa pembelajaran ipa pengaruh profesionalisme auditor internal pendeteksian fraud assets misappropriation survey auditor internal bumn berpusat kota bandung pengaruh pendekatan problem based learning kemampuan berpikir kritis siswapada materi penjumlahan pengurangan pecahan pelatihan trumpet marching band locomotive pt kai bandung pengaruh penggunaan siklus belajar tipe empiris induktif penguasaan konsep siswa sma pembelajaran transportasi tumbuhan korélasi antara kompetensi jeung performansi ngadongéng siswa kelas x sman 20 bandung taun ajar 2013/2014 analisis kinerja viral marketing brand equity smartphone nokia survei komunitas smartphone nokia jejaring sosial facebook pengaruh metode latihan self talk intruksional penguasaan teknik dasar servis tinggi lob bertahan atlet bulutangkis pemula usia 10-12 tahun meningkatkan keterampilan proses sains siswa mata pelajaran ipa materi gaya melalui penerapan model learning cycle 7e penelitian tindakan kelas dilaksanakan siswa kelas v sdn pasiripis ii kecamatan kertajati kabupaten majalengka tahun pelajaran 2012/2013 pengaruh penggunaan media alat bantu musik tam-tam peningkatan partisipasi siswa pembelajaran pendidikan jasmani kelas v sdn sekemandung i kab. bandung pengaruh pembelajaran inquiry lesson peningkatan kemampuan literasi sains sikap ilmiah siswa smp materi fotosintesis pengaruh pertumbuhan perusahaan, leverage, kepemilikan manajerial pembagian dividen tunai bank umum terdaftar bursa efek indonesia tahun 2007-2011 kontribusi kecepatan kekuatan otot tungkai keterampilan teknik dasar dribble pemain futsal penerapan permainan cheerleaders meningkatkan kemampuan membaca ujaran kata benda anak tunarungu perbandingan gaya mengajar komando gaya mengajar problem solving hasil belajar service panjang cabang olahraga bulutangkis strategi pengorganisasian tenaga administratif perguruan tinggi studikasusdi sekolah tinggi seni rupa desain indonesia [stisi] bandung pengaruh motivasi belajar prestasi belajar siswa standar kompetensi menggambar konstruksi atap smk negeri 1 majalengka efektivitas penggunaan metode think-talk-write (ttw) berbasis multimedia meningkatkan kemampuan analisis siswa smk rekayasa perangkat lunak assertive training mereduksi peserta didik mengalami gejala adiksi handphone penelitian pra-eksperimen peserta didik kelas xi sma pasundan 8 bandung 2013/2014 pembinaan kehampuan profesional dosen yunior universitas pasundan bandung tentang pembinaan kemampuan profesionaldosen yunior oleh jurusan, fakultas universitas universitas pasundan bandung efektifitas strategi pembelajaran multiple intelligences peningkatan kemampuan muhadatsah studi eksperimen kuasi siswa kelas x sma negeri 11 kota bandung 2012/2013 perbedaan pengaruh model pembelajaran iknuiri model pembelajaran konvensional hasil belajar keterampilan bermain sepakbola smpn 1 lembang program pelatihan bimbingan konseling meningkatkan kompetensi profesional konselor sekolah penelitian kuasi eskperimen konselor sma negeri kota pontianak penerapan pendekatan taktis hasil pembelajaran kasti siswa sdn sukamandi ii kabupaten subang penerapan pendekatan taktis hasil pembelajaran permainan kastistudi deskriptif kualitatif sdn sukamandi ii kabupaten subang kontribusi kemampuan supervisi kepala sekolah kinerja mengajar guru sekolah menengah pertama negeri se-kabupaten purwakarta efektivitas pengelolaan praktek kerja industri rangka penyelenggaraan program pendidikan sistem ganda tentang pengelolaan prakerin smk negeri 1 bandung pengembangan model pembelajaran vct ppkn sekolah lanjutan tingkat pertama penerapan metode tanya jawab meningkatkan hasil belajar siswa pembelajaran ips sekolah dasar penelitian tindakan kelas dilakukan kelas iv sd negeri puncak uptd pendidikan kecamatan dawuan kabupaten subang 2012/2013 penerapan model pembelajaran cooperative learning teknik team game tournament (tgt) meningkatkan kemampuan berpikir kritis siswa pembelajaran pkn penelitian tindakan kelas siswa kelas vii smp. negeri 1 jatinunggal kab. sumedang pengaruh profitabilitas nilai pasar perusahaan subsektor telekomunikasi terdaftar bursa efek indonesia pengaruh kecerdasan emosional wirausaha keberhasilan usaha pengaruh pertumbuhan pdb, tingkat inflasi, tingkat suku bunga volatilitas harga saham syariah nilai tukar sebagai variable intervening penelitian indeks saham syariah indonesia malaysia periode 2009 – 2012 motif utama siswa sma kota bandung menggeluti cabang olahraga futsal studi deskriptif sma kota bandung mempunyai prestasi baik cabang olahraga futsal efektivitas metode amtsilati meningkatkan kemampuan qowa’id bahasa arab santri studi eksperimen kuasi kelas wustho pondok pesantren nurul huda-ciamis hubungan tingkat kebugaran jasmani teknik dasar futsal siswa sman 1 losarang kabupaten indramayu pembelajaran passing bawah permainan bola voli melalui metode guided discovery siswa kelas v sdn 2 pagundan kecamatan lebakwangi kabupaten kuningan pengaruh pelatihan staf pengadaan kompensasi efektifitas pengadaan barang/jasa lembaga penjaminan mutu pendidikan (lpmp) pusat pengembangan pemberdayaan pendidik tenaga kependidikan (p4tk)kementerian pendididikan & kebudayaan perilaku adaptif anak tunagrahita sekolah dasar inklusif hikmah teladan kota cimahi study deskriptif kualitatif siswa tunagrahita sd inklusif hikmah teladan kota cimahi supervisi program pengalaman lapangan oleh kepala sekolah, guru pamong dosen pembimbing upaya pembentukan kemampuan mengajar mahasiswa pengaruh perencanaan, pelaksanaan evaluasi pendidikan latihan pegawai kinerja pegawai kajian deskriptif analitik kantor pusat direktorat jenderal anggaran tahun 2002 pengaruh kualitas pelayanan kepuasan nasabah bank muamalat indonesia cabang buah batu upaya pembinaan usaha mandiri kalangan para wanita tuna susila panti sosial karya wanita margarahayu kecamatan cibadak kabupaten sukabumi pemanfaatan media pembelajaran e-learning meningkatkan pemahaman siswa standar kompetensi menggunakan hasil pengukuran smk negeri 4 bandung peningkatkan hasil belajar siswa pembelajaran ipa sekolah dasar melalui pendekatan lingkungan penelitian tindakan kelas kelas vi sd negeri i cipaisan kecamatan purwakarta kabupaten purwakarta tahun pelajaran 2012-2013 materi perkembangbiakan tumbuhan penerapan metode sosiodrama berorientasi kecerdasan emosional meningkatkan kemampuan menulis kreatif siswa kelas 4 sd negeri sukamanah kecamatan kalijati kabupaten subang pengaruh human relations dilakukan pimpinan iklim kerja pegawai pengaruh biaya pemasaran, tarif telepon, tarif sms pendapatan studi produk kartu prabayar pt. telkomsel penggunaan kata sapaan oleh siswa tunarungu peristiwa tutur studi deskriptif siswa tunarungu smplb slb negeri cicendo kota bandung pengembangan perangkat deteksi dini kerusakan transformator tenaga metode forward chaining meningkatkan keterampilan sosial anak taman kanak-kanak melalui permainan tradisional oray-orayan model konseling keterampilan hidup (lifeskillas counseling) meningkatkan keterampilan sosial siswa tuna rungu jenjang smplb slb-b kota bandung manajemen pembinaan narapidana lembaga pemasyarakatan tangerang analisis efektivitas efisiensi penyelenggaraan pendidikan program pelatihan orangtua intervensi dini anak gangguan komunikasi korelasi antara prestasi belajar, kemampuan berpikir kreatif, pengetahuan tentang nature of science siswa smp pembelajaran fisika menggunakan pendekatan sains teknologi masyarakat lingkungan penerapan pendekatan matematika realistik mata pelajaran matematika tentang pokok bahasan perkalian pembagian meningkatkan hasil belajar siswa modél pangajaran explicit instruction pikeun ngaronjatkeun kamampuh maca sajak panalungtikan tindakan kelas ka siswa kelas viii-f smp negeri 45 bandung taun ajaran 2012/2013 penerapan model pembelajaran contextual teaching and learning (ctl) meningkatkan hasil belajar siswa konsep cahaya sifat-sifatnyaptk kelas v sd negeri limpar kecamatan curug kota serang analisis potensi wisata paralayang sebagai pengembangan wisata minat khusus gunung panten kabupaten majalengka the analysis of educational marketing mix model and the influence on student’s choice to study in sma bpk penabur tasikmalaya pengembangan model pembelajaran quantum mata pelajaran bahasa inggris smu rangka pengembangan kurikulum berbasis sekolah propinsi banten pengelolaan mutu kehidupan kerja fasilitasi kinerja guru efektif studi smpn 11 smpn 36 kota bandung analisis banding sengketa pajak penghasilan badan pengadilan pajak meningkatkan kemampuan anak membilang melalui penggunaan kartu hitung bergambar penelitian tindakan kelas anak kelompok b tk tunas karya cibening kecamatan bungursari kabupaten purwakarta tahun pelajaran 2012-2013 upaya peningkatan pemahaman siswa prinsip kerja komponen pneumatik berbantuan perangkat lunak multimedia interaktif kesenian rebana asep serepet desa cirapuhan kecamatan selaawi kabupaten garut pengaruh melukis pasir cetakan beraneka bentuk meningkatkan kemampuan memahami bangun datar sederhana penelitian single subject research anak low vision kelas iii sdlb negeri a kota bandung pengaruh beban pajak tangguhan manajemen laba (earnings management) perusahaan makanan minuman terdaftar bursa efek indonesia penerapan pendekatan metakognitif pembelajaran fisika guna meningkatkan keterampilan berpikir kritis siswa smp pengaruh pemanfaatan layanan bimbingan karir pencapaian kompetensi siswa memasuki dunia kerja siswa kelas xii kompetensi keahlian akuntansi smk negeri 1 garut 2012/2013 penggunaan keterampilan bertanya dasardalam pembelajaran ips sd penelitan deskriptif kelas iv sdn sirnagalih kecamatan sariwangi kabupaten tasikmalaya pengaruh gaya kepemimpinan etos kerja pegawai dinas pertanian perikanan kabupaten majalengka studi persepsional pegawai dinas pertanian perikanan kabupaten majalengka representasi kritik sosial antologi cerpen senyum karyamin karya ahmad tohari kajian sosiologi sastra penyebab perubahan produksi budidaya akarwangi kecamatan leles kabupaten garut upaya penanggulangannya strategi penerimaan siswa baru sma swasta penerimaan siswa baru 1991/1992 sma madya bandung, sma bhakti kalsum bandung, sma bina taruna bandung penerapan module trainer robot wireless meningkatkan analisis siswa mata pelajaran amplitude sift keying pengembangan model pelatihan kewirausahaan berbasis potensi lokal meningkatkan kompetensi kewirausahaan warga belajar keaksaraan usaha mandiri (kum) kabupaten karawang penggunaan media flashcard meningkatkan kemampuan membaca anak tunarungu bidang studi bahasa indonesia penelitian tindakan kelas kelas 3 sdlbn kabupaten tasikmalaya primary students’ writing strategies in constructing experiences through dialogue journals a case study in a school in bandung applying cambridge curriculum profil ketersediaan media alat pembelajaran pendidikan jasmani sekolah dasar negeri kecamatan purwakarta model konseling kelompok meningkatkan regulasi diri kaum lansia panti jompo analisis kelayakan multimedia interaktif biologi sma materi virus, monera, fungi efisiensi manajemen sistem pendidikan sekolah dasar studi evaluatif tentang mengulang kelas putus sekolah sdn kabupaten indramayu tahun 2000/2001 penerapan model kooperatif tipe think-pair-share (tps) pendidikan ips meningkatkan hasil belajar peserta didik tentang kenampakan alam (penelitian tindakan kelas kelas iv sd negeri sirnasari kecamatan jatinunggal kabupaten sumedang) die effektivität des einsatzes des kreuzworträtsels zur erweiterung des deutschen wortschatzes interpretasi stratigrafi lapisan dasar laut data seismik pantul saluran tunggal daerah tanjung penyusuk perairan bangka profil komitmen belajar peserta didik implikasinya bagi layanan dasar bimbingan konseling penelitian studi deskriptif perserta didik kelas x smapgri 1 bandung 2012/2013 valuasi ekonomi dampak pertambangan galian pasir sungai kecamatan panyingkiran kabupaten majalengka profil kemampuan berinkuiri siswa hasil belajar siswa setelah diterapkan model pembelajaran level of inquiry pengaruh profitabilitas nilai pasar return saham perusahaan subsektor energi bursa efek indonesia pembelajaran matematika model advance organizer berbasis materi prasyarat terstruktur meningkatkan pemahaman konsep penalaran matematis siswa pengaruh latihan pliometrik hasil keceptan memanjat cabor panjat tebing kategori speed studi eksperimen atlet amatir fpti pandeglang perbandingan pengaruh terapi jalan kaki senam diabet penurunan kadar gula darah penderita diabetes melitus studi komparatif duafitnes center terbesar kota bandung hal kualitas pelayanan sarana-prasarana serta pengaruhnya minat pengunjung studi komparatif antara d’groove sport and wellnes center celebrity fitness penerapan model pembelajaran contextual teaching and learninguntuk meningkatkan aktifitas hasil belajar siswa kelas xi agribisnis perikanan pengaruh objektivitas integritas auditor internal kualitas audit inspektorat daerah se – bandung raya program bimbingan akademik meningkatkan academic self-efficacy peserta didik studi deskriptif peserta didik kelas vii smp negeri 9 bandung 2012/2013 analisis kesalahan pelafalan sokuon mahasiswa tingkat i pendidikan bahasa jepang fpbs upi penerapan model pembelajaran knisley meningkatkan kemampuan komunikasi matematik siswa smp pengaruh likuiditas, leverage, pertumbuhan, jaminan asset profitabilitas kebijakan dividen studi empiris perusahaan manufaktur tercatat bei periode 2006-2010 perbandingan pegangan raket (upper grips lower grips) kecepatan akurasi shuttlecock saat melakukan teknik overhead backhand smash cabang olahraga bulutangkis studi deskriptif kuantitatif ukm bulutangkis universitas pendidikan indonesia meningkatkan kemampuan siswa menulis karangan deskripsi menggunakan metode karyawisata siswa kelas v sdn ciketrung i profil psikomotorik siswa smk pertanian pembangunan negeri tanjungsari praktek membuat akuarium mata pelajaran keteknikan budidaya perikanan kepemimpinan ketua penyelenggara meningkatkan kinerja pendidik paud (studi kelompok bermain arya kikis desa kagok kecamatan banjaran kabupaten majalengka) pengaruh metode latihan kesegaran jasmani awal peningkatan kesegaran jasmani studi eksperimen perwira siswa pria secapaad pengaruh agribisnis hortikultura kesejahteraan petani kelompok tani kawasan agropolitan kecamatan pacet kabupaten cianjur pengaruh agribisnis hortikultura kesejahteraan petani kelompok tani kawasan agropolitan kecamatan pacet kabupaten cianjur ajén seni dina lais kabupatén garut pikeun bahan pangajaran maca bahasan sma kelas xii pengembangan model pembelajaran pendidikan agama islam multikultur menanamkan sikap kerjasama, toleransi saling menghormati interpretasi porno melalui inferensi pragmatik lirik lagu dangdut album “kamasutra” dipopulerkan oleh julia perez pengaruh metode pembelajaran unplugged konsep dasar tik hasil belajar siswa smk kelas x siswa kelas x jurusan komputer teknik jaringan smk pasundan 1 cimahi hubungan antara pelayanan kesejahteraan berbeda prestasi belajar siswa studi perbandingan antara dua sma kodya bandung pembinaan kepedulian siswa lingkungan sekolah menengah umum melalui mata pelajaran ppkn, pendidikan agama ipa ips smun 12 bandung
continue reading Analisis Data